Citrus Sinensis ID: 043683


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
cccHHHcccccccccccccccccHHHHHHHccccccccEEEEEEcccccccccccHHHHHccccEEEEcccccccccccccccccEEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
cccEEEEEcccccccccEEEccHHHHHHHHHccccccEEEEEEEEcccccEccccHHHHHHHHHEEEccccccccccccccHHHHEEEcccccHHHHHccccHHHHHHcccccccccccHcccccHHHHHHHccEEEccccccEEcccccccHHHHcEEcccccHHHcccccccccccEEEccccccHHcccccHHHHHHHHHHHccHccccHcccccHHcHHHHHHHHcccccHHHHHHHHHHHcccccEEcccc
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSkvkeihlnpDTFRKMLRYFhwhgcplkslpsnihleklvllemphsnIQQLLDSVRGiltrtpntplgqhlntlvlpenigqlsslgkldlqknnferiPESVIQLSKLGRLCLRYWERlqslpklpcklheldahhcTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
mgweivrqESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTAleslsglfssfeARTQYFDLRIledalqetqlleaalWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
*************LGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCW*
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
*GWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKMLRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLSGLFSSFEARTQYFDLRILEDALQETQLLEAALWKEILVCLCSFGFCMKCILNQIHNTYSIKCWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
O82500 1095 Putative disease resistan no no 0.730 0.170 0.277 7e-10
Q40392 1144 TMV resistance protein N N/A no 0.0 0.0 0.568 1e-09
Q9SZ67 1895 Probable WRKY transcripti no no 0.375 0.050 0.328 1e-07
O23530 1301 Protein SUPPRESSOR OF npr no no 0.648 0.127 0.276 3e-06
B5DX45 629 Leucine-rich repeat prote yes no 0.472 0.192 0.313 0.0002
B4IBI9 683 Leucine-rich repeat prote N/A no 0.472 0.177 0.305 0.0003
B3P3E8 644 Leucine-rich repeat prote N/A no 0.316 0.125 0.358 0.0003
B4PU77 645 Leucine-rich repeat prote N/A no 0.316 0.125 0.358 0.0003
B4QVR7 680 Leucine-rich repeat prote N/A no 0.472 0.177 0.305 0.0003
Q9VEK6 641 Leucine-rich repeat prote yes no 0.316 0.126 0.358 0.0003
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function desciption
 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 108/231 (46%), Gaps = 44/231 (19%)

Query: 1   MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVK-EIHLNPDTF 59
           +G E+VR++S+ + GKR +L + +++   L++N G   + GI L M ++K E++++  TF
Sbjct: 491 LGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTF 550

Query: 60  RKM----------------------------------LRYFHWHGCPLKSLPSNIHLEKL 85
            +M                                  LR  HW   PL+  PS+   E L
Sbjct: 551 EEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECL 610

Query: 86  VLLEMPHSNIQQLLDSVRGILT-RTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQ-KNNF 143
           V L M HS +++L   V+ +   RT N  L    N  +LP N+ + + L +LDL    + 
Sbjct: 611 VELNMSHSKLKKLWSGVQPLRNLRTMN--LNSSRNLEILP-NLMEATKLNRLDLGWCESL 667

Query: 144 ERIPESVIQLSKLGRLCLRYWERLQSLP---KLPCKLHELDAHHCTALESL 191
             +P S+  L  L  L +   ++L+ +P    LP  L  L   +CT L++ 
Sbjct: 668 VELPSSIKNLQHLILLEMSCCKKLEIIPTNINLPS-LEVLHFRYCTRLQTF 717





Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 Back     alignment and function description
>sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
255573549 908 ATP binding protein, putative [Ricinus c 0.679 0.191 0.349 6e-24
359493489 1092 PREDICTED: TMV resistance protein N-like 0.667 0.156 0.364 6e-22
356554611 1114 PREDICTED: TMV resistance protein N-like 0.738 0.169 0.316 2e-19
357515077 1266 NBS-LRR resistance-like protein 4G [Medi 0.789 0.159 0.340 6e-19
357471111 1264 NBS-LRR resistance-like protein 4G [Medi 0.789 0.159 0.340 8e-19
255561520 465 conserved hypothetical protein [Ricinus 0.425 0.234 0.388 2e-18
105922468 581 NBS type disease resistance protein [Pop 0.679 0.299 0.331 3e-18
224145028 709 nbs-lrr resistance protein [Populus tric 0.792 0.286 0.300 1e-17
359493273 1233 PREDICTED: TMV resistance protein N-like 0.769 0.159 0.326 2e-17
356506541 913 PREDICTED: TMV resistance protein N-like 0.628 0.176 0.340 3e-17
>gi|255573549|ref|XP_002527699.1| ATP binding protein, putative [Ricinus communis] gi|223532930|gb|EEF34698.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 110/226 (48%), Gaps = 52/226 (23%)

Query: 1   MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFR 60
           MGWEIVRQES+ + G RS LW+HE+    LTSN G   + GI L +SK+ ++ L+ D+F 
Sbjct: 489 MGWEIVRQESIYEPGSRSRLWNHEEIYHVLTSNKGTGAVRGINLDLSKIHKLCLSSDSFT 548

Query: 61  KM----------------------------------LRYFHWHGCPLKSLPSNIHLEKLV 86
           +M                                  LR  HW   PL SLPSN    +LV
Sbjct: 549 RMGNLKFLKFYTPFSKYWEDDSKLYALEGLAYLPASLRLLHWDRYPLNSLPSNFEPRQLV 608

Query: 87  LLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNNFERI 146
            L + HS ++ L +  +                  +L  +  +LSSL  LDL+ NNF  I
Sbjct: 609 ELILCHSKLELLWEGAK------------------LLESSFSRLSSLEHLDLRGNNFSNI 650

Query: 147 PESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHHCTALESLS 192
           P  + QL  L  L +     L+SLP+LP  +  ++AH CT+LES+S
Sbjct: 651 PGDIRQLFHLKLLDISSCSNLRSLPELPSHIEYVNAHDCTSLESVS 696




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359493489|ref|XP_002264004.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554611|ref|XP_003545638.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information
>gi|357515077|ref|XP_003627827.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355521849|gb|AET02303.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] Back     alignment and taxonomy information
>gi|357471111|ref|XP_003605840.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355506895|gb|AES88037.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] Back     alignment and taxonomy information
>gi|255561520|ref|XP_002521770.1| conserved hypothetical protein [Ricinus communis] gi|223538983|gb|EEF40580.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|105922468|gb|ABF81418.1| NBS type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356506541|ref|XP_003522038.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.277 0.054 0.444 4.4e-14
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.246 0.051 0.523 1.5e-10
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.238 0.053 0.555 1.6e-10
TAIR|locus:21337421039 AT4G09430 [Arabidopsis thalian 0.214 0.052 0.454 2e-10
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.484 0.104 0.358 2.5e-09
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.246 0.045 0.428 9.1e-09
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.246 0.040 0.428 2.4e-08
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 0.234 0.048 0.4 6.3e-08
TAIR|locus:2153072 1229 AT5G51630 [Arabidopsis thalian 0.464 0.096 0.353 7.2e-08
UNIPROTKB|Q5F4C4 529 SHOC2 "Leucine-rich repeat pro 0.625 0.302 0.283 1.8e-07
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 4.4e-14, Sum P(2) = 4.4e-14
 Identities = 32/72 (44%), Positives = 47/72 (65%)

Query:   117 HLNTLVLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCLRYWERLQSLP-KLPC 175
             ++N   +P +IG L +L +LDL  NNFE IP S+ +L++L RL L   +RLQ+LP +LP 
Sbjct:   964 NMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPR 1023

Query:   176 KLHELDAHHCTA 187
              L  +  H CT+
Sbjct:  1024 GLLYIYIHSCTS 1035


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2133742 AT4G09430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F4C4 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-17
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 81.1 bits (200), Expect = 2e-17
 Identities = 69/247 (27%), Positives = 103/247 (41%), Gaps = 59/247 (23%)

Query: 1   MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFR 60
           MG EIVR +S N+ G+R +L   +D    L  N G   + GI L + ++ E+H++ + F+
Sbjct: 497 MGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFK 555

Query: 61  KM---------------------------------LRYFHWHGCPLKSLPSNIHLEKLVL 87
            M                                 LR   W   PL+ +PSN   E LV 
Sbjct: 556 GMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVK 615

Query: 88  LEMPHSNIQQLLDSVRGI-------------LTRTPNTPLGQHLNTLV---------LPE 125
           L+M  S +++L D V  +             L   P+  +  +L TL          LP 
Sbjct: 616 LQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPS 675

Query: 126 NIGQLSSLGKLDLQK-NNFERIPESVIQLSKLGRLCLRYWERLQSLPKLPCKLHELDAHH 184
           +I  L+ L  LD+ +  N E +P + I L  L RL L    RL+S P +   +  LD   
Sbjct: 676 SIQYLNKLEDLDMSRCENLEILP-TGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDE 734

Query: 185 CTALESL 191
            TA+E  
Sbjct: 735 -TAIEEF 740


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.52
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.43
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.38
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.32
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.2
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.19
KOG0617264 consensus Ras suppressor protein (contains leucine 99.1
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.06
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.95
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.91
KOG4237498 consensus Extracellular matrix protein slit, conta 98.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.79
PLN03150623 hypothetical protein; Provisional 98.78
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.42
PLN03150623 hypothetical protein; Provisional 98.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.3
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.25
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.19
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.09
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.74
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.7
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.56
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.51
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.47
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.36
PRK15386 426 type III secretion protein GogB; Provisional 97.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.2
PRK15386 426 type III secretion protein GogB; Provisional 97.01
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.79
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.5
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.93
smart0037026 LRR Leucine-rich repeats, outliers. 93.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.74
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 93.67
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 92.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.29
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.31
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.02
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 81.37
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.83  E-value=1.1e-20  Score=191.89  Aligned_cols=190  Identities=33%  Similarity=0.544  Sum_probs=133.1

Q ss_pred             ChhhhhhhhcccCCCCccccCCcccHHHHHhhccccCccceeEeeCCCCeeeecChHHHHhh------------------
Q 043683            1 MGWEIVRQESMNDLGKRSWLWHHEDSIKFLTSNAGRILIEGICLGMSKVKEIHLNPDTFRKM------------------   62 (256)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~l~l~~l~~~~l~~~~f~~l------------------   62 (256)
                      |||+||++++ .+||+|+|+|.++|++++++.++++..++++.+|++....+.+..++|.+|                  
T Consensus       497 ~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~  575 (1153)
T PLN03210        497 MGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKE  575 (1153)
T ss_pred             HHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEeccccccccc
Confidence            8999999998 699999999999999999999999999999999998888888888888777                  


Q ss_pred             ---------------hhhhhccCCCCCccCCccccCCccEEeCcCCcchhhHHHHHHhcccCCCCchhhc--cCcccccc
Q 043683           63 ---------------LRYFHWHGCPLKSLPSNIHLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQH--LNTLVLPE  125 (256)
Q Consensus        63 ---------------L~~L~ls~n~l~~lp~~~~l~~L~~L~L~~n~l~~l~~~L~~Ll~~lp~~~l~~~--L~~L~lp~  125 (256)
                                     |+.|++.+|++..+|..+.+.+|++|++++|+++.+|.+...+ ..+..+.+.++  ++  .+| 
T Consensus       576 ~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l-~~Lk~L~Ls~~~~l~--~ip-  651 (1153)
T PLN03210        576 VRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSL-TGLRNIDLRGSKNLK--EIP-  651 (1153)
T ss_pred             ceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccC-CCCCEEECCCCCCcC--cCC-
Confidence                           3444555666777777777788888899888888775443331 11111111111  11  123 


Q ss_pred             ccCCCCCCcEEEcc-CCCCccccccccCCCCCCEEeeccCcCCcccCCC--CCCCcEEeccCcccccccccch
Q 043683          126 NIGQLSSLGKLDLQ-KNNFERIPESVIQLSKLGRLCLRYWERLQSLPKL--PCKLHELDAHHCTALESLSGLF  195 (256)
Q Consensus       126 ~~~~l~~L~~L~l~-~n~l~~lp~~i~~l~~L~~L~l~~~~~l~~lp~~--l~~L~~L~l~~~~~l~~~p~~~  195 (256)
                      .++.+++|++|+++ |+.+..+|..++.+++|+.|++++|+.++.+|..  +++|++|++++|..+..+|...
T Consensus       652 ~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~  724 (1153)
T PLN03210        652 DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDIS  724 (1153)
T ss_pred             ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCcccccccc
Confidence            24556667777766 3445566666666677777777666666666654  5666666666666665555443



syringae 6; Provisional

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 63.0 bits (154), Expect = 7e-12
 Identities = 30/129 (23%), Positives = 54/129 (41%), Gaps = 21/129 (16%)

Query: 63  LRYFHWHGCPLKSLPSNI-HLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTL 121
           L+        ++SLP++I +L+ L  L++ +S +  L  ++   L           L  L
Sbjct: 185 LQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAI-HHLP---------KLEEL 234

Query: 122 ---------VLPENIGQLSSLGKLDLQ-KNNFERIPESVIQLSKLGRLCLRYWERLQSLP 171
                      P   G  + L +L L+  +N   +P  + +L++L +L LR    L  LP
Sbjct: 235 DLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLP 294

Query: 172 KLPCKLHEL 180
            L  +L   
Sbjct: 295 SLIAQLPAN 303


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.64
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.46
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.43
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.42
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.41
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.4
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.4
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.4
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.4
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.39
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.39
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.39
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.38
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.38
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.38
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.38
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.37
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.36
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.33
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.33
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.33
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.3
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.3
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.3
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.28
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.28
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.28
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.27
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.25
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.24
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.21
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.2
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.13
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.01
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.01
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.98
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.98
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.94
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.86
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.75
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.58
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.58
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.57
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.46
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.15
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.82
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.76
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.75
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.73
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.29
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.86
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.8
4fs7_A 394 Uncharacterized protein; leucine-rich repeats, pro 92.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.44
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 91.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 88.89
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 86.38
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.64  E-value=2.6e-16  Score=138.27  Aligned_cols=164  Identities=21%  Similarity=0.309  Sum_probs=115.0

Q ss_pred             CccceeEeeCCCCeeeecChHHHHhh--hhhhhccCCCCCccCCcc-ccCCccEEeCcCCcchhhHHHHHH------h--
Q 043683           37 ILIEGICLGMSKVKEIHLNPDTFRKM--LRYFHWHGCPLKSLPSNI-HLEKLVLLEMPHSNIQQLLDSVRG------I--  105 (256)
Q Consensus        37 ~~~~~~~l~l~~l~~~~l~~~~f~~l--L~~L~ls~n~l~~lp~~~-~l~~L~~L~L~~n~l~~l~~~L~~------L--  105 (256)
                      ..+..+.+.-..+.  .+... +..+  |++|++++|.+..+|..+ .+++|++|++++|.++.++..+..      |  
T Consensus        81 ~~l~~L~L~~n~l~--~lp~~-l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L  157 (328)
T 4fcg_A           81 PGRVALELRSVPLP--QFPDQ-AFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSI  157 (328)
T ss_dssp             TTCCEEEEESSCCS--SCCSC-GGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEE
T ss_pred             cceeEEEccCCCch--hcChh-hhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEEC
Confidence            44454444333333  34332 3334  899999999988999888 899999999999988866333222      2  


Q ss_pred             -----cccCCCCchh---------hc--cCcc--------ccccccCCCCCCcEEEccCCCCccccccccCCCCCCEEee
Q 043683          106 -----LTRTPNTPLG---------QH--LNTL--------VLPENIGQLSSLGKLDLQKNNFERIPESVIQLSKLGRLCL  161 (256)
Q Consensus       106 -----l~~lp~~~l~---------~~--L~~L--------~lp~~~~~l~~L~~L~l~~n~l~~lp~~i~~l~~L~~L~l  161 (256)
                           ++.+|.. ++         ++  |+.|        .+|..++.+++|++|++++|+++.+|+.++.+++|++|++
T Consensus       158 ~~n~~~~~~p~~-~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~L  236 (328)
T 4fcg_A          158 RACPELTELPEP-LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDL  236 (328)
T ss_dssp             EEETTCCCCCSC-SEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEEC
T ss_pred             CCCCCccccChh-HhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEEC
Confidence                 2334432 11         11  3333        5677788888888888888888888888888888888888


Q ss_pred             ccCcCCcccCCC---CCCCcEEeccCcccccccccchhchhhhhhc
Q 043683          162 RYWERLQSLPKL---PCKLHELDAHHCTALESLSGLFSSFEARTQY  204 (256)
Q Consensus       162 ~~~~~l~~lp~~---l~~L~~L~l~~~~~l~~~p~~~~~l~~l~~l  204 (256)
                      ++|+..+.+|..   +++|++|++++|...+.+|..++++++++.+
T Consensus       237 s~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L  282 (328)
T 4fcg_A          237 RGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKL  282 (328)
T ss_dssp             TTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEE
T ss_pred             cCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEE
Confidence            888877777765   7788888888888888888888777776654



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.31
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.31
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.26
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.26
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.25
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.23
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.14
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.13
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.11
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.1
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.09
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.99
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.83
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.8
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.7
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.77
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.33
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.16
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.11
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 87.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 86.65
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.47  E-value=7.8e-14  Score=103.90  Aligned_cols=95  Identities=25%  Similarity=0.349  Sum_probs=83.4

Q ss_pred             hhhhccCCCCCccCCcc-ccCCccEEeCcCCcchhhHHHHHHhcccCCCCchhhccCccccccccCCCCCCcEEEccCCC
Q 043683           64 RYFHWHGCPLKSLPSNI-HLEKLVLLEMPHSNIQQLLDSVRGILTRTPNTPLGQHLNTLVLPENIGQLSSLGKLDLQKNN  142 (256)
Q Consensus        64 ~~L~ls~n~l~~lp~~~-~l~~L~~L~L~~n~l~~l~~~L~~Ll~~lp~~~l~~~L~~L~lp~~~~~l~~L~~L~l~~n~  142 (256)
                      |+|++++|.++.+|. + .+++|++|++++|.++.+                         |..++.+++|++|++++|.
T Consensus         1 R~L~Ls~n~l~~l~~-l~~l~~L~~L~ls~N~l~~l-------------------------p~~~~~l~~L~~L~l~~N~   54 (124)
T d1dcea3           1 RVLHLAHKDLTVLCH-LEQLLLVTHLDLSHNRLRAL-------------------------PPALAALRCLEVLQASDNA   54 (124)
T ss_dssp             SEEECTTSCCSSCCC-GGGGTTCCEEECCSSCCCCC-------------------------CGGGGGCTTCCEEECCSSC
T ss_pred             CEEEcCCCCCCCCcc-cccCCCCCEEECCCCccCcc-------------------------hhhhhhhhccccccccccc
Confidence            678999999999974 7 899999999999999754                         7778899999999999999


Q ss_pred             CccccccccCCCCCCEEeeccCcCCcccCCC-----CCCCcEEeccCcc
Q 043683          143 FERIPESVIQLSKLGRLCLRYWERLQSLPKL-----PCKLHELDAHHCT  186 (256)
Q Consensus       143 l~~lp~~i~~l~~L~~L~l~~~~~l~~lp~~-----l~~L~~L~l~~~~  186 (256)
                      ++.+| +++.+++|+.|++++ +.+..+|..     +++|++|++++|+
T Consensus        55 i~~l~-~~~~l~~L~~L~l~~-N~i~~~~~~~~l~~~~~L~~L~l~~N~  101 (124)
T d1dcea3          55 LENVD-GVANLPRLQELLLCN-NRLQQSAAIQPLVSCPRLVLLNLQGNS  101 (124)
T ss_dssp             CCCCG-GGTTCSSCCEEECCS-SCCCSSSTTGGGGGCTTCCEEECTTSG
T ss_pred             ccccC-ccccccccCeEECCC-CccCCCCCchhhcCCCCCCEEECCCCc
Confidence            99997 589999999999998 567777753     7899999999876



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure