Citrus Sinensis ID: 043760


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQTNSVTSHENNQKHEGKKDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITTRGSPRKASSPEVPAHTD
ccccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccccHHHHHHHHHHHcHHHHcccccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
ccccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccccHHHHHHHHHccccccccccccccHHHHHHcccHHHHHHHccccHHHHHccccccHHHHHHccccHHHHHHHHHccccHHHcccccccHHHHHHHcccEEEEEEEcEEccccccccccccccHcccccccHHccccccccccc
MAGSVNTLLElrqqdplilerptvnclsetPLHVAALLGHedfakeilpqkpriaeeldsrkssalhiASQKGYVGIVKALLQVipdkcsdtdvdgrnplhLAAMRGHIDVLEELVRakpdaastrLIWVGSTEVLLEnmgdfellnakddyGMTILLLAVADKQIEAIKFLTTSTAIEVNavtangftAWDILAQSKRDIKDWDTGELLRRAgaisakdlqlpvNELAVTQtnsvtshennqkhegkkdlkgtpwnlDDWLEKKLNAAMVVASVISTMgfqaavdppqspelaaSSFVVWNTigvdarfrfssfydqdlcsinfittrgsprkasspevpahtd
magsvntllelrqqdplilERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNavtangftawDILAQSKRDIKDWDTGELLRRAGaisakdlqlpvNELAVTQTnsvtshennqkhegkkdlkgtpWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSInfittrgsprkasspevpahtd
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQTNSVTSHENNQKHEGKKDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITTRGSPRKASSPEVPAHTD
**************DPLILERPTVNCLSETPLHVAALLGHEDFAKEIL*****************LHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELA************************TPWNLDDWLEKKLNAAMVVASVISTMGFQAAV*******LAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITT*****************
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVT********************KGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFI*******************
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQ*****************DLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITTR****************
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQTNSVTSHENNQKHEGKKDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITT*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQTNSVTSHENNQKHEGKKDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTIGVDARFRFSSFYDQDLCSINFITTRGSPRKASSPEVPAHTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query345 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.782 0.457 0.256 6e-12
Q9ZU96 532 Ankyrin repeat-containing no no 0.747 0.484 0.259 3e-11
Q6AWW5524 Ankyrin repeat-containing no no 0.721 0.475 0.248 3e-10
Q5F478990 Serine/threonine-protein yes no 0.466 0.162 0.282 2e-09
Q9ERK0786 Receptor-interacting seri yes no 0.342 0.150 0.316 5e-09
Q8N8A2993 Serine/threonine-protein yes no 0.515 0.179 0.287 2e-08
B2RXR6 993 Serine/threonine-protein no no 0.455 0.158 0.323 4e-08
Q3EC11 536 Probable S-acyltransferas no no 0.463 0.298 0.303 6e-08
Q54F46803 Homeobox protein Wariai O yes no 0.498 0.214 0.297 9e-08
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.542 0.099 0.283 1e-07
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 131/312 (41%), Gaps = 42/312 (13%)

Query: 31  PLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCS 90
           PLH+AA+ GH    + +L     +++      ++ L  A+ +G+  +V  LL    +   
Sbjct: 167 PLHIAAIQGHHAIVEVLLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLE 226

Query: 91  DTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMG--------- 141
            +  + +N LHLAA +GH++V++ L+   P  A  R+   G T + +   G         
Sbjct: 227 ISRSNNKNALHLAARQGHVEVIKALLSKDPQLAR-RIDKKGQTALHMAVKGQSSEVVKLL 285

Query: 142 ---DFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDI----- 193
              D  ++   D    T L +A   K+ E ++ L +      N +T +  TA DI     
Sbjct: 286 LDADPAIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLP 345

Query: 194 LAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNELAVTQT---NSV------TSHENNQK 244
           L++    IK     E L R+GA+ A +L  P +EL  T T   N V      T   N   
Sbjct: 346 LSEESSYIK-----ECLARSGALRANELNQPRDELRSTVTQIKNDVHIQLEQTKRTNKNV 400

Query: 245 HEGKKDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVDPPQSPELAASSFVVWNTI 304
           H   K+L+       + +    N+  VVA + +T+ F A    P       S+ VV    
Sbjct: 401 HNISKELRKLHR---EGINNATNSVTVVAVLFATVAFAAIFTVPGGDNNDGSAVVV---- 453

Query: 305 GVDARFRFSSFY 316
               R  F  F+
Sbjct: 454 ---GRASFKIFF 462





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|Q3EC11|ZDHC2_ARATH Probable S-acyltransferase At2g14255 OS=Arabidopsis thaliana GN=At2g14255 PE=2 SV=2 Back     alignment and function description
>sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
343887300 469 ankyrin repeat family protein [Citrus un 0.823 0.605 0.516 6e-74
343887301 470 Ankyrin repeat family protein [Citrus un 0.886 0.651 0.489 8e-74
343887299 477 ankyrin repeat family protein [Citrus un 0.828 0.599 0.519 4e-73
359475962 486 PREDICTED: ankyrin repeat-containing pro 0.826 0.586 0.503 7e-72
343887311 473 ankyrin repeat family protein [Citrus un 0.8 0.583 0.488 8e-66
296081692444 unnamed protein product [Vitis vinifera] 0.733 0.569 0.498 1e-61
359475964 491 PREDICTED: ankyrin repeat-containing pro 0.797 0.560 0.498 7e-61
224088778 491 predicted protein [Populus trichocarpa] 0.794 0.558 0.456 2e-57
224092119 471 predicted protein [Populus trichocarpa] 0.773 0.566 0.416 2e-53
225444809 514 PREDICTED: ankyrin repeat-containing pro 0.828 0.556 0.415 5e-53
>gi|343887300|dbj|BAK61846.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
 Score =  283 bits (725), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 156/302 (51%), Positives = 204/302 (67%), Gaps = 18/302 (5%)

Query: 3   GSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRK 62
           GSV +LL+L Q+D L+L+R  V+C SETPLH+A++LGHE F +EIL +KP +A ELDSR+
Sbjct: 12  GSVESLLKLLQEDALLLDRSMVSCYSETPLHIASMLGHESFVREILSRKPELAGELDSRR 71

Query: 63  SSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDA 122
           SSALH A+ KG++GIV  LL V P  C   D DG+NPLH+AA++GH++VL ELV+ +P A
Sbjct: 72  SSALHFAAAKGHLGIVLKLLSVNPKMCCACDRDGKNPLHVAAIKGHVNVLRELVQVRPKA 131

Query: 123 ASTRLIWVGST--------------EVLLENMGDFELLNAKDDYGMTILLLAVADKQIEA 168
               L+  G T              ++L+E + D E +N+KDD G TIL LAV DKQ+EA
Sbjct: 132 CRI-LMDRGETILHACVNYNQLECLKLLVETLNDHEFVNSKDDDGNTILHLAVIDKQVEA 190

Query: 169 IKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAKDLQLPVNEL 228
           +KFLT ST IEVNAV ANGFTA DILAQ K D+     GELLR AGA S K+ + P +  
Sbjct: 191 VKFLTGSTTIEVNAVNANGFTALDILAQRKLDMNS-TIGELLRCAGARSLKETREPASGT 249

Query: 229 AVTQTNS-VTSHENNQKHEGK-KDLKGTPWNLDDWLEKKLNAAMVVASVISTMGFQAAVD 286
             T+T S +TSH  +  ++G+ +  K      D W EKK N  MVVAS+I+TM FQA ++
Sbjct: 250 TKTRTGSIITSHSGDPSNQGRERPEKARKKQEDKWSEKKRNTLMVVASLIATMAFQAGLN 309

Query: 287 PP 288
           PP
Sbjct: 310 PP 311




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|343887301|dbj|BAK61847.1| Ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|343887299|dbj|BAK61845.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|359475962|ref|XP_002279591.2| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|343887311|dbj|BAK61857.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|296081692|emb|CBI20697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475964|ref|XP_002279612.2| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088778|ref|XP_002308536.1| predicted protein [Populus trichocarpa] gi|222854512|gb|EEE92059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092119|ref|XP_002309480.1| predicted protein [Populus trichocarpa] gi|222855456|gb|EEE93003.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225444809|ref|XP_002278533.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.733 0.382 0.283 2.4e-15
TAIR|locus:2031948 627 AT1G05640 "AT1G05640" [Arabido 0.736 0.405 0.291 2.8e-15
TAIR|locus:2172089426 ANK "ankyrin" [Arabidopsis tha 0.875 0.708 0.259 1.8e-14
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.718 0.408 0.260 4.1e-14
TAIR|locus:2026489 543 AT1G07710 "AT1G07710" [Arabido 0.698 0.443 0.266 1.2e-10
TAIR|locus:2012557436 AT1G14500 "AT1G14500" [Arabido 0.8 0.633 0.273 8.7e-13
TAIR|locus:2172099431 AT5G54620 [Arabidopsis thalian 0.405 0.324 0.319 3.6e-12
TAIR|locus:2065434 532 AT2G01680 "AT2G01680" [Arabido 0.773 0.501 0.266 1.9e-11
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.669 0.391 0.260 4e-10
TAIR|locus:2176252442 AT5G51160 "AT5G51160" [Arabido 0.695 0.542 0.253 1.4e-10
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 2.4e-15, P = 2.4e-15
 Identities = 79/279 (28%), Positives = 134/279 (48%)

Query:    31 PLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCS 90
             P HVAA  GH +  K +L   P +A   D   ++ALH A+ +G++ +V  LL+   +   
Sbjct:   227 PFHVAAKQGHLEVLKILLETFPNLAMTTDLSCTTALHTAATQGHIDVVNLLLETDSNLAK 286

Query:    91 DTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLL----ENMG----- 141
                 +G+  LH AA  GH++V++ L+   P +   R    G T + +    +N G     
Sbjct:   287 IAKNNGKTALHSAARMGHVEVVKSLIGKDP-SIGFRTDKKGQTALHMAVKGQNDGIVVEL 345

Query:   142 ---DFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSK 198
                D  +L+ +D+ G T L +A    +I+ ++ L +   I +N +   G T  D+   S+
Sbjct:   346 VKPDVAVLSVEDNKGNTPLHIATNKGRIKIVRCLVSFEGINLNPINKAGDTPLDV---SE 402

Query:   199 RDIKDWDTGELLRRAGAISAKDLQLPVNELA-VTQTNSVTSHE-NNQKHEGKKD---LKG 253
             + I + +   +L+ AGA +AKDL  P N    + QT S   HE  +Q  + ++    ++ 
Sbjct:   403 K-IGNAELVSVLKEAGAATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQK 461

Query:   254 TPWNLD----DWLEKKLNAAMVVASVISTMGFQAAVDPP 288
                 L       L   +N+A VVA +I+T+ F A    P
Sbjct:   462 IAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTIP 500


GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012557 AT1G14500 "AT1G14500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065434 AT2G01680 "AT2G01680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
smart0024830 smart00248, ANK, ankyrin repeats 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 87.4 bits (217), Expect = 3e-21
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 26/149 (17%)

Query: 24  VNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQ 83
            +    TPLH+AA  GH +  K +L +        D+   + LH+A++ G++ IVK LL+
Sbjct: 3   RDEDGRTPLHLAASNGHLEVVKLLL-ENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLE 61

Query: 84  VIPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDF 143
              D  +  D DG  PLHLAA  G++DV++ L++   D                      
Sbjct: 62  KGADVNA-RDKDGNTPLHLAARNGNLDVVKLLLKHGAD---------------------- 98

Query: 144 ELLNAKDDYGMTILLLAVADKQIEAIKFL 172
             +NA+D  G T L LA  +  +E +K L
Sbjct: 99  --VNARDKDGRTPLHLAAKNGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 99.98
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02875413 ankyrin repeat protein; Provisional 99.97
PHA02874434 ankyrin repeat protein; Provisional 99.97
PHA03095471 ankyrin-like protein; Provisional 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02874434 ankyrin repeat protein; Provisional 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA03100480 ankyrin repeat protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA03095 471 ankyrin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02878477 ankyrin repeat protein; Provisional 99.96
PHA02876 682 ankyrin repeat protein; Provisional 99.96
PHA02946446 ankyin-like protein; Provisional 99.96
KOG0510 929 consensus Ankyrin repeat protein [General function 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02989494 ankyrin repeat protein; Provisional 99.95
PHA02876682 ankyrin repeat protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
PHA02917661 ankyrin-like protein; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
PHA02730672 ankyrin-like protein; Provisional 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PHA02792631 ankyrin-like protein; Provisional 99.93
PHA02798 489 ankyrin-like protein; Provisional 99.92
KOG0514452 consensus Ankyrin repeat protein [General function 99.92
PHA02730 672 ankyrin-like protein; Provisional 99.91
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02795437 ankyrin-like protein; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.9
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.89
PHA02792631 ankyrin-like protein; Provisional 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.86
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.86
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.85
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
KOG0514452 consensus Ankyrin repeat protein [General function 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.79
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.76
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.72
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.53
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.49
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.43
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
PF13962113 PGG: Domain of unknown function 99.29
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.99
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.95
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.92
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.89
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.88
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.87
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.84
PF1360630 Ank_3: Ankyrin repeat 98.79
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.76
PF1360630 Ank_3: Ankyrin repeat 98.68
KOG0522 560 consensus Ankyrin repeat protein [General function 98.64
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.64
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.62
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.62
KOG0522 560 consensus Ankyrin repeat protein [General function 98.52
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.41
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.36
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.33
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.22
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.19
KOG0511 516 consensus Ankyrin repeat protein [General function 98.13
KOG2384223 consensus Major histocompatibility complex protein 97.97
KOG2384223 consensus Major histocompatibility complex protein 97.97
KOG0511 516 consensus Ankyrin repeat protein [General function 97.95
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.87
KOG2505591 consensus Ankyrin repeat protein [General function 96.94
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.83
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.82
KOG2505591 consensus Ankyrin repeat protein [General function 96.55
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.92
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.3
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.64
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.99
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.86
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 86.07
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.4e-37  Score=241.99  Aligned_cols=184  Identities=29%  Similarity=0.334  Sum_probs=164.9

Q ss_pred             HHHHHHHHhcCCccccCCCCCCCCCcHHHHHHHcCCHHHHHHHhcCCCCcccccCCCCchHHHHHHHcCCHHHHHHHHhh
Q 043760            5 VNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQV   84 (345)
Q Consensus         5 ~~~v~~ll~~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~   84 (345)
                      ...++++++..|.-+... .|.+|+||||+||..|+.+++++|++...-.++.+|..||||||+||..|+.++|+.|+.+
T Consensus        16 ~~kveel~~s~~kSL~~r-~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r   94 (226)
T KOG4412|consen   16 EFKVEELIQSDPKSLNAR-DDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNR   94 (226)
T ss_pred             HHHHHHHHhcChhhhhcc-ccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcC
Confidence            457888999888433321 1458999999999999999999999754444488899999999999999999999999999


Q ss_pred             -CCCCCcCCCCCCCcHHHHHHHcCcHHHHHHHHhcCCCcccccccCCccHHHHHHhcCCcccccccCCCCCCHHHHHHHc
Q 043760           85 -IPDKCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVAD  163 (345)
Q Consensus        85 -~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~~g~t~Lh~A~~~  163 (345)
                       |+++ +..++.|+|+||+|+..|+.+|+++|++.|+.                        ++.+|..|.||||-|+..
T Consensus        95 ~~adv-na~tn~G~T~LHyAagK~r~eIaqlLle~ga~------------------------i~~kD~~~qtplHRAAav  149 (226)
T KOG4412|consen   95 SGADV-NATTNGGQTCLHYAAGKGRLEIAQLLLEKGAL------------------------IRIKDKQGQTPLHRAAAV  149 (226)
T ss_pred             CCCCc-ceecCCCcceehhhhcCChhhHHHHHHhcCCC------------------------CcccccccCchhHHHHhc
Confidence             9999 89999999999999999999999999999988                        899999999999999999


Q ss_pred             CCHHHHHHhhhcCCccccccCCCCCcHHHHHHhcCCCCchhhHHHHHHHccccccc
Q 043760          164 KQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRDIKDWDTGELLRRAGAISAK  219 (345)
Q Consensus       164 g~~~~v~~Ll~~~~~~~~~~n~~g~T~L~~a~~~~~~~~~~~i~~~L~~~ga~~~~  219 (345)
                      |..+++++|+.. |+.+|.+|..|+||||.|.-    .++.+...+|+++||+...
T Consensus       150 Gklkvie~Li~~-~a~~n~qDk~G~TpL~~al~----e~~~d~a~lLV~~gAd~~~  200 (226)
T KOG4412|consen  150 GKLKVIEYLISQ-GAPLNTQDKYGFTPLHHALA----EGHPDVAVLLVRAGADTDR  200 (226)
T ss_pred             cchhhHHHHHhc-CCCCCcccccCccHHHHHHh----ccCchHHHHHHHhccceee
Confidence            999999999999 89999999999999999955    4578899999999998754



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-10
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-09
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-09
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-09
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-09
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-05
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 3e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 3e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 4e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 4e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 8e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 67.4 bits (163), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 48/150 (32%), Positives = 73/150 (48%), Gaps = 26/150 (17%) Query: 28 SETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPD 87 TPLH+AA GH + K +L + + D + LH+A++ G++ +VK LL+ D Sbjct: 2 GRTPLHLAARNGHLEVVKLLLEAGADVNAK-DKNGRTPLHLAARNGHLEVVKLLLEAGAD 60 Query: 88 KCSDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLN 147 + D +GR PLHLAA GH++V++ L+ A D +N Sbjct: 61 -VNAKDKNGRTPLHLAARNGHLEVVKLLLEAGAD------------------------VN 95 Query: 148 AKDDYGMTILLLAVADKQIEAIKFLTTSTA 177 AKD G T L LA + +E +K L + A Sbjct: 96 AKDKNGRTPLHLAARNGHLEVVKLLLEAGA 125
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-24
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-22
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-22
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-06
2rfa_A232 Transient receptor potential cation channel subfa 1e-20
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-19
2etb_A256 Transient receptor potential cation channel subfam 5e-14
2etb_A256 Transient receptor potential cation channel subfam 1e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-04
2pnn_A273 Transient receptor potential cation channel subfa 7e-15
2pnn_A273 Transient receptor potential cation channel subfa 6e-14
2pnn_A273 Transient receptor potential cation channel subfa 6e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-04
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score = 96.7 bits (242), Expect = 2e-24
 Identities = 36/172 (20%), Positives = 62/172 (36%), Gaps = 17/172 (9%)

Query: 30  TPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKC 89
             +H  A  G  D  KE L +   +  + D R  + L  AS  G +  V+ LL+   D  
Sbjct: 4   LSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADPH 63

Query: 90  SDTDVDGRNPLHLAAMRGHIDVLEELVR--AKPDAAS----TRLIWV---GSTEV---LL 137
                +  + L LA+  G+ D++  L+      +       T L++       +    LL
Sbjct: 64  I-LAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALL 122

Query: 138 ENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFT 189
               D   L  + D G T + LAVA    +  + +      ++         
Sbjct: 123 ARGAD---LTTEADSGYTPMDLAVALGYRKVQQVIENHIL-KLFQSNLVPAD 170


>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
2rfa_A232 Transient receptor potential cation channel subfa 99.98
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.98
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=3.3e-36  Score=246.10  Aligned_cols=158  Identities=31%  Similarity=0.416  Sum_probs=149.2

Q ss_pred             cHHHHHHHcCCHHHHHHHhcCCCCcccccCCCCchHHHHHHHcCCHHHHHHHHhhCCCCCcCCCCCCCcHHHHHHHcCcH
Q 043760           30 TPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKCSDTDVDGRNPLHLAAMRGHI  109 (345)
Q Consensus        30 t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~  109 (345)
                      ++|+.||..|+.++|++|++.|+++ +.+|..|+||||+|+..++.+++++|+++|+++ +.+|..|+||||+|+..|+.
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadv-n~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~-~~~d~~g~TpLh~A~~~g~~   83 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADV-NASDSDGRTPLHHAAENGHKEVVKLLISKGADV-NAKDSDGRTPLHHAAENGHK   83 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCC-CCcCCCCCCHHHHHHHcCCHHHHHHHHhcccch-hhhccCCCCHHHHHHHcCCH
Confidence            4799999999999999999999998 999999999999999999999999999999999 89999999999999999999


Q ss_pred             HHHHHHHhcCCCcccccccCCccHHHHHHhcCCcccccccCCCCCCHHHHHHHcCCHHHHHHhhhcCCccccccCCCCCc
Q 043760          110 DVLEELVRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFT  189 (345)
Q Consensus       110 ~iv~~Ll~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~n~~g~T  189 (345)
                      +++++|+++|++                        +|.+|..|+||||+|+..|+.+++++|++. |++++.+|.+|+|
T Consensus        84 ~~v~~Ll~~gad------------------------vn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~-gad~~~~d~~G~T  138 (169)
T 4gpm_A           84 EVVKLLISKGAD------------------------VNAKDSDGRTPLHHAAENGHKEVVKLLISK-GADVNTSDSDGRT  138 (169)
T ss_dssp             HHHHHHHHTTCC------------------------TTCCCTTSCCHHHHHHHTTCHHHHHHHHHT-TCCTTCCCTTSCC
T ss_pred             HHHHHHHHCcCC------------------------CCCCCCCCCCHHHHHHHcCCHHHHHHHHHc-CCCccccCCCCCC
Confidence            999999999998                        899999999999999999999999999999 9999999999999


Q ss_pred             HHHHHHhcCCCCchhhHHHHHHHcccccc
Q 043760          190 AWDILAQSKRDIKDWDTGELLRRAGAISA  218 (345)
Q Consensus       190 ~L~~a~~~~~~~~~~~i~~~L~~~ga~~~  218 (345)
                      |||+|+.    .++.+++++|+++||+..
T Consensus       139 pL~~A~~----~g~~~iv~~Ll~~GA~ie  163 (169)
T 4gpm_A          139 PLDLARE----HGNEEVVKLLEKQGGWLE  163 (169)
T ss_dssp             HHHHHHH----TTCHHHHHHHHTC-----
T ss_pred             HHHHHHH----cCCHHHHHHHHHCCCCcC
Confidence            9999999    889999999999999874



>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 345
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-19
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.3 bits (215), Expect = 1e-19
 Identities = 45/201 (22%), Positives = 75/201 (37%), Gaps = 17/201 (8%)

Query: 30  TPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKALLQVIPDKC 89
           TPLHVA+ +GH    K +L +        + +  + LH+A++ G+  + K LLQ      
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASP-NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV- 59

Query: 90  SDTDVDGRNPLHLAAMRGHIDVLEELVRAKPDA---------ASTRLIWVGSTEVLLENM 140
           +    D + PLH AA  GH ++++ L+    +                  G  E +L  +
Sbjct: 60  NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL 119

Query: 141 GDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILAQSKRD 200
                       G T L +A    ++   + L    A   NA   NG T   +       
Sbjct: 120 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA-HPNAAGKNGLTPLHVAVHH--- 175

Query: 201 IKDWDTGELLRRAGA-ISAKD 220
             + D  +LL   G    +  
Sbjct: 176 -NNLDIVKLLLPRGGSPHSPA 195


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.91
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.9e-34  Score=249.08  Aligned_cols=188  Identities=23%  Similarity=0.200  Sum_probs=132.1

Q ss_pred             CCCHHHHHHHHhcCCccccCCCCCCCCCcHHHHHHHcCCHHHHHHHhcCCCCcccccCCCCchHHHHHHHcCCHHHHHHH
Q 043760            2 AGSVNTLLELRQQDPLILERPTVNCLSETPLHVAALLGHEDFAKEILPQKPRIAEELDSRKSSALHIASQKGYVGIVKAL   81 (345)
Q Consensus         2 ~g~~~~v~~ll~~~~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~L   81 (345)
                      .|+.++++.|++.+++.......|..|+||||+||..|+.+++++|+++|+++ +.+|..|.||||+|+..|+.+++++|
T Consensus        19 ~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i-~~~d~~g~tpL~~A~~~~~~~~~~~L   97 (255)
T d1oy3d_          19 HQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGV-LVAERGGHTALHLACRVRAHTCACVL   97 (255)
T ss_dssp             TTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCS-SCCCTTSCCHHHHHTTTTCHHHHHHH
T ss_pred             cCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccc-cccccccchhhhhhhccCchHHHHHH
Confidence            35666666666655443322233566666666666666666666666666665 55666666666666666666666666


Q ss_pred             HhhCCCC----------------------------------------------CcCCCCCCCcHHHHHHHcCcHHHHHHH
Q 043760           82 LQVIPDK----------------------------------------------CSDTDVDGRNPLHLAAMRGHIDVLEEL  115 (345)
Q Consensus        82 l~~~~~~----------------------------------------------~~~~d~~g~tpLh~A~~~g~~~iv~~L  115 (345)
                      ++.+...                                              .+.+|..|+||||+|+..|+.+++++|
T Consensus        98 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~L  177 (255)
T d1oy3d_          98 LQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLL  177 (255)
T ss_dssp             SSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             HhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccccccccccccccch
Confidence            5432110                                              023445566666666666666666666


Q ss_pred             HhcCCCcccccccCCccHHHHHHhcCCcccccccCCCCCCHHHHHHHcCCHHHHHHhhhcCCccccccCCCCCcHHHHHH
Q 043760          116 VRAKPDAASTRLIWVGSTEVLLENMGDFELLNAKDDYGMTILLLAVADKQIEAIKFLTTSTAIEVNAVTANGFTAWDILA  195 (345)
Q Consensus       116 l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~n~~g~T~L~~a~  195 (345)
                      ++.+++.                       .+..+..|.||||+|++.|+.+++++|+++ |++++.+|..|+||||+|+
T Consensus       178 l~~~~~~-----------------------~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~-gadin~~d~~g~t~L~~A~  233 (255)
T d1oy3d_         178 RDAGADL-----------------------NKPEPTCGRTPLHLAVEAQAASVLELLLKA-GADPTARMYGGRTPLGSAL  233 (255)
T ss_dssp             HHHTCCT-----------------------TCCCTTTCCCHHHHHHHTTCHHHHHHHHHT-TCCTTCCCTTSCCHHHHHH
T ss_pred             hcccccc-----------------------cccccccccccccccccccHHHHHHHHHHC-CCCCCCCCCCCCCHHHHHH
Confidence            6665552                       345678899999999999999999999998 8999999999999999999


Q ss_pred             hcCCCCchhhHHHHHHHcccccc
Q 043760          196 QSKRDIKDWDTGELLRRAGAISA  218 (345)
Q Consensus       196 ~~~~~~~~~~i~~~L~~~ga~~~  218 (345)
                      .    .++.+++++|+++||+..
T Consensus       234 ~----~~~~~i~~~Ll~~Ga~~~  252 (255)
T d1oy3d_         234 L----RPNPILARLLRAHGAPEP  252 (255)
T ss_dssp             T----SSCHHHHHHHHHTTCCCC
T ss_pred             H----CCCHHHHHHHHHcCCCCC
Confidence            9    889999999999999743



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure