>PF01776 Ribosomal_L22e: Ribosomal L22e protein family; InterPro: IPR002671 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms
Probab=100.00 E-value=3.8e-43 Score=251.88 Aligned_cols=80 Identities=63% Similarity=0.897 Sum_probs=70.3
Q ss_pred CccceeEEEEeeecccCCCccchhHHHHHhhcceeeccccCCCCCeEEEEeeCCeEEEEecccccceee--hhhhhhccc
Q 043767 24 GKKKGATFTIDCAKPVEDKIMDIASLEKFLQERIKVGGKAGALGDTVTVTRDKTKITVLSDSNFSKRYL--LLKRLLKLP 101 (105)
Q Consensus 24 ~kK~~~kF~IDCt~PveD~I~d~a~FEkFL~erIKVnGKtgnLg~~V~i~r~k~kI~V~s~~pfSKRYL--LTKKyLKK~ 101 (105)
++|+.++|+||||+||||+|||+++||+||||||||||++||||+.|+|++++++|+|+|++||||||| ||||||||+
T Consensus 1 kkk~~~kF~IDCt~pveD~I~d~~~fe~fL~erIKV~gk~gnlg~~V~i~~~~~ki~V~s~v~fsKrYLKYLTKKyLKK~ 80 (112)
T PF01776_consen 1 KKKQTLKFTIDCTHPVEDGIMDPADFEKFLQERIKVNGKTGNLGNKVTISRDKNKITVTSEVPFSKRYLKYLTKKYLKKN 80 (112)
T ss_dssp --EEEEEEEEE-HHSSSTS---SHHHHHHHHHHHHHHSCSSSSTTTEEEEE-SSEEEEEESSS-SHHHHHHHHHHHHTTS
T ss_pred CCcccEEEEEEeCCcccCceecHHHHHHHHHHheEeCCcccccCCeEEEEecCCEEEEEecccccHHHHHHHHHHHHhhc
Confidence 477889999999999999999999999999999999999999999999999999999999999999999 999999998
Q ss_pred cc
Q 043767 102 CA 103 (105)
Q Consensus 102 ~~ 103 (105)
+-
T Consensus 81 ~L 82 (112)
T PF01776_consen 81 NL 82 (112)
T ss_dssp SS
T ss_pred ch
Confidence 74
The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L22e forms part of the 60S ribosomal subunit []. This family is found in eukaryotes. Rattus norvegicus (Rat) L22 is related to ribosomal proteins from other eukaryotes and is identical in amino acid sequence to human EAP, the EBER 1 (Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) encoded RNA) associated protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1D_M 4A1B_M 4A19_M 4A18_M 3IZR_W 3IZS_W.
>KOG3434 consensus 60S ribosomal protein L22 [Translation, ribosomal structure and biogenesis]
Localization Of The Large Subunit Ribosomal Protein
2e-10
>pdb|3IZR|W Chain W, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 130
>pdb|4A18|M Chain M, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 118
>pdb|3IZS|W Chain W, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 121