Citrus Sinensis ID: 043706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580------
MYWKLQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMDTSSSAKPEKKQPVEAVTTVAKTEHATWSCLKMIKGEETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFGTR
cccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEccccEEEEccccccccccEEEccccccccccccccccccccEEEccccccEEEccHHHHHccccccEEEcccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEHHHHHHHHccccccccccccccccccccccccccHHHHHHcccccccHHEcccccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEEcccccHHHHHHcccccEEccccccEEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEcccccccHHHHHHccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccEEcccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEccccccccccccccccccEEEEccccccccccHHHcccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccHHHHHHHHHcccccccccccccHHHHccccccccccEEccccccccccccHHHccccccEEEccccccccccccccHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccHHHEHHHHHHcHHcEEEcccccEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHcccccHHHEEEEEccccccEEEEEccccccHHHHHcccccccccccccccccccc
mywklqnrqsvkgTMGFILFAFVFLHLvpsfglntdgVLLLSFKYsilsdplsvlqnwnyddatpcswtgvtctqidattipgspdMFRVISLIlpnsqllgsvtkDLGLIQHlrhldlsnnffngslplsifsATELQVLSLsnnaisgelpdligqiprlqlLNLSVnalagkvprnltavKSLTVVSLRsnyfsgsipsgfTSVEVLDLSsnlfngslpldfgggnlrylNLSYnkisgsispefakripqnvtidlsfnnltgaipgalplvnqrmesfsgnvelcgkplknlcsipstlstppnvstttspaiavipksidsvpvtnsspaaatgaqnqrpglkpgtIAAIAVADLAGIGLLAFIVFYVYQLKKrkaldksvmdtsssakpekkqpvEAVTTVAKTEHATWSCLKMikgeetsdantssdsdqdggnneyedHANVVQqqeskrgasgtlvtvdgetELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKlkhpnlvklrgfywedEEKLLIHDyvsngclasfsfthaskFHLFFAIIHPFGTR
mywklqnrqsvKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSVPVTNSSPAAatgaqnqrpglKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMdtsssakpekkqpveAVTTVAKTEHATWSCLKMikgeetsdantsSDSDQDGGNNEYEDHANVvqqqeskrgasgtLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKaiaklkhpnlvklRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFGTR
MYWKLQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIpstlstppnvstttspAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMDTSSSAKPEKKQPVEAVTTVAKTEHATWSCLKMIKGEETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFGTR
*********SVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSI**************************************************GTIAAIAVADLAGIGLLAFIVFYVYQLKK***************************TVAKTEHATWSCLKMI******************************************LVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPF***
*************TMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSVPVT**********************AAIAVADLAGIGLLAFIVFYVYQLKKRK*************************TVAKTEHATWSCLKMIKGEET*********DQDGGNNEY*******************LVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCF***KDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFG**
********QSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTL*********TSPAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKA*************************VAKTEHATWSCLKMIKGE****************NNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFGTR
MYWKLQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMDTSSSAKPEKKQPVEAVTTVAKTEHATWSCLKMIKGEETSDANTSSDSDQDGGNNEYEDHA*********RGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTH*****************
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYWKLQNRQSVKGTMGFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMDTSSSAKPEKKQPVEAVTTVAKTEHATWSCLKMIKGEETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAVLADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNGCLASFSFTHASKFHLFFAIIHPFGTR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query586 2.2.26 [Sep-21-2011]
Q94C77 757 Receptor protein kinase-l yes no 0.911 0.705 0.540 1e-161
C0LGS3 768 Probable LRR receptor-lik no no 0.895 0.683 0.479 1e-135
Q9C9N5 685 Probable inactive leucine no no 0.795 0.680 0.342 7e-69
Q84MA9 652 Inactive leucine-rich rep no no 0.730 0.656 0.288 2e-37
C0LGP9 784 Probable leucine-rich rep no no 0.866 0.647 0.261 1e-35
C0LGQ9 1037 Probable LRR receptor-lik no no 0.788 0.445 0.293 3e-34
Q9M9C5 670 Probable leucine-rich rep no no 0.718 0.628 0.277 2e-33
Q9C9Y8 640 Probable inactive recepto no no 0.697 0.639 0.272 6e-33
Q9LP77 655 Probable inactive recepto no no 0.711 0.636 0.256 4e-32
Q9SGP2 996 Receptor-like protein kin no no 0.457 0.269 0.316 5e-30
>sp|Q94C77|RPKL_ARATH Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1 Back     alignment and function desciption
 Score =  567 bits (1462), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 305/564 (54%), Positives = 390/564 (69%), Gaps = 30/564 (5%)

Query: 18  ILFAFVFLHL--VPSF--GLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTC 73
           +LF+ V  H   VP+    LNTDGVLLL+FKYSIL+DPLSVL+NWNYDDATPC WTGVTC
Sbjct: 8   LLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTC 67

Query: 74  TQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIF 133
           T++     P +PDMFRV SL+LPN  LLGS+T DL  I +LR LDLS+NFFNGSLP S+F
Sbjct: 68  TELGK---PNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVF 124

Query: 134 SATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRS 193
           +ATELQ +SL +N +SG+LP  +  +  LQLLNLS NA  G++P N++ +K+LTVVSL  
Sbjct: 125 NATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSK 184

Query: 194 NYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIP 253
           N FSG IPSGF + ++LDLSSNL NGSLP D GG +L YLNLS+NK+ G ISP FA++ P
Sbjct: 185 NTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFP 244

Query: 254 QNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTT 313
            N T+DLSFNNLTG IP +L L+NQ+ ESFSGN ELCGKPLK LCSIPSTLS PPN+S T
Sbjct: 245 ANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISET 304

Query: 314 TSPAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFY 373
           TSPAIAV P+S  + P+   +P      Q  +  LKP TIAAI VAD+ G+  +  +V Y
Sbjct: 305 TSPAIAVKPRS--TAPI---NPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLY 359

Query: 374 VYQLKKRKALDKSVMDTS-----SSAKPEKKQPVEAVTTVAKTEHATWSCLKMI-----K 423
           VYQ++KR+   +S   +         + +K +P     TV ++  A  +C   I     +
Sbjct: 360 VYQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTEVTVPESPEAKTTCGSCIILTGGR 419

Query: 424 GEETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKAS 483
            +ETS + +  ++ Q        D   + Q  +++      LVTVDGET L+++TL KAS
Sbjct: 420 YDETSTSESDVENQQTVQAFTRTDGGQLKQSSQTQ------LVTVDGETRLDLDTLLKAS 473

Query: 484 AYILCTSSSSIVYKAVLADGTTLAVRRI-GETC-FERLKDLESQVKAIAKLKHPNLVKLR 541
           AYIL T+ + IVYKAVL +GT  AVRRI  E+C   + K+ E +V+AIAKL+HPNLV++R
Sbjct: 474 AYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIR 533

Query: 542 GFYWEDEEKLLIHDYVSNGCLASF 565
           GF W D+EKLLI DYV NG L  F
Sbjct: 534 GFCWGDDEKLLISDYVPNGSLLCF 557

Arabidopsis thaliana (taxid: 3702)
>sp|C0LGS3|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=1 SV=1 Back     alignment and function description
>sp|Q84MA9|Y1063_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 OS=Arabidopsis thaliana GN=At1g60630 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 Back     alignment and function description
>sp|Q9M9C5|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400 OS=Arabidopsis thaliana GN=At1g68400 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9Y8|Y3868_ARATH Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP77|Y1848_ARATH Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query586
255555297 736 Interleukin-1 receptor-associated kinase 0.918 0.730 0.648 0.0
224060574 757 predicted protein [Populus trichocarpa] 0.907 0.702 0.631 0.0
225428900 1004 PREDICTED: receptor protein kinase-like 0.880 0.513 0.603 1e-176
356574280 1118 PREDICTED: receptor protein kinase-like 0.901 0.472 0.616 1e-175
356536160 760 PREDICTED: receptor protein kinase-like 0.901 0.694 0.619 1e-175
449446097 750 PREDICTED: receptor protein kinase-like 0.883 0.690 0.600 1e-164
18418404 757 receptor protein kinase-like protein [Ar 0.911 0.705 0.540 1e-159
297798486 757 hypothetical protein ARALYDRAFT_491249 [ 0.914 0.708 0.544 1e-159
2911040 980 receptor protein kinase-like protein [Ar 0.911 0.544 0.540 1e-158
224084402 773 predicted protein [Populus trichocarpa] 0.923 0.699 0.533 1e-153
>gi|255555297|ref|XP_002518685.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis] gi|223542066|gb|EEF43610.1| Interleukin-1 receptor-associated kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/558 (64%), Positives = 433/558 (77%), Gaps = 20/558 (3%)

Query: 29  PSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQIDATTIPGSPDMF 88
           P+F LNTDG+LLLSFKYS LSDPLSVL++WNYDD TPCSW GVTCT++    + G+PDMF
Sbjct: 24  PTFALNTDGILLLSFKYSTLSDPLSVLESWNYDDDTPCSWNGVTCTELG---LQGTPDMF 80

Query: 89  RVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAI 148
           RV SL+LP+SQLLGS+  DLG IQHL+HLDLSNN+ NGSLP SIF+ATEL+V+SLS N I
Sbjct: 81  RVTSLVLPSSQLLGSIPPDLGFIQHLKHLDLSNNYLNGSLPSSIFNATELEVISLSGNEI 140

Query: 149 SGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTSVE 208
           SGEL + IG +  LQLLNLS NALAGKVP+NLT++++LTVVSLRSNYFSG +PSGF SV+
Sbjct: 141 SGELSESIGGMKNLQLLNLSDNALAGKVPKNLTSLQNLTVVSLRSNYFSGYVPSGFNSVQ 200

Query: 209 VLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGA 268
           VLDLSSNL NGSLPLDFGG NLRYLNLSYNK+SG IS  FAK I QN TIDLSFNNLTGA
Sbjct: 201 VLDLSSNLLNGSLPLDFGGANLRYLNLSYNKLSGQISQAFAKEIAQNATIDLSFNNLTGA 260

Query: 269 IPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPKSIDSV 328
           IP +L L+NQ+ ESF GN++LCGKPLKNLCSIPSTLSTPPN+S TTSPAIAVIPK ++S 
Sbjct: 261 IPESLSLLNQKTESFKGNIDLCGKPLKNLCSIPSTLSTPPNIS-TTSPAIAVIPKPLEST 319

Query: 329 PVTNSSPA--AATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKS 386
           PVTN+S     A+G Q Q  GLKP T+ AI VADLAGI +LA  + YVYQLKK+K L+ +
Sbjct: 320 PVTNTSSGNQKASGNQTQN-GLKPTTVIAIVVADLAGITILALAILYVYQLKKKKTLNHT 378

Query: 387 VMDTSSSAKPEKKQPVEAVTTVAKTEH-------ATWSCLKMIKGEETSDANTSSDSDQD 439
             +       +K QP E+++T  KT+         TWSCL  IK EETS+ + +SDSD++
Sbjct: 379 STNDYLPKSEQKLQP-ESIST--KTDQLAESRKPITWSCLP-IKAEETSEESATSDSDRE 434

Query: 440 GGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASAYILCTSSSSIVYKAV 499
           G   + E            +   G LV VDGETE+++ETL KASAYIL  S +SIVYKAV
Sbjct: 435 GSGQQNESSNQWYGSSHHPQQKGGKLVIVDGETEMDMETLLKASAYILGASGASIVYKAV 494

Query: 500 LADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSN 559
           LADGT  AVRRIGE+  ER KD E+QV+ I+K++HPNLV++RGFYW D+EKL+I+DYVSN
Sbjct: 495 LADGTAFAVRRIGESGIERFKDFENQVRFISKMRHPNLVRIRGFYWGDDEKLVIYDYVSN 554

Query: 560 GCLASFSFTH--ASKFHL 575
           G LAS SF    +S FHL
Sbjct: 555 GSLASSSFRKPGSSPFHL 572

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224060574|ref|XP_002300237.1| predicted protein [Populus trichocarpa] gi|222847495|gb|EEE85042.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428900|ref|XP_002282529.1| PREDICTED: receptor protein kinase-like protein At4g34220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356574280|ref|XP_003555277.1| PREDICTED: receptor protein kinase-like protein At4g34220-like [Glycine max] Back     alignment and taxonomy information
>gi|356536160|ref|XP_003536607.1| PREDICTED: receptor protein kinase-like protein At4g34220-like, partial [Glycine max] Back     alignment and taxonomy information
>gi|449446097|ref|XP_004140808.1| PREDICTED: receptor protein kinase-like protein At4g34220-like [Cucumis sativus] gi|449486742|ref|XP_004157387.1| PREDICTED: receptor protein kinase-like protein At4g34220-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18418404|ref|NP_567961.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|75165202|sp|Q94C77.1|RPKL_ARATH RecName: Full=Receptor protein kinase-like protein At4g34220; Flags: Precursor gi|14334872|gb|AAK59614.1| putative receptor protein kinase [Arabidopsis thaliana] gi|21281267|gb|AAM44951.1| putative receptor protein kinase [Arabidopsis thaliana] gi|224589647|gb|ACN59356.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332660943|gb|AEE86343.1| receptor protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798486|ref|XP_002867127.1| hypothetical protein ARALYDRAFT_491249 [Arabidopsis lyrata subsp. lyrata] gi|297312963|gb|EFH43386.1| hypothetical protein ARALYDRAFT_491249 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|2911040|emb|CAA17550.1| receptor protein kinase-like protein [Arabidopsis thaliana] gi|7270372|emb|CAB80139.1| receptor protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224084402|ref|XP_002307286.1| predicted protein [Populus trichocarpa] gi|222856735|gb|EEE94282.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query586
TAIR|locus:2124296 757 AT4G34220 [Arabidopsis thalian 0.921 0.713 0.526 3.9e-140
TAIR|locus:2049108 744 AT2G15300 [Arabidopsis thalian 0.924 0.728 0.519 3.2e-136
TAIR|locus:2115120 768 AT4G37250 [Arabidopsis thalian 0.889 0.678 0.486 1.5e-124
TAIR|locus:2058598 773 AT2G23300 [Arabidopsis thalian 0.894 0.677 0.486 1.9e-124
TAIR|locus:2157182 751 RLK "receptor-like kinase" [Ar 0.738 0.576 0.420 5.4e-79
TAIR|locus:2038706 716 AT2G01210 [Arabidopsis thalian 0.566 0.463 0.362 2.2e-78
TAIR|locus:2033000 702 AT1G25320 [Arabidopsis thalian 0.465 0.388 0.406 3.7e-74
TAIR|locus:2033379 685 AT1G66830 [Arabidopsis thalian 0.462 0.395 0.403 3.3e-69
TAIR|locus:2008793 719 AT1G67510 [Arabidopsis thalian 0.464 0.378 0.379 8.3e-69
TAIR|locus:2053751646 AT2G42290 [Arabidopsis thalian 0.329 0.298 0.344 3.7e-45
TAIR|locus:2124296 AT4G34220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1371 (487.7 bits), Expect = 3.9e-140, P = 3.9e-140
 Identities = 300/570 (52%), Positives = 380/570 (66%)

Query:    18 ILFAFVFLHL--VPSF--GLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTC 73
             +LF+ V  H   VP+    LNTDGVLLL+FKYSIL+DPLSVL+NWNYDDATPC WTGVTC
Sbjct:     8 LLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTC 67

Query:    74 TQIDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIF 133
             T++     P +PDMFRV SL+LPN  LLGS+T DL  I +LR LDLS+NFFNGSLP S+F
Sbjct:    68 TELGK---PNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVF 124

Query:   134 SATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRS 193
             +ATELQ +SL +N +SG+LP  +  +  LQLLNLS NA  G++P N++ +K+LTVVSL  
Sbjct:   125 NATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSK 184

Query:   194 NYFSGSIPSGFTSVEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIP 253
             N FSG IPSGF + ++LDLSSNL NGSLP D GG +L YLNLS+NK+ G ISP FA++ P
Sbjct:   185 NTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFP 244

Query:   254 QNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIXXXXXXXXXXXXX 313
              N T+DLSFNNLTG IP +L L+NQ+ ESFSGN ELCGKPLK LCSI             
Sbjct:   245 ANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISET 304

Query:   314 XXXAIAVIPKSIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFY 373
                AIAV P+S  + P+   +P      Q  +  LKP TIAAI VAD+ G+  +  +V Y
Sbjct:   305 TSPAIAVKPRS--TAPI---NPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLY 359

Query:   374 VYQLKKRKALDKSVMDT-------SSSAKPEKKQPVEAVTTVAKTEHATW--SCLKMIKG 424
             VYQ++KR+   +S   +        + AK  K    E VT     E  T   SC+ +  G
Sbjct:   360 VYQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTE-VTVPESPEAKTTCGSCIILTGG 418

Query:   425 EETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKASA 484
                 D  ++S+SD +  N +           + K+ +   LVTVDGET L+++TL KASA
Sbjct:   419 RY--DETSTSESDVE--NQQTVQAFTRTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASA 474

Query:   485 YILCTSSSSIVYKAVLADGTTLAVRRIG-ETCFE-RLKDLESQVKAIAKLKHPNLVKLRG 542
             YIL T+ + IVYKAVL +GT  AVRRI  E+C   + K+ E +V+AIAKL+HPNLV++RG
Sbjct:   475 YILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRG 534

Query:   543 FYWEDEEKLLIHDYVSNGCLASFSFTHASK 572
             F W D+EKLLI DYV NG L  F FT A+K
Sbjct:   535 FCWGDDEKLLISDYVPNGSLLCF-FT-ATK 562
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2049108 AT2G15300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115120 AT4G37250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058598 AT2G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157182 RLK "receptor-like kinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038706 AT2G01210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033000 AT1G25320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033379 AT1G66830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008793 AT1G67510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053751 AT2G42290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94C77RPKL_ARATHNo assigned EC number0.54070.91120.7054yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-24
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-18
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-06
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-06
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-06
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 7e-06
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-05
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 4e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-05
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-04
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-04
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 4e-04
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 4e-04
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 5e-04
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 0.001
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 0.004
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  147 bits (373), Expect = 3e-37
 Identities = 95/263 (36%), Positives = 144/263 (54%), Gaps = 21/263 (7%)

Query: 16  GFILFAFVFLHLVPSFGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCSWTGVTCTQ 75
            +++F   FL L  S     +  LLLSFK SI +DPL  L NWN   A  C W G+TC  
Sbjct: 10  PYLIFMLFFLFLNFSMLHAEELELLLSFKSSI-NDPLKYLSNWN-SSADVCLWQGITCNN 67

Query: 76  IDATTIPGSPDMFRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIF-S 134
                        RV+S+ L    + G ++  +  + +++ ++LSNN  +G +P  IF +
Sbjct: 68  SS-----------RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTT 116

Query: 135 ATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSN 194
           ++ L+ L+LSNN  +G +P   G IP L+ L+LS N L+G++P ++ +  SL V+ L  N
Sbjct: 117 SSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN 174

Query: 195 YFSGSIP---SGFTSVEVLDLSSNLFNGSLPLDFGG-GNLRYLNLSYNKISGSISPEFAK 250
              G IP   +  TS+E L L+SN   G +P + G   +L+++ L YN +SG I  E   
Sbjct: 175 VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG 234

Query: 251 RIPQNVTIDLSFNNLTGAIPGAL 273
               N  +DL +NNLTG IP +L
Sbjct: 235 LTSLN-HLDLVYNNLTGPIPSSL 256

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 586
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.81
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
PLN03150623 hypothetical protein; Provisional 99.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.6
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.59
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.56
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.56
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
PLN032101153 Resistant to P. syringae 6; Provisional 99.54
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.53
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.53
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.52
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.52
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.49
PLN032101153 Resistant to P. syringae 6; Provisional 99.48
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.48
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.38
PHA02988 283 hypothetical protein; Provisional 99.35
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.32
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.29
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.28
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.27
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.25
KOG4237498 consensus Extracellular matrix protein slit, conta 99.25
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.25
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.24
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.21
KOG3653 534 consensus Transforming growth factor beta/activin 99.2
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.18
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 99.18
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.18
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.16
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.15
PLN03150623 hypothetical protein; Provisional 99.15
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.15
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.14
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.14
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.14
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.13
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.13
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.13
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.13
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.12
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.12
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.12
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.11
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.11
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.1
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.1
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.1
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.1
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.1
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.1
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.09
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.09
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.09
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.09
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.08
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.08
KOG0605 550 consensus NDR and related serine/threonine kinases 99.08
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.08
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.08
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.08
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.08
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.08
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.07
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.07
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.06
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.06
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.06
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.06
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.06
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.06
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.06
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.06
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.06
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.05
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.05
PTZ00267 478 NIMA-related protein kinase; Provisional 99.05
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.05
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.05
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.05
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.05
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.05
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.04
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.04
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.04
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.04
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.04
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.03
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.03
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.03
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.03
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.03
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.03
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.02
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.02
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.02
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.02
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.02
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.02
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.02
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.02
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.02
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.02
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.02
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.01
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.01
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.01
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.01
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.01
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.01
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.0
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.0
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.99
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.99
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.99
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.99
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.99
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.99
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.99
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 98.99
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.99
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 98.99
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 98.98
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 98.98
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 98.98
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.98
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 98.98
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.98
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.98
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 98.98
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.98
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.98
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.98
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.98
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.98
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.98
KOG0582 516 consensus Ste20-like serine/threonine protein kina 98.98
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.97
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.97
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.97
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.97
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 98.97
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.97
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.97
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.97
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.97
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.97
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.97
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.97
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.96
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.96
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.96
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.96
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.96
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.96
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 98.96
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.96
KOG0589 426 consensus Serine/threonine protein kinase [General 98.96
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 98.96
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.95
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 98.95
KOG0198 313 consensus MEKK and related serine/threonine protei 98.95
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.95
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.95
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.95
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.95
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.95
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.95
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 98.95
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.95
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.94
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.94
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.94
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.94
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.94
KOG0583 370 consensus Serine/threonine protein kinase [Signal 98.94
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.94
PLN00034 353 mitogen-activated protein kinase kinase; Provision 98.94
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 98.93
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.93
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.93
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.93
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.93
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 98.93
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.93
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.93
KOG4721 904 consensus Serine/threonine protein kinase, contain 98.92
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.92
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.92
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.92
KOG0610 459 consensus Putative serine/threonine protein kinase 98.92
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.92
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.92
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.92
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.92
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.92
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.92
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.91
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.91
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.91
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 98.91
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.91
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 98.91
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.91
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.91
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.91
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.9
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.9
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.9
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 98.9
KOG0607 463 consensus MAP kinase-interacting kinase and relate 98.9
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.9
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.9
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.9
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.9
KOG0586 596 consensus Serine/threonine protein kinase [General 98.9
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.9
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.9
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.89
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.89
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.89
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.89
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.89
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.89
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.89
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.88
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.88
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.88
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.88
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.88
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.87
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.87
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.87
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.87
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 98.87
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.87
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.87
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.87
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.87
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.86
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.86
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.86
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 98.86
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 98.86
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.86
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.86
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.86
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.85
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 98.85
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.85
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 98.85
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 98.85
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.85
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.84
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 98.84
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.84
PTZ00266 1021 NIMA-related protein kinase; Provisional 98.84
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.84
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.83
KOG0578 550 consensus p21-activated serine/threonine protein k 98.83
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.83
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.83
KOG0661 538 consensus MAPK related serine/threonine protein ki 98.83
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.83
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.83
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.83
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 98.83
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.83
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.82
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.82
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 98.82
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.82
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.82
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.82
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.81
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 98.81
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.81
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.81
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 98.81
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 98.8
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.8
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.8
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 98.8
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.79
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.79
KOG0201 467 consensus Serine/threonine protein kinase [Signal 98.78
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 98.78
KOG1989 738 consensus ARK protein kinase family [Signal transd 98.78
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.78
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.78
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.77
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.77
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 98.77
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.77
PTZ00283 496 serine/threonine protein kinase; Provisional 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PHA03211 461 serine/threonine kinase US3; Provisional 98.75
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 98.75
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.75
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.75
PHA03212 391 serine/threonine kinase US3; Provisional 98.74
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.74
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.74
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 98.74
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.74
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.73
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.73
KOG0577 948 consensus Serine/threonine protein kinase [Signal 98.73
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.72
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 98.72
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.72
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 98.72
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.71
PLN00009 294 cyclin-dependent kinase A; Provisional 98.71
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.71
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.7
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.7
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.7
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.7
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.7
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.69
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 98.69
PRK09188 365 serine/threonine protein kinase; Provisional 98.69
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 98.68
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.68
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.68
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.67
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.67
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.67
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 98.66
PTZ00036 440 glycogen synthase kinase; Provisional 98.64
PHA03209 357 serine/threonine kinase US3; Provisional 98.64
KOG0694 694 consensus Serine/threonine protein kinase [Signal 98.64
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.63
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.62
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.62
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.62
PRK10345210 hypothetical protein; Provisional 98.61
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 98.61
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.61
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.6
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 98.6
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.6
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 98.58
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 98.58
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.58
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.57
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.57
PHA03207 392 serine/threonine kinase US3; Provisional 98.57
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 98.56
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.56
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.56
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.55
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 98.55
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.54
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 98.54
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.53
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.52
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.52
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 98.51
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 98.51
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.5
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.5
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.5
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 98.5
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.49
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.49
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.49
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.46
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.45
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.45
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 98.44
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.43
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.42
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 98.41
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.41
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.39
PRK14879 211 serine/threonine protein kinase; Provisional 98.37
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.37
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.37
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 98.35
PTZ00284 467 protein kinase; Provisional 98.34
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.33
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 98.29
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.29
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.29
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.27
KOG0584 632 consensus Serine/threonine protein kinase [General 98.25
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 98.23
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.21
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.21
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 98.2
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.19
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.18
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.18
PHA03210 501 serine/threonine kinase US3; Provisional 98.15
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.15
KOG0596 677 consensus Dual specificity; serine/threonine and t 98.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.14
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.14
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.09
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 98.05
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 97.92
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 97.87
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 97.86
KOG1152772 consensus Signal transduction serine/threonine kin 97.86
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.71
KOG0696 683 consensus Serine/threonine protein kinase [Signal 97.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.67
smart00090237 RIO RIO-like kinase. 97.64
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 97.64
KOG1027 903 consensus Serine/threonine protein kinase and endo 97.63
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 97.61
PRK15386426 type III secretion protein GogB; Provisional 97.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.56
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 97.54
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 97.5
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG0695 593 consensus Serine/threonine protein kinase [Signal 97.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.35
PRK12274 218 serine/threonine protein kinase; Provisional 97.34
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 97.29
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 97.29
KOG1167 418 consensus Serine/threonine protein kinase of the C 97.18
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.15
PHA02882 294 putative serine/threonine kinase; Provisional 97.15
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 97.1
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 97.1
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.01
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.0
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.0
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 96.96
COG0515 384 SPS1 Serine/threonine protein kinase [General func 96.91
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 96.84
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 96.73
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 96.7
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 96.69
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 96.63
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 96.55
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.35
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 96.23
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 96.22
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 96.08
KOG1290 590 consensus Serine/threonine protein kinase [Signal 96.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.95
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 95.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.12
KOG4308478 consensus LRR-containing protein [Function unknown 95.09
COG0661 517 AarF Predicted unusual protein kinase [General fun 94.79
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 94.75
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 94.62
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 94.54
KOG1235 538 consensus Predicted unusual protein kinase [Genera 94.0
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 93.79
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.77
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-39  Score=381.98  Aligned_cols=376  Identities=25%  Similarity=0.409  Sum_probs=221.2

Q ss_pred             CceEEEEcCCCCCcccCccccCCCCCCCEEEccCCCCCCCCCccccCCCCCcEEEeeCCCCCCCCccccCCCCCCcEEEc
Q 043706           88 FRVISLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNL  167 (586)
Q Consensus        88 ~~l~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L  167 (586)
                      .+++.|+|++|.+.+.+|..+..++.|+.|+|++|.+++.+|..+..+++|+.|+|++|++.+.+|..+ .+++|+.|+|
T Consensus       404 ~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~l  482 (968)
T PLN00113        404 RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDL  482 (968)
T ss_pred             CCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEEC
Confidence            344445555555555555555555555555555555555555555555555555555555555555443 2355666666


Q ss_pred             cCCCCCCCCchhcCCCCCCcEEecccccCCcCCCCCC---CCCcEEecccCCCCCcCCcCCCC-CcccEEEcccCcCCCc
Q 043706          168 SVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGF---TSVEVLDLSSNLFNGSLPLDFGG-GNLRYLNLSYNKISGS  243 (586)
Q Consensus       168 ~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~g~~p~~l---~~L~~L~Ls~N~l~~~~p~~~~~-~~L~~L~ls~N~l~g~  243 (586)
                      ++|++++.+|..+.++++|+.|+|++|++++.+|..+   ++|++|+|++|.++|.+|..+.. ++|+.|+|++|+++|.
T Consensus       483 s~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  562 (968)
T PLN00113        483 SRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGE  562 (968)
T ss_pred             cCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccccc
Confidence            6666666666666677777777777777777666543   66777777777777777777666 6777777777777777


Q ss_pred             CcHHHHhcCCCCcEEEccCCCCcccCCCCCcCcccccccccCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCC
Q 043706          244 ISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLKNLCSIPSTLSTPPNVSTTTSPAIAVIPK  323 (586)
Q Consensus       244 ip~~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lc~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~p~  323 (586)
                      +|..+.. +++|+.|++++|+++|.+|....+.......+.||+.+|+.+....                       .| 
T Consensus       563 ~p~~l~~-l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~-----------------------~~-  617 (968)
T PLN00113        563 IPKNLGN-VESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSG-----------------------LP-  617 (968)
T ss_pred             CChhHhc-CcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccC-----------------------CC-
Confidence            7777766 7777777777777777777665555555666677777775421100                       00 


Q ss_pred             CCCCCCCCCCCCccccccCCCCCCCCccceehhhHHHHHHHHHHHHHHHHHHHHhhhhhhcccccCCCCCCCCCCCCCcc
Q 043706          324 SIDSVPVTNSSPAAATGAQNQRPGLKPGTIAAIAVADLAGIGLLAFIVFYVYQLKKRKALDKSVMDTSSSAKPEKKQPVE  403 (586)
Q Consensus       324 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~iv~~~~~~~~~l~~i~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~  403 (586)
                               +..      . ..+......+++++++   ++++++++++.++++++++.......        +.     
T Consensus       618 ---------~c~------~-~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~-----  665 (968)
T PLN00113        618 ---------PCK------R-VRKTPSWWFYITCTLG---AFLVLALVAFGFVFIRGRNNLELKRV--------EN-----  665 (968)
T ss_pred             ---------CCc------c-ccccceeeeehhHHHH---HHHHHHHHHHHHHHHHhhhccccccc--------cc-----
Confidence                     000      0 0000111112222221   11222222222222222221000000        00     


Q ss_pred             ccccccccccccccccccccCCCCCCCCCCCCCCCCCCCCccccccchhhhcccccCCCCeEEEecCcccccHHHHhhc-
Q 043706          404 AVTTVAKTEHATWSCLKMIKGEETSDANTSSDSDQDGGNNEYEDHANVVQQQESKRGASGTLVTVDGETELEVETLFKA-  482 (586)
Q Consensus       404 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a-  482 (586)
                          ....+..                                                 ....-.....++++++..+ 
T Consensus       666 ----~~~~~~~-------------------------------------------------~~~~~~~~~~~~~~~~~~~~  692 (968)
T PLN00113        666 ----EDGTWEL-------------------------------------------------QFFDSKVSKSITINDILSSL  692 (968)
T ss_pred             ----ccccccc-------------------------------------------------cccccccchhhhHHHHHhhC
Confidence                0000000                                                 0000000123455565443 


Q ss_pred             -ccceeecCCceEEEEEEe-CCCcEEEEEEecccchhhHHHHHHHHHHHHccCCCCccceeEEEEeCCeEEEEEeccCCC
Q 043706          483 -SAYILCTSSSSIVYKAVL-ADGTTLAVRRIGETCFERLKDLESQVKAIAKLKHPNLVKLRGFYWEDEEKLLIHDYVSNG  560 (586)
Q Consensus       483 -~~~~lg~g~~g~vy~~~~-~~g~~vavK~l~~~~~~~~~~f~~e~~~l~~l~H~niv~l~g~~~~~~~~~lv~ey~~~G  560 (586)
                       ..++||+|+||.||+|+. .+|..||||+++.....    ...|++.+++++|||||+++|+|...+..++|||||++|
T Consensus       693 ~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~~----~~~~~~~l~~l~HpnIv~~~~~~~~~~~~~lv~Ey~~~g  768 (968)
T PLN00113        693 KEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNSI----PSSEIADMGKLQHPNIVKLIGLCRSEKGAYLIHEYIEGK  768 (968)
T ss_pred             CcccEEccCCCeeEEEEEECCCCcEEEEEEccCCccc----cHHHHHHHhhCCCCCcceEEEEEEcCCCCEEEEeCCCCC
Confidence             357899999999999997 58999999999754332    234588899999999999999999999999999999999


Q ss_pred             CHHHHHhccCCCCCccHHhhcccc
Q 043706          561 CLASFSFTHASKFHLFFAIIHPFG  584 (586)
Q Consensus       561 sL~~~L~~~~~~~~l~w~~r~~~~  584 (586)
                      +|.++++.      ++|.++.+++
T Consensus       769 ~L~~~l~~------l~~~~~~~i~  786 (968)
T PLN00113        769 NLSEVLRN------LSWERRRKIA  786 (968)
T ss_pred             cHHHHHhc------CCHHHHHHHH
Confidence            99999963      6788877664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-16
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 6e-08
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 4e-07
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-05
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 5e-04
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 5e-04
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 5e-04
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 5e-04
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 105/276 (38%), Gaps = 73/276 (26%)
Query: 92  SLILPNSQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGE 151
           +LIL  + L G +   L    +L  + LSNN   G +P  I     L +L LSNN+ SG 
Sbjct: 467 TLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGN 526
Query: 152 LPDLIGQIPRLQLLNLSVNAL-----------AGKVPRNLTAVKSLTVV----------- 189
           +P  +G    L  L+L+ N             +GK+  N  A K    +           
Sbjct: 527 IPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHG 586
Query: 190 --------SLRS---NYFSGSIPSGFTS----------------VEVLDLSSNLFNGSLP 222
                    +RS   N  S   P   TS                +  LD+S N+ +G +P
Sbjct: 587 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 646
Query: 223 LDFGG-GNLRYLNLSYNKISGSISPEFAK----------------RIPQNVT-------I 258
            + G    L  LNL +N ISGSI  E                   RIPQ ++       I
Sbjct: 647 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI 706
Query: 259 DLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPL 294
           DLS NNL+G IP            F  N  LCG PL
Sbjct: 707 DLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 742
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-52
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-40
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-16
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-04
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 7e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-07
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
3soc_A 322 Activin receptor type-2A; structural genomics cons 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-05
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-05
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-05
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 4e-05
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 4e-05
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 5e-05
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-05
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 7e-05
4aoj_A 329 High affinity nerve growth factor receptor; transf 7e-05
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 8e-05
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 8e-05
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 9e-05
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-04
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-04
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-04
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-04
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-04
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-04
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-04
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-04
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-04
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 3e-04
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-04
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 3e-04
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 3e-04
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 4e-04
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 4e-04
3bhy_A 283 Death-associated protein kinase 3; death associate 5e-04
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 5e-04
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-04
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 5e-04
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 6e-04
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 6e-04
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-04
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 6e-04
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 6e-04
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 7e-04
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 7e-04
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 7e-04
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 7e-04
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 7e-04
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 8e-04
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  200 bits (511), Expect = 1e-59
 Identities = 77/321 (23%), Positives = 123/321 (38%), Gaps = 67/321 (20%)

Query: 34  NTDGVLLLSFKYSILSDPLSVLQNWNYD-DATPCSWTGVTCTQIDATTIPGSPDMFRVIS 92
             D   LL  K   L +P + L +W    D    +W GV C     T         RV +
Sbjct: 5   PQDKQALLQIKKD-LGNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTY--------RVNN 54

Query: 93  LILPNSQLLGSVT--KDLGLIQHLRHLDLSN-NFFNGSLPLSIFSATELQVLSLSNNAIS 149
           L L    L         L  + +L  L +   N   G +P +I   T+L  L +++  +S
Sbjct: 55  LDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 150 GELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSLTVVSLRSNYFSGSIPSGFTS--- 206
           G +PD + QI  L  L+ S NAL+G +P +++++ +L  ++   N  SG+IP  + S   
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK 174

Query: 207 -VEVLDLSSNLFNGSLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNL 265
               + +S N   G +P  F   NL +++LS N + G  S  F         I L+ N+L
Sbjct: 175 LFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGS-DKNTQKIHLAKNSL 233

Query: 266 TGAIP-------------------------------------------GALP----LVNQ 278
              +                                            G +P    L   
Sbjct: 234 AFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRF 293

Query: 279 RMESFSGNVELCGKPLKNLCS 299
            + +++ N  LCG PL   C+
Sbjct: 294 DVSAYANNKCLCGSPLPA-CT 313
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query586
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.87
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.79
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.79
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.71
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.7
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.6
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.58
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.58
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.53
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.52
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.52
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.46
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.42
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.41
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.39
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.35
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.33
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.33
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.32
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.31
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.3
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.29
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.28
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.27
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.27
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.27
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.27
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.26
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.25
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.24
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.24
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.24
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.24
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.23
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.23
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.23
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.23
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.23
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.23
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.22
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.22
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.22
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.22
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.22
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.22
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.22
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.21
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.21
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.21
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.21
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.21
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.21
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.2
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.2
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.2
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.2
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.2
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.2
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.19
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.19
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.19
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.19
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.18
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.18
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.18
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.17
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.17
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.17
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.17
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.17
3uqc_A 286 Probable conserved transmembrane protein; structur 99.17
3bhy_A 283 Death-associated protein kinase 3; death associate 99.17
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.17
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.17
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.17
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.17
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.16
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.15
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.15
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.15
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.15
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.15
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.15
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.15
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.15
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.15
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.15
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.15
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.15
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.15
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.15
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.15
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.15
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.14
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.14
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.14
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.14
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.14
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.14
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.14
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.14
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.14
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.14
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.14
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.14
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.13
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.13
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.13
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.13
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.13
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.13
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.12
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.12
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.12
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.12
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.12
3niz_A 311 Rhodanese family protein; structural genomics, str 99.11
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.11
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.11
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.11
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.11
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.11
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.11
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.1
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.1
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.1
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.1
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.1
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.1
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.1
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.1
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.1
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.1
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.1
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.1
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.1
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.09
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.09
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.09
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.09
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.08
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.08
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.08
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.08
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.08
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.08
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.08
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.08
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.07
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.07
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.07
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.07
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.07
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.07
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.07
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.07
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.06
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.06
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.06
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.06
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.05
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.05
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.05
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.05
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.05
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.05
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.04
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.04
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.04
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.04
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.04
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.03
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.02
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.02
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.02
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.02
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.01
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.01
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.01
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.01
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.01
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.0
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.0
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.0
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.0
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.99
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 98.99
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 98.99
3an0_A 340 Dual specificity mitogen-activated protein kinase; 98.99
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 98.99
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.98
3fme_A 290 Dual specificity mitogen-activated protein kinase; 98.98
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 98.98
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 98.98
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.97
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 98.97
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.97
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.96
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 98.95
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.95
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 98.94
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 98.93
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 98.93
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.93
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.92
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.92
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.91
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 98.91
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.9
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.9
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 98.9
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.9
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 98.89
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 98.89
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.89
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.89
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.88
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 98.88
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.88
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.88
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.88
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.87
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.87
3aln_A 327 Dual specificity mitogen-activated protein kinase; 98.87
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 98.87
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.86
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.86
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 98.85
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 98.85
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.84
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.82
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.82
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.82
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.82
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.81
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.81
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.8
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.8
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.78
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.77
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.76
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.74
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.73
2dyl_A 318 Dual specificity mitogen-activated protein kinase 98.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.73
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.7
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 98.69
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.68
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.68
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.67
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.65
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.41
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.37
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 97.98
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 97.81
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.73
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.63
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.23
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.01
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 96.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.74
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.64
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 96.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.51
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 94.12
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 93.66
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 91.96
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 91.38
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 91.36
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 90.27
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 87.09
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 85.6
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 85.38
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 84.93
3ats_A 357 Putative uncharacterized protein; hypothetical pro 83.43
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 83.21
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 81.12
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=5.9e-36  Score=304.53  Aligned_cols=260  Identities=27%  Similarity=0.467  Sum_probs=172.4

Q ss_pred             CCCchhHHHHHHHHHhcccCCcccCCCCCCCCCCCCC--ccceeeCCCC----C----------C---CcCCC-CCCCce
Q 043706           31 FGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPCS--WTGVTCTQID----A----------T---TIPGS-PDMFRV   90 (586)
Q Consensus        31 ~~~~~~~~~Ll~~k~~l~~~~~~~l~~W~~~~~~~C~--w~gv~C~~~~----~----------~---~ip~~-~~~~~l   90 (586)
                      .|.+.|++||++||.++ .||. .+.+|.. +.+||.  |.||.|+...    +          +   .+|.. ..+.++
T Consensus         2 ~c~~~~~~aL~~~k~~~-~~~~-~l~~W~~-~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L   78 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDL-GNPT-TLSSWLP-TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHT-TCCG-GGTTCCT-TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHhc-CCcc-cccCCCC-CCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCC
Confidence            35678999999999999 5775 7899975 357888  9999997531    0          1   12211 123455


Q ss_pred             EEEEcCC-CCCcccCccccCCCCCCCEEEccCCCCCCCCCccccCCCCCcEEEeeCCCCCCCCccccCCCCCCcEEEccC
Q 043706           91 ISLILPN-SQLLGSVTKDLGLIQHLRHLDLSNNFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSV  169 (586)
Q Consensus        91 ~~L~L~~-n~l~~~~~~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~  169 (586)
                      +.|+|++ |.+.+.+|..|+.+++|++|+|++|.+++.+|..+..+++|++|+|++|.+++.+|..+..+++|++|+|++
T Consensus        79 ~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~  158 (313)
T 1ogq_A           79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG  158 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             CeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcC
Confidence            5555553 555555555555555555555555555555555555555666666666666555566666666666666666


Q ss_pred             CCCCCCCchhcCCCC-CCcEEecccccCCcCCCCCC--------------------------CCCcEEecccCCCCCcCC
Q 043706          170 NALAGKVPRNLTAVK-SLTVVSLRSNYFSGSIPSGF--------------------------TSVEVLDLSSNLFNGSLP  222 (586)
Q Consensus       170 N~l~~~~p~~l~~l~-~L~~L~L~~N~l~g~~p~~l--------------------------~~L~~L~Ls~N~l~~~~p  222 (586)
                      |++++.+|..++.++ +|+.|+|++|.+++.+|..+                          ++|+.|+|++|.+++.+|
T Consensus       159 N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~  238 (313)
T 1ogq_A          159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG  238 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG
T ss_pred             CcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCcccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecC
Confidence            666656666666655 66666666666655444332                          233344444444443333


Q ss_pred             cCCCC-CcccEEEcccCcCCCcCcHHHHhcCCCCcEEEccCCCCcccCCCCCcCcccccccccCCccccCCCCC
Q 043706          223 LDFGG-GNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKPLK  295 (586)
Q Consensus       223 ~~~~~-~~L~~L~ls~N~l~g~ip~~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lc~~~~~  295 (586)
                      . +.. ++|++|+|++|+++|.+|..+.. +++|+.|+|++|+++|.+|....+..+....+.+|+.+||.|+.
T Consensus       239 ~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~~lc~~p~~  310 (313)
T 1ogq_A          239 K-VGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP  310 (313)
T ss_dssp             G-CCCCTTCCEEECCSSCCEECCCGGGGG-CTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS
T ss_pred             c-ccccCCCCEEECcCCcccCcCChHHhc-CcCCCEEECcCCcccccCCCCccccccChHHhcCCCCccCCCCC
Confidence            3 222 67888889999998889988887 99999999999999999998866777888899999999998764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 586
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-12
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-11
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-10
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-10
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 8e-10
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-09
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-09
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-09
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-09
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 8e-09
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 9e-09
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-08
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-08
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-08
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-08
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-08
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 3e-08
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-08
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 9e-08
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-07
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-07
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-07
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-07
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-07
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 3e-07
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 3e-07
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-07
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-07
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-07
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-06
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-06
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-06
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 4e-06
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-06
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-05
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-05
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 1e-05
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-05
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-05
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 2e-05
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-04
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-04
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-04
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 86.7 bits (213), Expect = 3e-19
 Identities = 66/320 (20%), Positives = 111/320 (34%), Gaps = 67/320 (20%)

Query: 35  TDGVLLLSFKYSILSDPLSVLQNWN-YDDATPCSWTGVTCTQIDATTIPGSPDMFRVISL 93
            D   LL  K   L +P + L +W    D    +W GV C              +RV +L
Sbjct: 6   QDKQALLQIKKD-LGNP-TTLSSWLPTTDCCNRTWLGVLCD--------TDTQTYRVNNL 55

Query: 94  ILPNSQLLGSVT--KDLGLIQHLR-------------------------HLDLSNNFFNG 126
            L    L         L  + +L                          +L +++   +G
Sbjct: 56  DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG 115

Query: 127 SLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKSL 186
           ++P  +     L  L  S NA+SG LP  I  +P L  +    N ++G +P +  +   L
Sbjct: 116 AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL 175

Query: 187 TVVSLRSN---------------------------YFSGSIPSGFTSVEVLDLSSNLFNG 219
                 S                              +  +     + + + L+ N    
Sbjct: 176 FTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235

Query: 220 SLPLDFGGGNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQR 279
            L       NL  L+L  N+I G++     + +    ++++SFNNL G IP    L    
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQGGNLQRFD 294

Query: 280 MESFSGNVELCGKPLKNLCS 299
           + +++ N  LCG PL   C+
Sbjct: 295 VSAYANNKCLCGSPLPA-CT 313
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query586
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.59
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.58
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.57
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.56
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.54
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.53
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.53
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.53
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.52
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.52
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.52
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.52
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.51
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.51
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.49
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.48
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.48
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.48
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.48
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.48
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.48
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.41
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.41
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.4
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.4
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.4
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.39
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.37
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.36
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.36
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.35
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.34
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.33
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.31
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.3
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.29
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.25
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.22
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.1
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.09
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.09
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.08
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.07
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.06
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.06
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.02
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 98.99
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.99
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 98.97
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.92
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.54
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.33
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.63
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.57
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.7
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 87.88
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 87.59
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=9.8e-38  Score=315.30  Aligned_cols=252  Identities=29%  Similarity=0.507  Sum_probs=211.7

Q ss_pred             CCCchhHHHHHHHHHhcccCCcccCCCCCCCCCCCC--CccceeeCCCCCCCcCCCCCCCceEEEEcCCCCCcc--cCcc
Q 043706           31 FGLNTDGVLLLSFKYSILSDPLSVLQNWNYDDATPC--SWTGVTCTQIDATTIPGSPDMFRVISLILPNSQLLG--SVTK  106 (586)
Q Consensus        31 ~~~~~~~~~Ll~~k~~l~~~~~~~l~~W~~~~~~~C--~w~gv~C~~~~~~~ip~~~~~~~l~~L~L~~n~l~~--~~~~  106 (586)
                      .|.++|++||++||+++ .|| ..+.+|.. +.|||  .|.||+|+..+.        ..+|++|+|+++++.|  .+|+
T Consensus         2 ~c~~~e~~aLl~~k~~~-~~~-~~l~sW~~-~~d~C~~~w~gv~C~~~~~--------~~~v~~L~L~~~~l~g~~~lp~   70 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDL-GNP-TTLSSWLP-TTDCCNRTWLGVLCDTDTQ--------TYRVNNLDLSGLNLPKPYPIPS   70 (313)
T ss_dssp             CSCHHHHHHHHHHHHHT-TCC-GGGTTCCT-TSCTTTTCSTTEEECCSSS--------CCCEEEEEEECCCCSSCEECCG
T ss_pred             CCCHHHHHHHHHHHHHC-CCC-CcCCCCCC-CCCCCCCcCCCeEEeCCCC--------cEEEEEEECCCCCCCCCCCCCh
Confidence            36789999999999999 455 36899974 45788  599999986421        2589999999999988  5889


Q ss_pred             ccCCCCCCCEEEccC-CCCCCCCCccccCCCCCcEEEeeCCCCCCCCccccCCCCCCcEEEccCCCCCCCCchhcCCCCC
Q 043706          107 DLGLIQHLRHLDLSN-NFFNGSLPLSIFSATELQVLSLSNNAISGELPDLIGQIPRLQLLNLSVNALAGKVPRNLTAVKS  185 (586)
Q Consensus       107 ~l~~l~~L~~L~Ls~-N~l~g~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~  185 (586)
                      .+++|++|++|+|++ |+++|.+|.+|+++++|++|+|++|++.+..+..+..+.+|+.+++++|.+.+.+|..+.+++.
T Consensus        71 ~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~  150 (313)
T d1ogqa_          71 SLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPN  150 (313)
T ss_dssp             GGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTT
T ss_pred             HHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcc
Confidence            999999999999986 8999999999999999999999999999888888888888888888888888888888888888


Q ss_pred             CcEEecccccCCcCCCCCC---------------------------------------------------CCCcEEeccc
Q 043706          186 LTVVSLRSNYFSGSIPSGF---------------------------------------------------TSVEVLDLSS  214 (586)
Q Consensus       186 L~~L~L~~N~l~g~~p~~l---------------------------------------------------~~L~~L~Ls~  214 (586)
                      |+.+++++|.++|.+|..+                                                   ++|+.|++++
T Consensus       151 L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~  230 (313)
T d1ogqa_         151 LVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAK  230 (313)
T ss_dssp             CCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCS
T ss_pred             cceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            8888888888887776532                                                   2345555555


Q ss_pred             CCCCCcCCcCCCC-CcccEEEcccCcCCCcCcHHHHhcCCCCcEEEccCCCCcccCCCCCcCcccccccccCCccccCCC
Q 043706          215 NLFNGSLPLDFGG-GNLRYLNLSYNKISGSISPEFAKRIPQNVTIDLSFNNLTGAIPGALPLVNQRMESFSGNVELCGKP  293 (586)
Q Consensus       215 N~l~~~~p~~~~~-~~L~~L~ls~N~l~g~ip~~~~~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~n~~lc~~~  293 (586)
                      |.+++.+|. +.. ++|++|+|++|+|+|.+|.++.. +++|++|||++|+|+|.+|....+..+....+.||+.+||.|
T Consensus       231 ~~l~~~~~~-~~~~~~L~~L~Ls~N~l~g~iP~~l~~-L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         231 NSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSP  308 (313)
T ss_dssp             SEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGG-CTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTT
T ss_pred             ccccccccc-cccccccccccCccCeecccCChHHhC-CCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCC
Confidence            555555443 333 78999999999999999999988 999999999999999999987667778888899999999987


Q ss_pred             CC
Q 043706          294 LK  295 (586)
Q Consensus       294 ~~  295 (586)
                      +.
T Consensus       309 lp  310 (313)
T d1ogqa_         309 LP  310 (313)
T ss_dssp             SS
T ss_pred             CC
Confidence            63
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure