Citrus Sinensis ID: 043777


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
cccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccccccHHHHHHccccEEEEEcccccHHHHHHHHHHcccccccccccccccEEcccHHHHHHcccccccccccEEEEcccEEEEEcccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccEEEEEcccccccccccccccccccHHHHHHHHc
cccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccEEEccccccccHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccEEEEEEcHccHHEEEEEEccccccccHHHHHHHHHHHHcccccEEEccHHHHHHHHHcccEEccccEEEEEccccccEEcEccccccEccHHHHHHHcc
MAGKSNVLVIGAIGRIgyhftrrsieyghpkfaLIRDSASNFNFSLLRVFHSGvfdywglleDEKSLLEAVKQVdvrfipseygagvfvkdtdVAAFTinalddprtLNKLLHLREIShtfnmessgeldgtklyphlkyttisdyldtsvprgniysfnDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVlgdqtnfeiepsfgveatelypdvnytTVDEYLNQFI
MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSeygagvfvkdTDVAAFTINALDDPRTLNKLLHLREISHtfnmessgeldgTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEkarvlgdqtnfeiepsfgveatelypdvnyTTVDEYLNQFI
MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
*****NVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLN***
***KSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSA*********VFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
***KSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAVKQVDVRFIPSEYGAGVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVLGDQTNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
E1U332308 Isoflavone reductase-like N/A no 0.987 0.740 0.347 2e-32
P52578308 Isoflavone reductase homo N/A no 0.978 0.733 0.348 1e-30
P52579310 Isoflavone reductase homo N/A no 0.978 0.729 0.325 3e-30
P52580309 Isoflavone reductase homo N/A no 0.978 0.731 0.319 3e-27
P52577310 Isoflavone reductase homo no no 0.965 0.719 0.313 5e-26
P52576318 Isoflavone reductase OS=P N/A no 0.982 0.713 0.282 3e-23
P52575318 Isoflavone reductase OS=M N/A no 0.978 0.710 0.269 8e-22
Q00016318 Isoflavone reductase OS=C N/A no 0.982 0.713 0.273 8e-21
Q15GI3323 Isoeugenol synthase 1 OS= N/A no 0.978 0.699 0.265 8e-17
P52581312 Isoflavone reductase homo N/A no 0.484 0.358 0.325 2e-12
>sp|E1U332|ALL12_OLEEU Isoflavone reductase-like protein OS=Olea europaea PE=1 SV=1 Back     alignment and function desciption
 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 149/311 (47%), Gaps = 83/311 (26%)

Query: 1   MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDS--ASNFNFSLLRVF-HSGVFDY 57
           MA K+ +L+IG  G IG      S +  HP FAL R+S  +      +++ F +SGV   
Sbjct: 1   MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL 60

Query: 58  WGLLEDEKSLLEAVKQVDV---------------------------RFIPSEYGAGV--- 87
            G L D +SL++A+KQVDV                           RF PS++G  V   
Sbjct: 61  TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC 120

Query: 88  ----------------------------FVKDTDVAAFTINALDDPRTL----NKLLHLR 115
                                       FV     A +++  L  P       +K++ L 
Sbjct: 121 HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG 180

Query: 116 E--ISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKA 173
           +      FN E+       K     +  T++  L    P+ NIYSFN+LV+LWE+KIGK 
Sbjct: 181 DGNAKAVFNEENDIGTYTIKAVDDAR--TLNKILYIKPPK-NIYSFNELVALWEKKIGKT 237

Query: 174 LDRVYVAEDQLLKNIQE-------------KARVLGDQTNFEIEPSFGVEATELYPDVNY 220
           L+++YV E+Q+LK IQE              A V GD TNF+IEPSFGVEA+ELYPDV Y
Sbjct: 238 LEKIYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKY 297

Query: 221 TTVDEYLNQFI 231
           TTV+EYL+QF+
Sbjct: 298 TTVEEYLDQFV 308





Olea europaea (taxid: 4146)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|P52578|IFRH_SOLTU Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P52579|IFRH_TOBAC Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P52580|IFRH_MAIZE Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1 Back     alignment and function description
>sp|P52577|IFRH_ARATH Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1 Back     alignment and function description
>sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 Back     alignment and function description
>sp|P52575|IFR_MEDSA Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|Q00016|IFR_CICAR Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1 Back     alignment and function description
>sp|Q15GI3|IGS1_PETHY Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1 Back     alignment and function description
>sp|P52581|IFRH_LUPAL Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
76559894306 TPA: isoflavone reductase-like protein 5 0.961 0.725 0.361 3e-37
225428436306 PREDICTED: isoflavone reductase homolog 0.961 0.725 0.358 6e-37
169639226305 phenylcoumaran benzylic ether reductase 0.987 0.747 0.347 1e-35
169639228305 phenylcoumaran benzylic ether reductase 0.987 0.747 0.347 3e-35
449438299308 PREDICTED: isoflavone reductase homolog 0.978 0.733 0.348 6e-34
225428438308 PREDICTED: isoflavone reductase homolog 0.978 0.733 0.354 2e-33
76559896308 TPA: isoflavone reductase-like protein 6 0.978 0.733 0.364 2e-33
149349524309 eugenol synthase 2 [Clarkia breweri] 0.978 0.731 0.343 2e-32
225428442308 PREDICTED: isoflavone reductase homolog 0.978 0.733 0.357 2e-32
225458243308 PREDICTED: isoflavone reductase homolog 0.961 0.720 0.350 2e-32
>gi|76559894|tpe|CAI56334.1| TPA: isoflavone reductase-like protein 5 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 150/315 (47%), Gaps = 93/315 (29%)

Query: 1   MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFH-SGVFDYWG 59
           M+ KS +L+IG  G IG      S + GHP FAL+R+S  +  F ++  F  SGV   +G
Sbjct: 1   MSEKSKILIIGGTGYIGKFIVAASAKSGHPTFALVRESTVSEKFEIIESFKSSGVTLVYG 60

Query: 60  LLEDEKSLLEAVKQVDV---------------------------RFIPSEYGAGVFVKDT 92
            L D +SL++A+KQVDV                           RF PSE+G      D 
Sbjct: 61  DLYDHESLVKAIKQVDVVISTVGHAQLPDQVKIIAAIKEAGNVKRFFPSEFG-----NDV 115

Query: 93  DVAAFTINALDDPRT-------LNKLLHLREISHTFNMES--------SGELDGTKLYPH 137
           D     ++A++  +T       + + +    I +T+   +        S    G    P 
Sbjct: 116 D----RVHAVEPAKTAFATKAQIRRTIEAEGIPYTYVSSNFFAGYFLPSLSQPGATTPPR 171

Query: 138 LKYTTISDYLDTSV----------------------------PRGNIYSFNDLVSLWEEK 169
            K   + D    +V                            P  N YSFNDLVSLWE+K
Sbjct: 172 DKVIILGDGNPKAVFNKEDDIGTYTIKAVDDPRTLNKILYIRPPQNTYSFNDLVSLWEKK 231

Query: 170 IGKALDRVYVAEDQLLKNIQEKARVL-------------GDQTNFEIEPSFGVEATELYP 216
           IGK L+++YV E+Q+LKNIQE +  L             GD TNFEIEPSFGVEATELYP
Sbjct: 232 IGKTLEKIYVPEEQVLKNIQEASVPLNVILSISHSVFIKGDHTNFEIEPSFGVEATELYP 291

Query: 217 DVNYTTVDEYLNQFI 231
           DV YTTVDEYLNQF+
Sbjct: 292 DVKYTTVDEYLNQFV 306




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225428436|ref|XP_002283953.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744403|emb|CBI37665.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|169639226|gb|ACA60729.1| phenylcoumaran benzylic ether reductase 1 [Linum corymbulosum] Back     alignment and taxonomy information
>gi|169639228|gb|ACA60730.1| phenylcoumaran benzylic ether reductase 2 [Linum corymbulosum] Back     alignment and taxonomy information
>gi|449438299|ref|XP_004136926.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] gi|449478781|ref|XP_004155417.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|225428438|ref|XP_002284006.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744402|emb|CBI37664.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|76559896|tpe|CAI56335.1| TPA: isoflavone reductase-like protein 6 [Vitis vinifera] Back     alignment and taxonomy information
>gi|149349524|gb|ABR24114.1| eugenol synthase 2 [Clarkia breweri] Back     alignment and taxonomy information
>gi|225428442|ref|XP_002283978.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera] gi|297744400|emb|CBI37662.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458243|ref|XP_002282110.1| PREDICTED: isoflavone reductase homolog P3 [Vitis vinifera] gi|302142513|emb|CBI19716.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
TAIR|locus:2136383308 AT4G39230 [Arabidopsis thalian 0.346 0.259 0.612 1.9e-43
TAIR|locus:2016482310 AT1G19540 [Arabidopsis thalian 0.346 0.258 0.537 1.3e-30
TAIR|locus:2025197318 AT1G75290 [Arabidopsis thalian 0.341 0.248 0.510 5.3e-30
TAIR|locus:2139494306 AT4G34540 [Arabidopsis thalian 0.346 0.261 0.462 8.2e-30
TAIR|locus:2025167322 AT1G75300 [Arabidopsis thalian 0.341 0.245 0.516 1.4e-29
TAIR|locus:2025192310 AT1G75280 [Arabidopsis thalian 0.341 0.254 0.516 3.7e-29
TAIR|locus:2119455317 PRR2 "pinoresinol reductase 2" 0.346 0.252 0.351 1.8e-14
TAIR|locus:2031730317 PRR1 "pinoresinol reductase 1" 0.393 0.287 0.318 5.5e-09
TAIR|locus:2136383 AT4G39230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 264 (98.0 bits), Expect = 1.9e-43, Sum P(3) = 1.9e-43
 Identities = 57/93 (61%), Positives = 65/93 (69%)

Query:   152 PRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKARVL-------------GDQ 198
             P  N YSFNDLVSLWE KIGK L+R+YV E+QLLK I E +  L             G  
Sbjct:   216 PPMNTYSFNDLVSLWENKIGKTLERIYVPEEQLLKQIIESSPPLNVMLSLCHCVFVKGGH 275

Query:   199 TNFEIEPSFGVEATELYPDVNYTTVDEYLNQFI 231
             T+FEIEPSFGVEA+ELYPDV YTTVDE LNQ++
Sbjct:   276 TSFEIEPSFGVEASELYPDVKYTTVDEILNQYV 308


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0032442 "phenylcoumaran benzylic ether reductase activity" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2016482 AT1G19540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025197 AT1G75290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139494 AT4G34540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025167 AT1G75300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025192 AT1G75280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119455 PRR2 "pinoresinol reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031730 PRR1 "pinoresinol reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036361001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (285 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
pfam05368232 pfam05368, NmrA, NmrA-like family 6e-09
cd05259282 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ethe 3e-08
pfam05368232 pfam05368, NmrA, NmrA-like family 2e-05
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 2e-05
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 7e-04
cd05244207 cd05244, BVR-B_like_SDR_a, biliverdin IX beta redu 0.001
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 0.002
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 0.002
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
 Score = 54.2 bits (131), Expect = 6e-09
 Identities = 31/74 (41%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 7  VLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHS-GVFDYWGLLEDEK 65
          +LV GA G  G    R S++ GHP  AL+RD  S     L +   + GV    G L+D +
Sbjct: 1  ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKS----ELAKSLKAAGVELVEGDLDDHE 56

Query: 66 SLLEAVKQVDVRFI 79
          SL+EA+K VDV F 
Sbjct: 57 SLVEALKGVDVVFS 70


NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families. Length = 232

>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase (PCBER) like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187555 cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.77
CHL00194317 ycf39 Ycf39; Provisional 99.74
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.71
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.67
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.55
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.4
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.32
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.26
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.26
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.24
PLN00016378 RNA-binding protein; Provisional 99.22
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.14
PLN02214 342 cinnamoyl-CoA reductase 99.11
PLN00198338 anthocyanidin reductase; Provisional 99.11
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.11
PLN02583297 cinnamoyl-CoA reductase 99.1
PLN02427 386 UDP-apiose/xylose synthase 99.07
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.06
PLN02206 442 UDP-glucuronate decarboxylase 99.06
PLN02650 351 dihydroflavonol-4-reductase 99.06
PLN02695 370 GDP-D-mannose-3',5'-epimerase 99.06
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.05
PLN02166436 dTDP-glucose 4,6-dehydratase 99.05
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.04
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.04
PRK05865 854 hypothetical protein; Provisional 99.04
PRK07201 657 short chain dehydrogenase; Provisional 99.03
COG0300265 DltE Short-chain dehydrogenases of various substra 99.02
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.02
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.01
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.01
COG2910211 Putative NADH-flavin reductase [General function p 98.99
PLN02686367 cinnamoyl-CoA reductase 98.99
PLN02896 353 cinnamyl-alcohol dehydrogenase 98.98
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 98.97
PRK06179270 short chain dehydrogenase; Provisional 98.96
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.95
PLN02572 442 UDP-sulfoquinovose synthase 98.94
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 98.94
PLN02260 668 probable rhamnose biosynthetic enzyme 98.94
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.93
PRK05993277 short chain dehydrogenase; Provisional 98.91
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.91
PRK06180277 short chain dehydrogenase; Provisional 98.89
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.89
PRK06182273 short chain dehydrogenase; Validated 98.88
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.88
PLN03209 576 translocon at the inner envelope of chloroplast su 98.87
PRK10675 338 UDP-galactose-4-epimerase; Provisional 98.87
PLN02653340 GDP-mannose 4,6-dehydratase 98.87
PRK09135249 pteridine reductase; Provisional 98.86
PRK09186256 flagellin modification protein A; Provisional 98.86
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.86
PRK07806248 short chain dehydrogenase; Provisional 98.86
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.86
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 98.85
PLN02240 352 UDP-glucose 4-epimerase 98.85
PRK06482276 short chain dehydrogenase; Provisional 98.85
PRK09291257 short chain dehydrogenase; Provisional 98.85
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.85
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.84
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.84
PRK06194287 hypothetical protein; Provisional 98.84
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.83
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.82
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 98.82
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.81
PRK08219227 short chain dehydrogenase; Provisional 98.8
PRK12320 699 hypothetical protein; Provisional 98.79
PRK07454241 short chain dehydrogenase; Provisional 98.79
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.79
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.79
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.78
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.77
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.77
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 98.76
PRK07814263 short chain dehydrogenase; Provisional 98.76
PRK12828239 short chain dehydrogenase; Provisional 98.76
PRK07102243 short chain dehydrogenase; Provisional 98.76
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.75
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.75
PRK10538248 malonic semialdehyde reductase; Provisional 98.75
PRK08267260 short chain dehydrogenase; Provisional 98.73
PRK12829264 short chain dehydrogenase; Provisional 98.73
PRK05866293 short chain dehydrogenase; Provisional 98.73
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 98.73
PRK07326237 short chain dehydrogenase; Provisional 98.73
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.73
PRK06138252 short chain dehydrogenase; Provisional 98.73
PRK05693274 short chain dehydrogenase; Provisional 98.72
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.72
PRK07890258 short chain dehydrogenase; Provisional 98.72
PRK09134258 short chain dehydrogenase; Provisional 98.72
PRK08265261 short chain dehydrogenase; Provisional 98.72
PRK06101240 short chain dehydrogenase; Provisional 98.72
PRK06172253 short chain dehydrogenase; Provisional 98.72
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.72
PRK12937245 short chain dehydrogenase; Provisional 98.72
PRK08628258 short chain dehydrogenase; Provisional 98.71
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 98.71
PRK08643256 acetoin reductase; Validated 98.71
PRK07774250 short chain dehydrogenase; Provisional 98.71
PRK08263275 short chain dehydrogenase; Provisional 98.71
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 98.71
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.71
PRK05717255 oxidoreductase; Validated 98.71
PRK07523255 gluconate 5-dehydrogenase; Provisional 98.7
PRK06914280 short chain dehydrogenase; Provisional 98.7
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.7
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.69
PRK07074257 short chain dehydrogenase; Provisional 98.69
PRK08251248 short chain dehydrogenase; Provisional 98.69
PRK07453322 protochlorophyllide oxidoreductase; Validated 98.69
PLN02253280 xanthoxin dehydrogenase 98.68
PRK06924251 short chain dehydrogenase; Provisional 98.68
PRK05875276 short chain dehydrogenase; Provisional 98.68
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.68
PRK07024257 short chain dehydrogenase; Provisional 98.68
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.68
PRK12746254 short chain dehydrogenase; Provisional 98.67
PRK07023243 short chain dehydrogenase; Provisional 98.67
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.67
PRK08226263 short chain dehydrogenase; Provisional 98.67
PRK08264238 short chain dehydrogenase; Validated 98.66
PRK12743256 oxidoreductase; Provisional 98.66
PRK12939250 short chain dehydrogenase; Provisional 98.66
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.66
PRK07478254 short chain dehydrogenase; Provisional 98.66
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.65
PRK05876275 short chain dehydrogenase; Provisional 98.65
PRK07067257 sorbitol dehydrogenase; Provisional 98.65
PRK07904253 short chain dehydrogenase; Provisional 98.65
PRK12827249 short chain dehydrogenase; Provisional 98.64
PRK06181263 short chain dehydrogenase; Provisional 98.64
PRK08278273 short chain dehydrogenase; Provisional 98.64
PRK06057255 short chain dehydrogenase; Provisional 98.64
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.63
PRK06196315 oxidoreductase; Provisional 98.63
PRK05854313 short chain dehydrogenase; Provisional 98.63
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.63
PRK07063260 short chain dehydrogenase; Provisional 98.63
PRK05867253 short chain dehydrogenase; Provisional 98.63
PRK06947248 glucose-1-dehydrogenase; Provisional 98.62
PRK07109334 short chain dehydrogenase; Provisional 98.62
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.62
PRK06483236 dihydromonapterin reductase; Provisional 98.62
PRK07775274 short chain dehydrogenase; Provisional 98.62
PRK06949258 short chain dehydrogenase; Provisional 98.62
PRK06398258 aldose dehydrogenase; Validated 98.62
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.61
PRK05650270 short chain dehydrogenase; Provisional 98.61
PRK06197306 short chain dehydrogenase; Provisional 98.61
PRK08177225 short chain dehydrogenase; Provisional 98.61
PRK08017256 oxidoreductase; Provisional 98.61
PRK06841255 short chain dehydrogenase; Provisional 98.61
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.61
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.6
PRK12744257 short chain dehydrogenase; Provisional 98.6
PRK07856252 short chain dehydrogenase; Provisional 98.6
PRK06500249 short chain dehydrogenase; Provisional 98.6
PRK06114254 short chain dehydrogenase; Provisional 98.6
PRK07576264 short chain dehydrogenase; Provisional 98.6
PRK07577234 short chain dehydrogenase; Provisional 98.6
PRK08277278 D-mannonate oxidoreductase; Provisional 98.59
PRK12367245 short chain dehydrogenase; Provisional 98.59
PRK07825273 short chain dehydrogenase; Provisional 98.59
PRK06128300 oxidoreductase; Provisional 98.59
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.58
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.58
PRK08339263 short chain dehydrogenase; Provisional 98.58
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.58
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.58
PRK12938246 acetyacetyl-CoA reductase; Provisional 98.58
PRK09072263 short chain dehydrogenase; Provisional 98.57
PRK06523260 short chain dehydrogenase; Provisional 98.57
PRK05884223 short chain dehydrogenase; Provisional 98.57
PRK08589272 short chain dehydrogenase; Validated 98.57
PRK06123248 short chain dehydrogenase; Provisional 98.56
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.56
PRK06701290 short chain dehydrogenase; Provisional 98.56
PRK06139330 short chain dehydrogenase; Provisional 98.56
PRK07060245 short chain dehydrogenase; Provisional 98.55
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.55
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.55
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.55
PRK05855582 short chain dehydrogenase; Validated 98.54
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.54
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.53
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 98.53
PRK12747252 short chain dehydrogenase; Provisional 98.53
TIGR02415254 23BDH acetoin reductases. One member of this famil 98.53
PRK12742237 oxidoreductase; Provisional 98.53
PRK06124256 gluconate 5-dehydrogenase; Provisional 98.52
PRK06198260 short chain dehydrogenase; Provisional 98.52
PRK08340259 glucose-1-dehydrogenase; Provisional 98.52
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.52
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.52
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.51
PRK07677252 short chain dehydrogenase; Provisional 98.5
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.5
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.5
PRK07062265 short chain dehydrogenase; Provisional 98.5
PLN02996 491 fatty acyl-CoA reductase 98.49
PRK06953222 short chain dehydrogenase; Provisional 98.49
PRK07035252 short chain dehydrogenase; Provisional 98.49
PRK08936261 glucose-1-dehydrogenase; Provisional 98.47
PRK07985294 oxidoreductase; Provisional 98.47
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.47
PLN02503 605 fatty acyl-CoA reductase 2 98.47
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 98.47
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.46
PRK07832272 short chain dehydrogenase; Provisional 98.46
PRK08309177 short chain dehydrogenase; Provisional 98.45
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.44
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.44
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.43
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.43
PRK09242257 tropinone reductase; Provisional 98.42
PRK07201657 short chain dehydrogenase; Provisional 98.4
PRK06125259 short chain dehydrogenase; Provisional 98.4
PRK07831262 short chain dehydrogenase; Provisional 98.39
PLN02778298 3,5-epimerase/4-reductase 98.38
PRK07791286 short chain dehydrogenase; Provisional 98.38
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 98.38
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.37
PRK08303305 short chain dehydrogenase; Provisional 98.37
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.36
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 98.36
PRK09009235 C factor cell-cell signaling protein; Provisional 98.36
PRK05872296 short chain dehydrogenase; Provisional 98.35
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.35
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 98.35
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.34
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 98.33
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 98.33
PRK07069251 short chain dehydrogenase; Validated 98.33
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.32
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 98.32
PRK08703239 short chain dehydrogenase; Provisional 98.32
PRK08862227 short chain dehydrogenase; Provisional 98.31
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.3
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 98.3
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.29
PRK07041230 short chain dehydrogenase; Provisional 98.29
PRK06940275 short chain dehydrogenase; Provisional 98.28
PRK05599246 hypothetical protein; Provisional 98.27
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.27
PRK06484520 short chain dehydrogenase; Validated 98.25
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.25
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.25
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.24
PRK06484 520 short chain dehydrogenase; Validated 98.24
PRK06720169 hypothetical protein; Provisional 98.24
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 98.23
PRK08324681 short chain dehydrogenase; Validated 98.22
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.2
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 98.2
PRK07578199 short chain dehydrogenase; Provisional 98.19
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 98.18
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 98.18
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.18
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.17
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.16
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.16
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.15
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 98.15
PLN02780320 ketoreductase/ oxidoreductase 98.14
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.1
COG1028251 FabG Dehydrogenases with different specificities ( 98.1
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 98.08
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 98.06
KOG1208314 consensus Dehydrogenases with different specificit 98.06
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.99
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 97.97
PLN00015308 protochlorophyllide reductase 97.92
PRK09620229 hypothetical protein; Provisional 97.9
KOG1611249 consensus Predicted short chain-type dehydrogenase 97.89
PLN02260668 probable rhamnose biosynthetic enzyme 97.88
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 97.88
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.79
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.78
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.78
KOG0725270 consensus Reductases with broad range of substrate 97.76
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.75
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.71
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 97.66
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.64
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 97.62
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 97.59
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 97.54
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.54
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 97.54
PRK09496 453 trkA potassium transporter peripheral membrane com 97.53
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 97.48
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 97.46
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 97.45
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.45
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.41
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 97.4
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.4
PRK14982340 acyl-ACP reductase; Provisional 97.37
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.36
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.33
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.15
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 97.12
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 97.1
PLN02730303 enoyl-[acyl-carrier-protein] reductase 97.0
PRK09496453 trkA potassium transporter peripheral membrane com 96.9
PLN00106323 malate dehydrogenase 96.87
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.86
KOG2774366 consensus NAD dependent epimerase [General functio 96.86
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.85
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.85
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.8
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.8
PTZ00325321 malate dehydrogenase; Provisional 96.79
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.77
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.76
PRK10669558 putative cation:proton antiport protein; Provision 96.7
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.63
KOG2733 423 consensus Uncharacterized membrane protein [Functi 96.62
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.59
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 96.59
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.55
PRK03659601 glutathione-regulated potassium-efflux system prot 96.44
PRK05086312 malate dehydrogenase; Provisional 96.42
PRK05442326 malate dehydrogenase; Provisional 96.4
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.38
PLN02383 344 aspartate semialdehyde dehydrogenase 96.33
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 96.31
PRK03562621 glutathione-regulated potassium-efflux system prot 96.31
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.28
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.23
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 96.22
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.17
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 96.15
PRK06849 389 hypothetical protein; Provisional 96.11
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.11
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.08
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.07
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.07
PRK10537393 voltage-gated potassium channel; Provisional 96.02
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 96.01
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.99
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.87
PRK04148134 hypothetical protein; Provisional 95.85
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.78
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 95.74
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 95.73
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.72
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.65
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 95.64
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 95.59
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.56
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 95.55
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 95.53
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 95.53
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 95.52
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.48
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.47
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.47
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.45
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 95.45
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.45
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.43
PRK06444197 prephenate dehydrogenase; Provisional 95.42
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 95.41
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 95.4
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.4
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.37
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 95.34
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 95.34
PRK08655 437 prephenate dehydrogenase; Provisional 95.32
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 95.21
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.2
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 95.13
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.13
PRK06719157 precorrin-2 dehydrogenase; Validated 95.1
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.03
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.0
PLN02948 577 phosphoribosylaminoimidazole carboxylase 94.98
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 94.97
COG3268 382 Uncharacterized conserved protein [Function unknow 94.96
PRK00048257 dihydrodipicolinate reductase; Provisional 94.92
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 94.88
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 94.87
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 94.87
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 94.86
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.76
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.75
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 94.71
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.68
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 94.67
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.64
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.63
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 94.57
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.55
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 94.49
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.46
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 94.44
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.44
PLN02688266 pyrroline-5-carboxylate reductase 94.41
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 94.41
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 94.36
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.32
PRK08163 396 salicylate hydroxylase; Provisional 94.29
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.27
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 94.22
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.19
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.17
PRK06847 375 hypothetical protein; Provisional 94.13
PRK12921305 2-dehydropantoate 2-reductase; Provisional 94.1
COG0623259 FabI Enoyl-[acyl-carrier-protein] 94.08
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.05
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 93.99
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 93.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.96
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 93.96
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 93.83
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.79
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.76
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 93.73
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.73
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 93.71
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.7
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.69
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.67
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 93.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 93.65
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 93.64
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 93.64
PRK08818 370 prephenate dehydrogenase; Provisional 93.63
PLN00203519 glutamyl-tRNA reductase 93.61
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 93.59
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.56
PTZ00075476 Adenosylhomocysteinase; Provisional 93.56
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 93.55
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.54
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 93.52
PRK05479330 ketol-acid reductoisomerase; Provisional 93.52
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.51
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 93.47
PLN02494477 adenosylhomocysteinase 93.45
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 93.43
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 93.41
PRK06545 359 prephenate dehydrogenase; Validated 93.41
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 93.4
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.4
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.39
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 93.37
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.36
PRK13940414 glutamyl-tRNA reductase; Provisional 93.35
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 93.32
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 93.26
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.18
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.13
PRK07417279 arogenate dehydrogenase; Reviewed 93.1
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 93.07
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.05
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 93.03
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.03
PRK07236 386 hypothetical protein; Provisional 93.01
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 92.87
PLN02928347 oxidoreductase family protein 92.87
cd05295 452 MDH_like Malate dehydrogenase-like. These MDH-like 92.8
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 92.76
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 92.74
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.73
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 92.73
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 92.7
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 92.63
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 92.62
PTZ00082321 L-lactate dehydrogenase; Provisional 92.59
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.58
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.55
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 92.55
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.35
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.35
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.29
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 92.28
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.25
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 92.14
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.07
PRK12549284 shikimate 5-dehydrogenase; Reviewed 92.05
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 92.05
PRK07574385 formate dehydrogenase; Provisional 92.04
PRK07208 479 hypothetical protein; Provisional 92.03
PRK13403 335 ketol-acid reductoisomerase; Provisional 91.97
PLN02256304 arogenate dehydrogenase 91.97
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 91.91
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 91.83
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 91.81
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.76
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 91.76
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 91.69
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 91.62
PLN02353 473 probable UDP-glucose 6-dehydrogenase 91.57
PLN02602350 lactate dehydrogenase 91.52
KOG4288283 consensus Predicted oxidoreductase [General functi 91.38
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 91.33
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
Probab=99.77  E-value=1.1e-17  Score=140.77  Aligned_cols=67  Identities=15%  Similarity=0.118  Sum_probs=56.6

Q ss_pred             eEEEEcCCChhHHHHHHHHHhCCCCEEEEEcCCCCchhhhhhhhhcCCcEEEEEcCCCHHHHHHHH------cc-CCEEE
Q 043777            6 NVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFNFSLLRVFHSGVFDYWGLLEDEKSLLEAV------KQ-VDVRF   78 (231)
Q Consensus         6 ~ilVtGatG~iG~~i~~~L~~~g~~v~~~~R~~~~~~~~~~~~~~~~~v~~~~~D~~d~~~l~~al------~~-~d~~f   78 (231)
                      +|+||||||++|++++++|+++|++|++++|+.+.   .   .  ..++..+.+|++|++++..++      ++ +|.+|
T Consensus         1 ~ilVtGatG~iG~~vv~~L~~~g~~V~~~~R~~~~---~---~--~~~~~~~~~d~~d~~~l~~a~~~~~~~~g~~d~v~   72 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSS---S---A--GPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAVY   72 (285)
T ss_pred             CEEEEcCCChHHHHHHHHHHhCCCcEEEEeCCCcc---c---c--CCCCccccccCCCHHHHHHHHhcccCcCCceeEEE
Confidence            48999999999999999999999999999998642   1   0  146677889999999999999      56 88887


Q ss_pred             Ec
Q 043777           79 IP   80 (231)
Q Consensus        79 ~p   80 (231)
                      +.
T Consensus        73 ~~   74 (285)
T TIGR03649        73 LV   74 (285)
T ss_pred             Ee
Confidence            63



This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.

>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
1qyc_A308 Crystal Structures Of Pinoresinol-Lariciresinol And 3e-28
2gas_A307 Crystal Structure Of Isoflavone Reductase Length = 4e-23
1qyd_A313 Crystal Structures Of Pinoresinol-Lariciresinol And 2e-17
3i52_A346 Ternary Complex Structure Of Leucoanthocyanidin Red 3e-14
3c1o_A321 The Multiple Phenylpropene Synthases In Both Clarki 3e-09
2r2g_A318 Structure Of Eugenol Synthase From Ocimum Basilicum 9e-09
2qw8_A314 Structure Of Eugenol Synthase From Ocimum Basilicum 9e-09
2qx7_A318 Structure Of Eugenol Synthase From Ocimum Basilicum 1e-08
3c3x_A318 The Multiple Phenylpropene Synthases In Both Clarki 1e-08
>pdb|1QYC|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 308 Back     alignment and structure

Iteration: 1

Score = 121 bits (304), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 100/314 (31%), Positives = 141/314 (44%), Gaps = 89/314 (28%) Query: 1 MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNFN---FSLLRVFH-SGVFD 56 M +S +L+IGA G IG H + S++ GHP F L+R+S ++ N LL F SG Sbjct: 1 MGSRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANI 60 Query: 57 YWGLLEDEKSLLEAVKQVDV---------------------------RFIPSEYGA---G 86 G ++D SL+EAVK VDV RF PSE+G Sbjct: 61 VHGSIDDHASLVEAVKNVDVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDN 120 Query: 87 VFVKDTDVAAFTINALDDPRTLNKLLHLREISHTF------------NMESSGEL----- 129 V + + F + A + + + I +T+ ++ +G Sbjct: 121 VHAVEPAKSVFEVKA-----KVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGLTAPPRD 175 Query: 130 ------DGTKLYPHLKYTTISDYLDTSV--PR-----------GNIYSFNDLVSLWEEKI 170 DG +K I + +V PR N S N+LV+LWE+KI Sbjct: 176 KVVILGDGNARVVFVKEEDIGTFTIKAVDDPRTLNKTLYLRLPANTLSLNELVALWEKKI 235 Query: 171 GKALDRVYVAEDQLLK-------------NIQEKARVLGDQTNFEIEPSFGVEATELYPD 217 K L++ YV E+++LK I V GDQTNFEI P+ GVEA++LYPD Sbjct: 236 DKTLEKAYVPEEEVLKLIADTPFPANISIAISHSIFVKGDQTNFEIGPA-GVEASQLYPD 294 Query: 218 VNYTTVDEYLNQFI 231 V YTTVDEYL+ F+ Sbjct: 295 VKYTTVDEYLSNFV 308
>pdb|2GAS|A Chain A, Crystal Structure Of Isoflavone Reductase Length = 307 Back     alignment and structure
>pdb|1QYD|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And Phenylcoumaran Benzylic Ether Reductases, And Their Relationship To Isoflavone Reductases Length = 313 Back     alignment and structure
>pdb|3I52|A Chain A, Ternary Complex Structure Of Leucoanthocyanidin Reductase From Vitis Vinifera Length = 346 Back     alignment and structure
>pdb|3C1O|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 321 Back     alignment and structure
>pdb|2R2G|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Complexed With Emdf Length = 318 Back     alignment and structure
>pdb|2QW8|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 314 Back     alignment and structure
>pdb|2QX7|A Chain A, Structure Of Eugenol Synthase From Ocimum Basilicum Length = 318 Back     alignment and structure
>pdb|3C3X|A Chain A, The Multiple Phenylpropene Synthases In Both Clarkia Breweri And Petunia Hybrida Represent Two Distinct Lineages Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 9e-34
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 3e-31
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 3e-30
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 7e-28
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 3e-08
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 3e-04
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 3e-27
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 4e-11
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 1e-23
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 1e-08
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 1e-06
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 1e-05
1xq6_A253 Unknown protein; structural genomics, protein stru 9e-05
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 1e-04
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 2e-04
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2e-04
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 4e-04
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 5e-04
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 6e-04
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
 Score =  122 bits (307), Expect = 9e-34
 Identities = 73/315 (23%), Positives = 121/315 (38%), Gaps = 86/315 (27%)

Query: 1   MAGKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASN---FNFSLLRVFHSGVFDY 57
           M  KS VL++G  G IG      SI  GHP + L R    +       LL     G    
Sbjct: 1   MDKKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLI 60

Query: 58  WGLLEDEKSLLEAVKQVDV-------------------------------RFIPSEYGAG 86
              L+D + L++A+KQVDV                               RF+PSE+G  
Sbjct: 61  EASLDDHQRLVDALKQVDVVISALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMD 120

Query: 87  VFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESS---------GELDGTKLYPH 137
             + +  +         D R + + +    I +T+   +           +LDG  + P 
Sbjct: 121 PDIMEHALQPG-SITFIDKRKVRRAIEAASIPYTYVSSNMFAGYFAGSLAQLDGHMMPPR 179

Query: 138 LK------------YTTISD---------YLDTSVPR-------GNIYSFNDLVSLWEEK 169
            K            +    D             ++ +        NI S  +++ +WE  
Sbjct: 180 DKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIRPPMNILSQKEVIQIWERL 239

Query: 170 IGKALDRVYVAEDQLLKNIQEKAR-------------VLGDQTNFEIEPSFGVEATELYP 216
             + LD++Y++    L ++++K+                GD  NFEI P+  +EAT+LYP
Sbjct: 240 SEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPN-AIEATKLYP 298

Query: 217 DVNYTTVDEYLNQFI 231
           +V Y T+D YL +++
Sbjct: 299 EVKYVTMDSYLERYV 313


>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.93
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.93
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.91
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.9
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.9
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.88
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.81
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.74
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.65
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.65
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.61
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.6
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.59
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.55
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.55
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.5
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.5
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.47
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.45
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.43
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.43
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.43
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.43
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.41
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.41
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.4
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.37
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.36
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.35
1xq6_A253 Unknown protein; structural genomics, protein stru 99.35
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.33
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.33
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.32
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.31
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.3
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.3
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.29
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.29
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.28
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.27
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.24
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.23
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.23
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.22
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.22
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.21
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.19
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.18
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.18
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.18
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.16
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.16
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.15
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.13
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.13
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.13
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.12
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.11
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.11
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.1
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.1
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.1
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.09
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.07
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.07
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.05
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.05
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.04
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.04
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.03
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.03
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.03
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.03
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.03
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.02
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.01
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.01
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.01
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.0
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.0
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.0
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 98.99
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.99
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.98
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.98
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.97
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 98.97
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.97
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.97
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.96
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.96
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.96
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.96
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.96
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.95
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.94
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.94
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.94
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.93
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.93
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.93
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.92
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.92
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.92
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.92
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.92
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.92
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.91
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.91
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.91
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.91
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.91
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.91
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.9
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.89
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.89
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.89
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.89
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 98.89
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.88
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.88
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.88
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.88
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.88
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.88
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.88
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.88
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.88
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.88
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.88
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.88
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.88
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 98.88
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.88
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.87
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.87
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.87
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.87
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.87
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.87
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.87
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.86
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.86
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.86
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.86
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.86
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.86
3cxt_A291 Dehydrogenase with different specificities; rossma 98.86
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.86
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.85
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.85
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 98.85
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.85
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.85
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.85
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 98.85
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.85
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.85
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.85
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.85
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.85
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 98.85
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.84
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.84
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.84
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.84
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.84
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.84
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.84
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.84
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.84
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.84
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.84
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.84
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.84
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.84
1spx_A278 Short-chain reductase family member (5L265); paral 98.84
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.83
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.83
3rih_A293 Short chain dehydrogenase or reductase; structural 98.83
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.83
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.83
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 98.82
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.82
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.82
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.82
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.82
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.82
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.82
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.82
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.82
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.81
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.81
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.81
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 98.81
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.81
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.81
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.81
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.81
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.8
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.8
1xkq_A280 Short-chain reductase family member (5D234); parra 98.8
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.8
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.8
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.79
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.79
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.79
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.79
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.79
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.79
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.79
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.79
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.78
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.78
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 98.78
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.78
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.78
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.78
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.78
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.78
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.78
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.78
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.78
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.77
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.77
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.77
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.77
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.77
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.77
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.76
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.76
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 98.76
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.76
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.75
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.75
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.74
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.74
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.74
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.74
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.73
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.73
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.73
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.72
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.72
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.72
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.72
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.72
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.72
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.72
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.71
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.71
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.71
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.7
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.7
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.69
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.69
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.69
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.69
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.69
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.68
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.68
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.68
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.68
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.68
4e4y_A244 Short chain dehydrogenase family protein; structur 98.68
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.68
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.67
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.66
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.66
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.66
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.66
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.65
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.64
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.64
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.64
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.63
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 98.63
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 98.61
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 98.59
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 98.58
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.58
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.57
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.57
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.57
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.56
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.55
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.54
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.53
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.51
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.49
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.49
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.46
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.44
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.44
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.39
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 98.38
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.34
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 98.31
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.31
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.27
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.2
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.2
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.2
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.18
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.18
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.1
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.09
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.09
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.05
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.04
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 98.02
3slk_A795 Polyketide synthase extender module 2; rossmann fo 98.02
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.96
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.95
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.9
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.9
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.86
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.85
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 97.8
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 97.79
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.78
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 97.74
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.74
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 97.72
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.65
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.61
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 97.53
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.53
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.51
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.5
1lnq_A336 MTHK channels, potassium channel related protein; 97.48
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.44
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.44
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.43
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.32
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 97.31
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.31
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.29
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 97.21
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.13
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.12
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.11
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.11
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.11
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.06
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.01
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.97
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.97
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.94
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.94
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 96.94
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.87
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.87
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.82
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.73
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.73
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 96.7
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.64
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.58
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.56
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.55
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.54
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.53
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.51
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.42
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.4
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 96.38
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.37
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.35
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.35
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.34
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.29
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 96.28
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.26
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.24
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 96.21
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.15
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.1
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.08
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.08
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.07
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 96.05
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.04
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.01
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.0
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.0
4ezb_A317 Uncharacterized conserved protein; structural geno 95.97
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 95.95
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 95.94
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.94
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.92
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.87
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.85
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.85
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.82
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 95.82
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 95.8
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.8
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.79
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 95.77
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.75
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.74
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.72
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.69
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.67
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.67
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 95.63
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 95.61
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.57
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 95.55
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 95.55
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 95.5
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.42
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.41
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 95.4
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 95.39
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.39
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 95.39
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.38
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 95.38
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 95.37
1yb4_A295 Tartronic semialdehyde reductase; structural genom 95.36
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.36
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.35
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 95.34
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.33
3gms_A340 Putative NADPH:quinone reductase; structural genom 95.3
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 95.3
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.3
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 95.3
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.26
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 95.23
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.22
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 95.18
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.15
4gx0_A565 TRKA domain protein; membrane protein, ION channel 95.14
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.13
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 95.12
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 95.12
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.12
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.12
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 95.11
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 95.11
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.1
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.06
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.03
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 95.03
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.98
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 94.92
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.91
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 94.9
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.85
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 94.83
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.79
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 94.75
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 94.74
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 94.74
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 94.74
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.74
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.73
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.7
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.69
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.65
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.64
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 94.62
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 94.61
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 94.58
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.58
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 94.57
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 94.55
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 94.54
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 94.54
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.46
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 94.45
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.42
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 94.42
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.4
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 94.37
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.35
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 94.33
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 94.31
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 94.3
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.28
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.27
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 94.24
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 94.21
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.2
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.18
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.15
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.12
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.06
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 94.06
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 94.06
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.06
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.05
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.03
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 94.02
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.0
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
Probab=99.93  E-value=1.9e-25  Score=191.40  Aligned_cols=222  Identities=26%  Similarity=0.466  Sum_probs=136.7

Q ss_pred             CCeEEEEcCCChhHHHHHHHHHhCCCCEEEEEcCCCCch-hhhhhhhhc-CCcEEEEEcCCCHHHHHHHHc--cCCEEEE
Q 043777            4 KSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNF-NFSLLRVFH-SGVFDYWGLLEDEKSLLEAVK--QVDVRFI   79 (231)
Q Consensus         4 ~~~ilVtGatG~iG~~i~~~L~~~g~~v~~~~R~~~~~~-~~~~~~~~~-~~v~~~~~D~~d~~~l~~al~--~~d~~f~   79 (231)
                      +|+|+||||||+||++|+++|++.|++|++++|+.+..+ +.+.+..+. .++.++.+|++|.+++.++++  ++|++++
T Consensus        10 ~~~IlVtGatG~iG~~l~~~L~~~g~~V~~l~R~~~~~~~~~~~~~~l~~~~v~~~~~Dl~d~~~l~~~~~~~~~d~Vi~   89 (346)
T 3i6i_A           10 KGRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVS   89 (346)
T ss_dssp             -CCEEEECTTSHHHHHHHHHHHHTTCCEEEEECSSCCCHHHHHHHHHHHHTTCEEEECCTTCHHHHHHHHHHTTCCEEEE
T ss_pred             CCeEEEECCCcHHHHHHHHHHHHCCCCEEEEECCCCCChhHHHHHHHHHhCCcEEEEeecCCHHHHHHHHhhCCCCEEEE
Confidence            468999999999999999999999999999999864332 233333444 789999999999999999999  8998554


Q ss_pred             ---------------------------cccCCCcce-eec-hhHH-----HHHHH-hhcCccccCceEEEe-----e---
Q 043777           80 ---------------------------PSEYGAGVF-VKD-TDVA-----AFTIN-ALDDPRTLNKLLHLR-----E---  116 (231)
Q Consensus        80 ---------------------------ps~~g~~~~-~~~-~di~-----~~~~~-~~~~~~~~~~~~~~~-----~---  116 (231)
                                                 +|.||...- .+. ....     +..+. .+.+ .... ...++     +   
T Consensus        90 ~a~~~n~~~~~~l~~aa~~~g~v~~~v~S~~g~~~~e~~~~~p~~~y~~sK~~~e~~l~~-~g~~-~tivrpg~~~g~~~  167 (346)
T 3i6i_A           90 TVGGESILDQIALVKAMKAVGTIKRFLPSEFGHDVNRADPVEPGLNMYREKRRVRQLVEE-SGIP-FTYICCNSIASWPY  167 (346)
T ss_dssp             CCCGGGGGGHHHHHHHHHHHCCCSEEECSCCSSCTTTCCCCTTHHHHHHHHHHHHHHHHH-TTCC-BEEEECCEESSCCC
T ss_pred             CCchhhHHHHHHHHHHHHHcCCceEEeecccCCCCCccCcCCCcchHHHHHHHHHHHHHH-cCCC-EEEEEecccccccC
Confidence                                       444443100 000 0000     11111 1110 0010 01111     0   


Q ss_pred             -----------eeeeeeecCCCCcccccccCC---------ccccc-ccccccccCC-CCCccCHHHHHHHHHHHcCCcc
Q 043777          117 -----------ISHTFNMESSGELDGTKLYPH---------LKYTT-ISDYLDTSVP-RGNIYSFNDLVSLWEEKIGKAL  174 (231)
Q Consensus       117 -----------~~~~~~~~~~g~~~~~~~~~~---------~~~~~-~~~~~~~~~~-~~~~lt~~el~~~~~~~~G~~~  174 (231)
                                 ....+...++|......++..         ...+. .++.  +... +++.+|++|+++.+++++|+++
T Consensus       168 ~~~~~~~~~~~~~~~~~~~g~g~~~~~~i~~~Dva~~~~~~l~~~~~~~~~--~~i~g~~~~~s~~e~~~~~~~~~g~~~  245 (346)
T 3i6i_A          168 YNNIHPSEVLPPTDFFQIYGDGNVKAYFVAGTDIGKFTMKTVDDVRTLNKS--VHFRPSCNCLNINELASVWEKKIGRTL  245 (346)
T ss_dssp             SCC-----CCCCSSCEEEETTSCCCEEEECHHHHHHHHHHHTTCGGGTTEE--EECCCGGGEECHHHHHHHHHHHHTSCC
T ss_pred             ccccccccccCCCceEEEccCCCceEEecCHHHHHHHHHHHHhCccccCeE--EEEeCCCCCCCHHHHHHHHHHHHCCCC
Confidence                       000111122332211111110         00000 0111  1112 3689999999999999999999


Q ss_pred             eEEeecHHHHHHhhhhc-------------eeeecceeeeecC-CCccccccccCCCCcccCHHHHHhhh
Q 043777          175 DRVYVAEDQLLKNIQEK-------------ARVLGDQTNFEIE-PSFGVEATELYPDVNYTTVDEYLNQF  230 (231)
Q Consensus       175 ~~~~~~~~~~~~~~~~~-------------~~~~g~~~~~~~~-~~~~~~~~~~~p~~~~~~~~~~l~~~  230 (231)
                      ++.++|.+++.+.+...             .+..|+...|++. +. +.+.+++|||++++|++|||+++
T Consensus       246 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~g~~~~~~~~~~~-~~~~~~~~p~~~~t~~~e~l~~~  314 (346)
T 3i6i_A          246 PRVTVTEDDLLAAAGENIIPQSVVAAFTHDIFIKGCQVNFSIDGPE-DVEVTTLYPEDSFRTVEECFGEY  314 (346)
T ss_dssp             CEEEECHHHHHHHHHTCCTTHHHHHHHHHHHHTTCTTTSSCCCSTT-EEEHHHHSTTCCCCCHHHHHHHH
T ss_pred             ceEecCHHHHHHHHhcCCChhhhHHHHHHHHhccCCCcccccCCCC-cccHHHhCCCCCcCcHHHHHHHH
Confidence            99999999997776543             3344555557773 33 57789999999999999999986



>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 231
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 1e-17
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 2e-05
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 3e-17
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 6e-05
d1xgka_ 350 c.2.1.2 (A:) Negative transcriptional regulator Nm 2e-06
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 1e-05
d1rkxa_ 356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 7e-04
d1y1pa1 342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 0.002
d1kewa_ 361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 0.003
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Phenylcoumaran benzylic ether reductase
species: Loblolly pine (Pinus taeda) [TaxId: 3352]
 Score = 77.9 bits (190), Expect = 1e-17
 Identities = 61/152 (40%), Positives = 78/152 (51%), Gaps = 50/152 (32%)

Query: 93  DVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYPHLKYTTISDYLDTSVP 152
           D+  FTI A+DDPRTLNK L+L                                      
Sbjct: 193 DIGTFTIKAVDDPRTLNKTLYL------------------------------------RL 216

Query: 153 RGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEKAR-------------VLGDQT 199
             N  S N+LV+LWE+KI K L++ YV E+++LK I +                V GDQT
Sbjct: 217 PANTLSLNELVALWEKKIDKTLEKAYVPEEEVLKLIADTPFPANISIAISHSIFVKGDQT 276

Query: 200 NFEIEPSFGVEATELYPDVNYTTVDEYLNQFI 231
           NFEI P+ GVEA++LYPDV YTTVDEYL+ F+
Sbjct: 277 NFEIGPA-GVEASQLYPDVKYTTVDEYLSNFV 307


>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.95
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.94
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 99.73
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.63
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.58
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.58
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.54
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.53
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.52
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.51
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.5
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.43
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.35
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.34
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.33
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.32
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.3
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.27
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.27
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.23
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.22
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.21
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.2
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.18
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.15
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.06
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.89
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.82
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.8
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.79
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.78
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.77
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.76
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.74
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.74
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.74
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.73
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.73
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.73
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.73
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.72
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.72
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.72
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.71
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.71
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.71
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.7
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.69
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.69
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.69
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.69
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.68
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.68
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.68
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.67
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.67
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.66
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.66
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.66
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.65
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.64
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.64
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.63
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.63
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.62
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.62
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.61
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.59
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.57
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.57
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.57
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.56
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.56
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.55
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.52
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.5
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.49
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.48
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.44
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.43
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.43
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.43
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.42
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.4
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.4
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.38
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.32
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.28
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.27
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 98.25
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.1
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.01
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.97
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.97
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.96
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 97.91
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.9
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.84
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.76
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.5
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.36
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.31
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.29
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.29
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.26
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.19
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.15
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.04
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.96
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.95
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.87
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.84
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.83
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.81
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.75
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.7
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.69
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.68
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.67
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.65
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.63
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.6
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.59
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.58
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.55
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.51
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.46
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.44
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.38
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.37
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.36
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.33
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.3
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.28
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.25
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.24
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.17
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.13
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.02
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.01
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.0
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.94
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.93
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.9
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.89
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.87
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 95.8
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.74
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.73
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.71
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.7
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.69
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.65
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.64
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 95.64
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.63
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.63
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.63
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.6
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.58
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.57
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.54
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.42
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.39
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.37
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.37
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.35
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.23
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.2
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.17
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.15
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.07
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.06
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.03
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.0
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.97
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.89
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.89
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.79
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.76
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.65
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.48
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.41
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.4
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.39
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.39
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.26
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 94.21
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.16
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.94
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 93.94
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.91
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.87
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.84
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 93.8
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.79
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 93.74
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.72
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.68
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 93.48
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.44
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 93.39
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.38
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.35
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.2
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.18
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.16
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 93.05
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.95
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.91
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.79
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 92.78
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.73
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.73
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 92.51
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.51
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.24
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 92.21
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.19
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.02
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.96
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 91.95
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 91.88
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 91.8
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.79
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.55
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.52
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.43
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.33
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.25
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.07
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 91.06
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.0
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.97
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.69
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.52
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.27
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.14
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 90.08
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 90.07
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.04
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.01
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 89.84
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 89.72
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.08
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 88.89
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 88.7
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.68
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 88.45
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 88.45
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 88.37
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 88.23
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 88.21
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 87.83
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.83
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.16
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.14
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 86.56
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 86.55
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.4
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 86.25
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.22
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 85.56
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 85.25
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 85.07
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 85.05
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.89
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.65
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.59
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.35
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 84.08
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 83.82
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 83.78
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 83.35
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 83.3
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 83.0
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 82.9
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 82.86
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.85
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 82.39
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 82.25
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 82.11
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 82.09
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 81.98
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 81.8
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 81.8
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 81.67
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 81.6
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 81.38
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 81.33
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 81.14
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 80.94
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 80.88
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 80.88
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.84
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.71
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 80.01
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Pinoresinol-lariciresinol reductase
species: Giant arborvitae (Thuja plicata) [TaxId: 3316]
Probab=99.95  E-value=3e-27  Score=196.09  Aligned_cols=192  Identities=40%  Similarity=0.745  Sum_probs=140.6

Q ss_pred             CCCeEEEEcCCChhHHHHHHHHHhCCCCEEEEEcCCCCch--hhhhhhhhc-CCcEEEEEcCCCHHHHHHHHccCCEE--
Q 043777            3 GKSNVLVIGAIGRIGYHFTRRSIEYGHPKFALIRDSASNF--NFSLLRVFH-SGVFDYWGLLEDEKSLLEAVKQVDVR--   77 (231)
Q Consensus         3 ~~~~ilVtGatG~iG~~i~~~L~~~g~~v~~~~R~~~~~~--~~~~~~~~~-~~v~~~~~D~~d~~~l~~al~~~d~~--   77 (231)
                      +++|||||||||+||++++++|+++||+|++++|+.....  +.+....+. .+++++.+|++|.+.+.+++++++..  
T Consensus         2 ~k~KILVtGatG~iG~~l~~~L~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~~v~~v~~d~~d~~~~~~~~~~~~~~~~   81 (312)
T d1qyda_           2 KKSRVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVDALKQVDVVIS   81 (312)
T ss_dssp             CCCCEEEESTTSTTHHHHHHHHHHTTCCEEEECCSCCSSCHHHHHHHHHHHTTTCEEECCCSSCHHHHHHHHTTCSEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHhCCCEEEEEECCCcccchhHHHHHhhhccCCcEEEEeecccchhhhhhccCcchhhh
Confidence            3678999999999999999999999999999999765421  233333444 78999999999999999999998773  


Q ss_pred             -----------------------------EEcccCCC-------------------------------------------
Q 043777           78 -----------------------------FIPSEYGA-------------------------------------------   85 (231)
Q Consensus        78 -----------------------------f~ps~~g~-------------------------------------------   85 (231)
                                                   +++|.+|.                                           
T Consensus        82 ~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ss~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~~~~g  161 (312)
T d1qyda_          82 ALAGGVLSHHILEQLKLVEAIKEAGNIKRFLPSEFGMDPDIMEHALQPGSITFIDKRKVRRAIEAASIPYTYVSSNMFAG  161 (312)
T ss_dssp             CCCCSSSSTTTTTHHHHHHHHHHSCCCSEEECSCCSSCTTSCCCCCSSTTHHHHHHHHHHHHHHHTTCCBCEEECCEEHH
T ss_pred             hhhhcccccchhhhhHHHHHHHHhcCCcEEEEeeccccCCCcccccchhhhhhHHHHHHHHhhcccccceEEeccceeec
Confidence                                         33444432                                           


Q ss_pred             -----------------------------cceeechhHHHHHHHhhcCccccCceEEEeeeeeeeeecCCCCcccccccC
Q 043777           86 -----------------------------GVFVKDTDVAAFTINALDDPRTLNKLLHLREISHTFNMESSGELDGTKLYP  136 (231)
Q Consensus        86 -----------------------------~~~~~~~di~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  136 (231)
                                                   ..+++.+|++++.+.++.+++..++.++..                     
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~i~v~Dva~a~~~~l~~~~~~~~~~~~~---------------------  220 (312)
T d1qyda_         162 YFAGSLAQLDGHMMPPRDKVLIYGDGNVKGIWVDEDDVGTYTIKSIDDPQTLNKTMYIR---------------------  220 (312)
T ss_dssp             HHTTTSSCTTCCSSCCSSEECCBTTSCSEEEEECHHHHHHHHHHHTTCGGGSSSEEECC---------------------
T ss_pred             CCccchhhHHHHhhhcccccccccccccccceeeHHHHHHHHHHHhcCccccCceEEEe---------------------
Confidence                                         123444555555555554444444433321                     


Q ss_pred             CcccccccccccccCCCCCccCHHHHHHHHHHHcCCcceEEeecHHHHHHhhhhc-------------eeeecceeeeec
Q 043777          137 HLKYTTISDYLDTSVPRGNIYSFNDLVSLWEEKIGKALDRVYVAEDQLLKNIQEK-------------ARVLGDQTNFEI  203 (231)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~~~lt~~el~~~~~~~~G~~~~~~~~~~~~~~~~~~~~-------------~~~~g~~~~~~~  203 (231)
                                     .+++.+|++|+++.+++++|+++++.++|.+++.+.+...             .+..|+...+.+
T Consensus       221 ---------------~~~~~~s~~e~~~~~~~~~g~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  285 (312)
T d1qyda_         221 ---------------PPMNILSQKEVIQIWERLSEQNLDKIYISSQDFLADMKDKSYEEKIVRCHLYQIFFRGDLYNFEI  285 (312)
T ss_dssp             ---------------CGGGEEEHHHHHHHHHHHHTCCCEECCBCSHHHHHHHTTSCTTHHHHTTTHHHHTTSCTTTSSCC
T ss_pred             ---------------CCCcCCCHHHHHHHHHHHHCCCCeEEECCHHHHHHHHHhcCCcHhHHHHHHHHHHhcCccccccc
Confidence                           3467899999999999999999999999999887765433             234445444554


Q ss_pred             CCCccccccccCCCCcccCHHHHHhhhC
Q 043777          204 EPSFGVEATELYPDVNYTTVDEYLNQFI  231 (231)
Q Consensus       204 ~~~~~~~~~~~~p~~~~~~~~~~l~~~~  231 (231)
                      .+. ..+.+++|||+++||++|||++|+
T Consensus       286 ~~~-~~ea~~l~Pd~~~tt~~e~l~~~v  312 (312)
T d1qyda_         286 GPN-AIEATKLYPEVKYVTMDSYLERYV  312 (312)
T ss_dssp             CSS-EEEHHHHCTTSCCCCHHHHHTTTC
T ss_pred             Ccc-hhhHHHhCCCCCcCcHHHHHHhhC
Confidence            432 457789999999999999999986



>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure