Citrus Sinensis ID: 043808


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSKI
cccccccccccccccccccccccccEEccccccEEEEEEccccccccccccEEEEEEcccccccccccHHHHHHHHccccccccccEEEEEccccEEEEcccccEEEEcccccccHHHHHHHHHcccccEEEEEccccccccccEEEEEEccccccccHHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHccc
cccccccccEEEEccccccccccccccccccccEEEEEEccccccccccccEEEEEEcccccccccccHHHHHHHHcccccEEcccEEEEccccEEEEEcccHHHEEEcccccccHHHHHHHHHcccHEEEEEEEccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHcc
gygmtetcgvvtvenpllgvqnsgsagrlVAGVEAQIVCvdtlkplppnqvgelwvrgpilmpgyfnneQATKLIidkegwlhtgdlgyfdehgQLFIVDRIKELIkcngfqvapaelegvlvshpeildavvipfpdpeagevpiayvvrspnssltkeDVQKFVVKQVARYKRlrnvtftnsipkttsgKILRRELIAKLRSKI
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDtlkplppnqVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRspnssltkedvqKFVVKQvarykrlrnvtftnsipkttsgkilrreLIAKLRSKI
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSKI
*****ETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRREL********
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAK**S**
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSKI
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q9M0X9544 4-coumarate--CoA ligase-l yes no 1.0 0.378 0.718 7e-86
Q0DV32552 4-coumarate--CoA ligase-l yes no 0.990 0.369 0.713 6e-81
Q84P21546 4-coumarate--CoA ligase-l no no 0.966 0.364 0.557 4e-61
Q84P25565 4-coumarate--CoA ligase-l no no 1.0 0.364 0.533 2e-58
P0C5B6550 4-coumarate--CoA ligase-l no no 1.0 0.374 0.538 2e-58
Q10S72552 4-coumarate--CoA ligase-l no no 1.0 0.373 0.509 4e-57
Q3E6Y4552 4-coumarate--CoA ligase-l no no 1.0 0.373 0.524 3e-56
Q84P23562 4-coumarate--CoA ligase-l no no 0.961 0.352 0.515 1e-55
Q84P26550 4-coumarate--CoA ligase-l no no 0.985 0.369 0.533 1e-54
Q8RU95598 4-coumarate--CoA ligase-l no no 0.956 0.329 0.527 2e-54
>sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 Back     alignment and function desciption
 Score =  316 bits (809), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 148/206 (71%), Positives = 177/206 (85%)

Query: 1   GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
           GYGMTETCG+V+VE+P LG +NSGSAG L  GVEAQIV V+T K  PPNQ GE+WVRGP 
Sbjct: 339 GYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQPPNQQGEIWVRGPN 398

Query: 61  LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
           +M GY NN QATK  IDK+ W+HTGDLGYF+E G L++VDRIKELIK  GFQVAPAELEG
Sbjct: 399 MMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEG 458

Query: 121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVT 180
           +LVSHP+ILDAVVIPFPD EAGEVPIA+VVRSPNSS+T++D+QKF+ KQVA YKRLR V+
Sbjct: 459 LLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKFIAKQVAPYKRLRRVS 518

Query: 181 FTNSIPKTTSGKILRRELIAKLRSKI 206
           F + +PK+ +GKILRREL+ ++RSK+
Sbjct: 519 FISLVPKSAAGKILRRELVQQVRSKM 544




Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 Back     alignment and function description
>sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 Back     alignment and function description
>sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 Back     alignment and function description
>sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 Back     alignment and function description
>sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 Back     alignment and function description
>sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 Back     alignment and function description
>sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 Back     alignment and function description
>sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
358348013218 4-coumarate-coa ligase [Medicago truncat 1.0 0.944 0.781 2e-92
373432591 540 4-coumarate--CoA ligase-like 7-like [Gly 1.0 0.381 0.771 3e-92
255565415 542 AMP dependent CoA ligase, putative [Rici 1.0 0.380 0.762 4e-91
380042366 543 acyl-activating enzyme 3 [Cannabis sativ 1.0 0.379 0.762 6e-90
356539342 548 PREDICTED: 4-coumarate--CoA ligase-like 1.0 0.375 0.757 8e-90
225436506 544 PREDICTED: 4-coumarate--CoA ligase-like 1.0 0.378 0.747 1e-89
224077516 543 4-coumarate-coa ligase [Populus trichoca 1.0 0.379 0.747 6e-89
224127622 543 4-coumarate-coa ligase [Populus trichoca 1.0 0.379 0.742 7e-89
297734926221 unnamed protein product [Vitis vinifera] 1.0 0.932 0.747 1e-88
356544665 379 PREDICTED: LOW QUALITY PROTEIN: 4-coumar 1.0 0.543 0.737 8e-87
>gi|358348013|ref|XP_003638044.1| 4-coumarate-coa ligase [Medicago truncatula] gi|355503979|gb|AES85182.1| 4-coumarate-coa ligase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (89%)

Query: 1   GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
           GYGMTETCG+V+VEN  +G++++GSAG LVAGVEAQIV VDTLKPLPP Q+GE+WVRGP 
Sbjct: 13  GYGMTETCGIVSVENTRMGIRHTGSAGMLVAGVEAQIVSVDTLKPLPPGQLGEIWVRGPN 72

Query: 61  LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
           +MPGY+NN QA++L IDK+GW+HTGDLGYFDE G LF+VDRIKELIK  GFQVAPAELEG
Sbjct: 73  MMPGYYNNPQASRLTIDKKGWVHTGDLGYFDEDGNLFVVDRIKELIKYKGFQVAPAELEG 132

Query: 121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVT 180
           +LVSHPEILDAVVIPFPD EAGEVP+AYVVRSPNSSLT+ED+QKF+  QVA +KRLR VT
Sbjct: 133 LLVSHPEILDAVVIPFPDAEAGEVPVAYVVRSPNSSLTEEDIQKFIADQVAPFKRLRRVT 192

Query: 181 FTNSIPKTTSGKILRRELIAKLRSKI 206
           F N++PKT SGKILRRELI K RSKI
Sbjct: 193 FINTVPKTASGKILRRELIDKARSKI 218




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|373432591|ref|NP_001243292.1| 4-coumarate--CoA ligase-like 7-like [Glycine max] gi|370316591|gb|AEX25890.1| 4-coumarate:CoA ligase [Glycine max] Back     alignment and taxonomy information
>gi|255565415|ref|XP_002523698.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223537002|gb|EEF38638.1| AMP dependent CoA ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|380042366|gb|AFD33347.1| acyl-activating enzyme 3 [Cannabis sativa] Back     alignment and taxonomy information
>gi|356539342|ref|XP_003538157.1| PREDICTED: 4-coumarate--CoA ligase-like 7-like [Glycine max] Back     alignment and taxonomy information
>gi|225436506|ref|XP_002276353.1| PREDICTED: 4-coumarate--CoA ligase-like 7 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077516|ref|XP_002305282.1| 4-coumarate-coa ligase [Populus trichocarpa] gi|222848246|gb|EEE85793.1| 4-coumarate-coa ligase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127622|ref|XP_002329323.1| 4-coumarate-coa ligase [Populus trichocarpa] gi|224127626|ref|XP_002329324.1| acyl:coa ligase [Populus trichocarpa] gi|222870777|gb|EEF07908.1| 4-coumarate-coa ligase [Populus trichocarpa] gi|222870778|gb|EEF07909.1| acyl:coa ligase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297734926|emb|CBI17160.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356544665|ref|XP_003540768.1| PREDICTED: LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 7-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2115673544 AT4G05160 [Arabidopsis thalian 1.0 0.378 0.718 1.4e-78
TAIR|locus:2034392546 OPCL1 "OPC-8:0 CoA ligase1" [A 1.0 0.377 0.548 2.5e-56
TAIR|locus:2034423565 AT1G20480 [Arabidopsis thalian 1.0 0.364 0.533 2.1e-54
TAIR|locus:2034403550 AT1G20500 [Arabidopsis thalian 1.0 0.374 0.538 8.9e-54
TAIR|locus:2158559562 AT5G63380 [Arabidopsis thalian 0.956 0.350 0.522 4.4e-52
TAIR|locus:2176662550 4CL8 [Arabidopsis thaliana (ta 0.980 0.367 0.536 6.5e-51
TAIR|locus:2017602561 4CL1 "4-coumarate:CoA ligase 1 0.980 0.360 0.521 1.5e-49
TAIR|locus:2094716556 4CL2 "4-coumarate:CoA ligase 2 0.980 0.363 0.502 2.5e-49
TAIR|locus:2015003561 4CL3 "4-coumarate:CoA ligase 3 0.970 0.356 0.512 4.1e-49
TAIR|locus:2117209566 AT4G19010 [Arabidopsis thalian 0.961 0.349 0.510 4.1e-49
TAIR|locus:2115673 AT4G05160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 790 (283.2 bits), Expect = 1.4e-78, P = 1.4e-78
 Identities = 148/206 (71%), Positives = 177/206 (85%)

Query:     1 GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
             GYGMTETCG+V+VE+P LG +NSGSAG L  GVEAQIV V+T K  PPNQ GE+WVRGP 
Sbjct:   339 GYGMTETCGIVSVEDPRLGKRNSGSAGMLAPGVEAQIVSVETGKSQPPNQQGEIWVRGPN 398

Query:    61 LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
             +M GY NN QATK  IDK+ W+HTGDLGYF+E G L++VDRIKELIK  GFQVAPAELEG
Sbjct:   399 MMKGYLNNPQATKETIDKKSWVHTGDLGYFNEDGNLYVVDRIKELIKYKGFQVAPAELEG 458

Query:   121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVT 180
             +LVSHP+ILDAVVIPFPD EAGEVPIA+VVRSPNSS+T++D+QKF+ KQVA YKRLR V+
Sbjct:   459 LLVSHPDILDAVVIPFPDEEAGEVPIAFVVRSPNSSITEQDIQKFIAKQVAPYKRLRRVS 518

Query:   181 FTNSIPKTTSGKILRRELIAKLRSKI 206
             F + +PK+ +GKILRREL+ ++RSK+
Sbjct:   519 FISLVPKSAAGKILRRELVQQVRSKM 544




GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016207 "4-coumarate-CoA ligase activity" evidence=ISS
GO:0004321 "fatty-acyl-CoA synthase activity" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0009695 "jasmonic acid biosynthetic process" evidence=IDA
GO:0009850 "auxin metabolic process" evidence=IDA
GO:0009851 "auxin biosynthetic process" evidence=IDA
TAIR|locus:2034392 OPCL1 "OPC-8:0 CoA ligase1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034423 AT1G20480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034403 AT1G20500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176662 4CL8 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017602 4CL1 "4-coumarate:CoA ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094716 4CL2 "4-coumarate:CoA ligase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015003 4CL3 "4-coumarate:CoA ligase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117209 AT4G19010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0DV324CLL1_ORYSJ6, ., 2, ., 1, ., -0.71350.99020.3695yesno
Q9M0X94CLL7_ARATH6, ., 2, ., 1, ., -0.71841.00.3786yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00022179001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (544 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00036840001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (514 aa)
       0.899
GSVIVG00033763001
SubName- Full=Chromosome undetermined scaffold_69, whole genome shotgun sequence; (338 aa)
       0.899
GSVIVG00025189001
SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (429 aa)
       0.899
GSVIVG00024561001
SubName- Full=Putative uncharacterized protein (Chromosome chr6 scaffold_3, whole genome shotgu [...] (717 aa)
       0.899
GSVIVG00023932001
SubName- Full=Putative uncharacterized protein (Chromosome chr6 scaffold_3, whole genome shotgu [...] (505 aa)
       0.899
GSVIVG00023306001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (508 aa)
       0.899
GSVIVG00023211001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (710 aa)
       0.899
GSVIVG00019520001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (247 aa)
       0.899
GSVIVG00018175001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (723 aa)
       0.899
GSVIVG00017017001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (532 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 1e-120
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 2e-93
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 4e-86
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 2e-79
PLN02574560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 3e-79
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 3e-77
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 4e-77
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 2e-74
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 1e-68
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 2e-68
PLN02330546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 6e-66
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 1e-64
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 3e-64
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 9e-64
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 4e-61
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 5e-58
cd12119517 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth 2e-52
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 3e-52
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 6e-52
PRK05677562 PRK05677, PRK05677, long-chain-fatty-acid--CoA lig 3e-51
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 1e-50
PRK08974560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 1e-49
PRK08314546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 3e-49
COG0365528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 3e-49
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 2e-48
PRK08315559 PRK08315, PRK08315, AMP-binding domain protein; Va 6e-48
PRK07059557 PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig 8e-48
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 9e-47
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 2e-46
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 3e-46
PRK06710563 PRK06710, PRK06710, long-chain-fatty-acid--CoA lig 7e-45
cd05971439 cd05971, MACS_like_3, Uncharacterized subfamily of 2e-44
PRK08008517 PRK08008, caiC, putative crotonobetaine/carnitine- 1e-43
cd05944359 cd05944, FACL_like_4, Uncharacterized subfamily of 1e-43
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 1e-43
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 2e-43
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 2e-42
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 2e-42
cd12118520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 4e-42
PRK07786542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 1e-41
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 3e-41
PRK08751560 PRK08751, PRK08751, putative long-chain fatty acyl 4e-41
PRK07788549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 5e-41
PRK06178567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 6e-41
PRK12583558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 1e-40
PRK05605573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 2e-40
PRK07529632 PRK07529, PRK07529, AMP-binding domain protein; Va 6e-40
PRK06188524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 2e-39
PRK07514504 PRK07514, PRK07514, malonyl-CoA synthase; Validate 2e-39
PRK06145497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 3e-39
cd05959506 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 1e-37
PRK12492562 PRK12492, PRK12492, long-chain-fatty-acid--CoA lig 1e-37
cd05919436 cd05919, BCL_like, Benzoate CoA ligase (BCL) and s 2e-37
PRK09088488 PRK09088, PRK09088, acyl-CoA synthetase; Validated 3e-37
TIGR03205541 TIGR03205, pimA, dicarboxylate--CoA ligase PimA 1e-36
cd05931547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 2e-36
PRK07470528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 2e-36
cd05969443 cd05969, MACS_like_4, Uncharacterized subfamily of 1e-35
PRK06087547 PRK06087, PRK06087, short chain acyl-CoA synthetas 1e-35
PRK08276502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 2e-35
PRK13382537 PRK13382, PRK13382, acyl-CoA synthetase; Provision 2e-35
cd05974433 cd05974, MACS_like_1, Uncharacterized subfamily of 3e-35
PRK07787471 PRK07787, PRK07787, acyl-CoA synthetase; Validated 6e-35
PRK12406509 PRK12406, PRK12406, long-chain-fatty-acid--CoA lig 1e-34
PRK08162545 PRK08162, PRK08162, acyl-CoA synthetase; Validated 1e-34
PRK04319570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 5e-34
cd05970537 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s 2e-33
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 1e-32
PRK13295547 PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig 9e-32
cd05967607 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) 3e-31
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 4e-31
cd05909489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 7e-31
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 7e-30
cd05945447 cd05945, DltA, D-alanine:D-alanyl carrier protein 1e-29
PRK06018542 PRK06018, PRK06018, putative acyl-CoA synthetase; 1e-29
cd05928530 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co 2e-29
PRK06155542 PRK06155, PRK06155, crotonobetaine/carnitine-CoA l 2e-29
cd05958487 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) 3e-29
PRK07008539 PRK07008, PRK07008, long-chain-fatty-acid--CoA lig 2e-28
PRK07638487 PRK07638, PRK07638, acyl-CoA synthetase; Validated 4e-28
PRK13391511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 4e-28
cd05930445 cd05930, A_NRPS, The adenylation domain of nonribo 4e-28
PRK07867529 PRK07867, PRK07867, acyl-CoA synthetase; Validated 6e-28
cd05973440 cd05973, MACS_like_2, Uncharacterized subfamily of 1e-27
cd05906560 cd05906, A_NRPS_TubE_like, The adenylation domain 2e-27
PLN02860563 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase 3e-27
cd05966602 cd05966, ACS, Acetyl-CoA synthetase (also known as 5e-27
PRK13383516 PRK13383, PRK13383, acyl-CoA synthetase; Provision 9e-27
TIGR03208538 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate 3e-26
PTZ00216700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 5e-26
PLN03102579 PLN03102, PLN03102, acyl-activating enzyme; Provis 9e-26
PLN02479567 PLN02479, PLN02479, acetate-CoA ligase 3e-25
PRK05620576 PRK05620, PRK05620, long-chain-fatty-acid--CoA lig 5e-25
PRK13388540 PRK13388, PRK13388, acyl-CoA synthetase; Provision 7e-25
PRK09192579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 9e-25
COG1021542 COG1021, EntE, Peptide arylation enzymes [Secondar 1e-24
PRK06164540 PRK06164, PRK06164, acyl-CoA synthetase; Validated 2e-24
TIGR02188625 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase 2e-24
cd05933594 cd05933, ACSBG_like, Bubblegum-like very long-chai 3e-24
cd05908499 cd05908, A_NRPS_MycA_like, The adenylation domain 4e-24
cd05968474 cd05968, AACS_like, Uncharacterized acyl-CoA synth 8e-24
TIGR02262508 TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil 2e-23
TIGR02275526 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP 2e-23
cd12117474 cd12117, A_NRPS_Srf_like, The adenylation domain o 4e-23
TIGR03098517 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form 7e-23
cd05923495 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) 7e-23
PRK086331146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola 2e-22
cd05918447 cd05918, A_NRPS_SidN3_like, The adenylation (A) do 3e-22
PRK13390501 PRK13390, PRK13390, acyl-CoA synthetase; Provision 4e-22
TIGR01733409 TIGR01733, AA-adenyl-dom, amino acid adenylation d 1e-21
PRK09029458 PRK09029, PRK09029, O-succinylbenzoic acid--CoA li 1e-21
PRK10946536 PRK10946, entE, enterobactin synthase subunit E; P 1e-21
PRK00174637 PRK00174, PRK00174, acetyl-CoA synthetase; Provisi 1e-21
PRK07445452 PRK07445, PRK07445, O-succinylbenzoic acid--CoA li 4e-21
cd05915509 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase 5e-21
cd12116438 cd12116, A_NRPS_Ta1_like, The adenylation domain o 2e-20
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 3e-20
cd12114476 cd12114, A_NRPS_TlmIV_like, The adenylation domain 4e-20
cd05914448 cd05914, FACL_like_3, Uncharacterized subfamily of 2e-19
PRK08308414 PRK08308, PRK08308, acyl-CoA synthetase; Validated 4e-19
PTZ00237647 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi 8e-19
PRK05857540 PRK05857, PRK05857, acyl-CoA synthetase; Validated 1e-18
cd05940444 cd05940, FATP_FACS, Fatty acid transport proteins 2e-18
PRK07768545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 2e-18
TIGR02316628 TIGR02316, propion_prpE, propionate--CoA ligase 2e-18
PRK07824358 PRK07824, PRK07824, O-succinylbenzoic acid--CoA li 6e-18
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 2e-17
cd05924365 cd05924, FACL_like_5, Uncharacterized subfamily of 4e-17
PRK05851525 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c 6e-17
cd12115449 cd12115, A_NRPS_Sfm_like, The adenylation domain o 7e-17
PRK10524629 PRK10524, prpE, propionyl-CoA synthetase; Provisio 7e-17
PRK07798533 PRK07798, PRK07798, acyl-CoA synthetase; Validated 1e-16
cd05910455 cd05910, FACL_like_1, Uncharacterized subfamily of 6e-16
PRK09274552 PRK09274, PRK09274, peptide synthase; Provisional 7e-16
PRK04813503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 8e-16
PRK06334539 PRK06334, PRK06334, long chain fatty acid--[acyl-c 9e-16
PLN02430660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 2e-15
PRK05850578 PRK05850, PRK05850, acyl-CoA synthetase; Validated 3e-15
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 3e-14
TIGR01734502 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho 9e-14
PRK08043718 PRK08043, PRK08043, bifunctional acyl-[acyl carrie 9e-14
PRK068141140 PRK06814, PRK06814, acylglycerophosphoethanolamine 1e-13
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 2e-13
COG1020642 COG1020, EntF, Non-ribosomal peptide synthetase mo 4e-13
PRK07769631 PRK07769, PRK07769, long-chain-fatty-acid--CoA lig 1e-12
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 3e-12
PLN02614666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 3e-12
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 3e-12
PLN02387696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 4e-12
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 2e-11
PRK12476612 PRK12476, PRK12476, putative fatty-acid--CoA ligas 2e-11
cd05921559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 4e-11
cd05937468 cd05937, FATP_chFAT1_like, Uncharacterized subfami 4e-11
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 1e-10
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 2e-10
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 5e-10
PRK06060 705 PRK06060, PRK06060, acyl-CoA synthetase; Validated 5e-10
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 1e-09
PRK08180614 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewe 3e-09
PRK12582624 PRK12582, PRK12582, acyl-CoA synthetase; Provision 3e-09
PLN02654666 PLN02654, PLN02654, acetate-CoA ligase 8e-09
pfam1319343 pfam13193, DUF4009, Domain of unknown function (DU 5e-08
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 7e-08
cd05905556 cd05905, Dip2, Disco-interacting protein 2 (Dip2) 2e-07
cd05943616 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoac 2e-06
PTZ00342746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 1e-05
PRK08279600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 4e-05
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 8e-05
PRK10252 1296 PRK10252, entF, enterobactin synthase subunit F; P 9e-05
cd05939474 cd05939, hsFATP4_like, Fatty acid transport protei 6e-04
TIGR01217652 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase 9e-04
cd05938535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 0.003
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
 Score =  348 bits (896), Expect = e-120
 Identities = 127/198 (64%), Positives = 152/198 (76%)

Query: 1   GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
           GYGMTE+  V T+          GS GRLV  VEA+IV  +T + LPPNQ GELWVRGP 
Sbjct: 307 GYGMTESSPVTTMCPVPEKDPKPGSVGRLVPNVEAKIVDPETGESLPPNQPGELWVRGPQ 366

Query: 61  LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
           +M GY NN +AT   IDK+GWLHTGDLGYFDE G LFIVDR+KELIK  GFQVAPAELE 
Sbjct: 367 VMKGYLNNPEATAETIDKDGWLHTGDLGYFDEDGYLFIVDRLKELIKYKGFQVAPAELEA 426

Query: 121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRNVT 180
           +L+SHPEI DA VIP+PD EAGE+P+A+VVR P S L++++V +FV KQVA YK++R V 
Sbjct: 427 LLLSHPEIADAAVIPYPDEEAGEIPMAFVVRQPGSELSEDEVMQFVAKQVAPYKKVRKVV 486

Query: 181 FTNSIPKTTSGKILRREL 198
           F ++IPK+ SGKILRREL
Sbjct: 487 FVDAIPKSPSGKILRREL 504


4-Coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids. Length = 504

>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) Back     alignment and domain information
>gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes Back     alignment and domain information
>gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) Back     alignment and domain information
>gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) Back     alignment and domain information
>gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family Back     alignment and domain information
>gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) Back     alignment and domain information
>gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated Back     alignment and domain information
>gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) Back     alignment and domain information
>gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain Back     alignment and domain information
>gnl|CDD|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional Back     alignment and domain information
>gnl|CDD|234677 PRK00174, PRK00174, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|131369 TIGR02316, propion_prpE, propionate--CoA ligase Back     alignment and domain information
>gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae Back     alignment and domain information
>gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>gnl|CDD|181207 PRK08043, PRK08043, bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|180374 PRK06060, PRK06060, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|236175 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>gnl|CDD|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215353 PLN02654, PLN02654, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|221971 pfam13193, DUF4009, Domain of unknown function (DUF4009) Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|213273 cd05905, Dip2, Disco-interacting protein 2 (Dip2) Back     alignment and domain information
>gnl|CDD|213308 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS) Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins Back     alignment and domain information
>gnl|CDD|233316 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
KOG1176537 consensus Acyl-CoA synthetase [Lipid transport and 100.0
KOG1177596 consensus Long chain fatty acid acyl-CoA ligase [L 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
PLN02574560 4-coumarate--CoA ligase-like 100.0
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 100.0
PTZ00237647 acetyl-CoA synthetase; Provisional 100.0
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 100.0
PRK00174637 acetyl-CoA synthetase; Provisional 100.0
PLN02654666 acetate-CoA ligase 100.0
PRK06839496 acyl-CoA synthetase; Validated 100.0
PLN02246537 4-coumarate--CoA ligase 100.0
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 100.0
PRK09088488 acyl-CoA synthetase; Validated 100.0
PRK07788549 acyl-CoA synthetase; Validated 100.0
PRK07529632 AMP-binding domain protein; Validated 100.0
PRK07514504 malonyl-CoA synthase; Validated 100.0
PLN02330546 4-coumarate--CoA ligase-like 1 100.0
PRK06060 705 acyl-CoA synthetase; Validated 100.0
PLN03051499 acyl-activating enzyme; Provisional 100.0
PRK06145497 acyl-CoA synthetase; Validated 100.0
PRK04319570 acetyl-CoA synthetase; Provisional 100.0
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
PRK07638487 acyl-CoA synthetase; Validated 100.0
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 100.0
PLN02860563 o-succinylbenzoate-CoA ligase 100.0
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 100.0
PRK09274552 peptide synthase; Provisional 100.0
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08316523 acyl-CoA synthetase; Validated 100.0
PRK08315559 AMP-binding domain protein; Validated 100.0
PRK07470528 acyl-CoA synthetase; Validated 100.0
PRK05852534 acyl-CoA synthetase; Validated 100.0
PRK12583558 acyl-CoA synthetase; Provisional 100.0
KOG1175626 consensus Acyl-CoA synthetase [Lipid transport and 100.0
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 100.0
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 100.0
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK06178567 acyl-CoA synthetase; Validated 100.0
PRK10524629 prpE propionyl-CoA synthetase; Provisional 100.0
PRK13382537 acyl-CoA synthetase; Provisional 100.0
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 100.0
PRK06164540 acyl-CoA synthetase; Validated 100.0
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK03584655 acetoacetyl-CoA synthetase; Provisional 100.0
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 100.0
PRK07867529 acyl-CoA synthetase; Validated 100.0
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK06188524 acyl-CoA synthetase; Validated 100.0
PRK06087547 short chain acyl-CoA synthetase; Reviewed 100.0
PRK10946536 entE enterobactin synthase subunit E; Provisional 100.0
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 100.0
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 100.0
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK07787471 acyl-CoA synthetase; Validated 100.0
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 100.0
PRK13390501 acyl-CoA synthetase; Provisional 100.0
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 100.0
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 100.0
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 100.0
PRK12476612 putative fatty-acid--CoA ligase; Provisional 100.0
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 100.0
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 100.0
PLN02736651 long-chain acyl-CoA synthetase 100.0
PRK13388540 acyl-CoA synthetase; Provisional 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK05857540 acyl-CoA synthetase; Validated 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PLN03102579 acyl-activating enzyme; Provisional 100.0
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 100.0
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 100.0
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK13391511 acyl-CoA synthetase; Provisional 100.0
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
PRK05691 4334 peptide synthase; Validated 100.0
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 100.0
PRK13383516 acyl-CoA synthetase; Provisional 100.0
PRK05691 4334 peptide synthase; Validated 100.0
PLN03052728 acetate--CoA ligase; Provisional 100.0
PRK06018542 putative acyl-CoA synthetase; Provisional 100.0
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 100.0
PLN02614666 long-chain acyl-CoA synthetase 100.0
PRK09192579 acyl-CoA synthetase; Validated 100.0
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 100.0
PLN02861660 long-chain-fatty-acid-CoA ligase 100.0
PRK07868994 acyl-CoA synthetase; Validated 100.0
PRK08279600 long-chain-acyl-CoA synthetase; Validated 100.0
PLN02479567 acetate-CoA ligase 100.0
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 100.0
PRK08162545 acyl-CoA synthetase; Validated 100.0
PRK07798533 acyl-CoA synthetase; Validated 100.0
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 100.0
PRK05850578 acyl-CoA synthetase; Validated 100.0
PTZ00342746 acyl-CoA synthetase; Provisional 100.0
PTZ00216700 acyl-CoA synthetase; Provisional 100.0
PRK08180614 feruloyl-CoA synthase; Reviewed 100.0
PLN02430660 long-chain-fatty-acid-CoA ligase 99.98
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.98
PRK08308414 acyl-CoA synthetase; Validated 99.97
KOG1256691 consensus Long-chain acyl-CoA synthetases (AMP-for 99.97
PRK12582624 acyl-CoA synthetase; Provisional 99.97
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.97
KOG1180678 consensus Acyl-CoA synthetase [Lipid transport and 99.94
PRK09188365 serine/threonine protein kinase; Provisional 99.93
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.92
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 99.92
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.9
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.89
KOG1179649 consensus Very long-chain acyl-CoA synthetase/fatt 99.87
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 99.79
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.71
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.69
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 99.69
PTZ00297 1452 pantothenate kinase; Provisional 99.59
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 99.51
KOG36281363 consensus Predicted AMP-binding protein [General f 99.5
KOG3628 1363 consensus Predicted AMP-binding protein [General f 99.06
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 98.4
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 98.3
PF03321528 GH3: GH3 auxin-responsive promoter; InterPro: IPR0 98.06
PLN02249597 indole-3-acetic acid-amido synthetase 97.6
PLN02247606 indole-3-acetic acid-amido synthetase 97.28
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 97.22
PLN02620612 indole-3-acetic acid-amido synthetase 97.2
PF0081816 Ice_nucleation: Ice nucleation protein repeat; Int 87.38
>KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.4e-48  Score=320.30  Aligned_cols=203  Identities=48%  Similarity=0.812  Sum_probs=192.7

Q ss_pred             CcccccCccceeccCCccCCCCCCcceeecCCceEEEEeCCCCCCCCCCCceEEEEEcCCCCcccCCChhhccccccCCC
Q 043808            1 GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEG   80 (206)
Q Consensus         1 ~YG~TE~g~~~~~~~~~~~~~~~~~~G~p~~~~~~~i~~~~~~~~~~~g~~Gel~i~~~~~~~~y~~~~~~~~~~~~~~~   80 (206)
                      +||+||+|+.++.....+. .+++++|++++++...+.+ ++|+.++.++.||||++|++++.||+++|+.|++.++.+|
T Consensus       331 ~YGmTE~~~~~~~~~~~~e-~k~~svG~~~~g~~~~v~~-e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~~~G  408 (537)
T KOG1176|consen  331 GYGMTEAGGLITSNDWGPE-RKPGSVGRLLPGVRVKVLD-ETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFDDDG  408 (537)
T ss_pred             eeccccccCceeecCCCcc-CcccccCccccceEEEeeC-CCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcccCC
Confidence            6999999987776655433 6899999999999988888 9999999999999999999999999999999999997779


Q ss_pred             eEecCceEEEecCCcEEEeccccceEEECCeEeChHHHHHHHhcCCCcceeEEEeecCCCCCceeEEEEEeCCCCCCCHH
Q 043808           81 WLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKE  160 (206)
Q Consensus        81 ~~~TGDl~~~~~~g~l~~~GR~dd~i~~~G~~v~~~~ie~~i~~~~~v~~~~v~~~~~~~~~~~~~~~v~~~~~~~~~~~  160 (206)
                      ||+|||+|.+|+||+|++.+|..|+||.+|.+|+|.|||++|.+||.|.||+|++.+++..|+..+|+|+..++...+++
T Consensus       409 W~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~p~A~VV~k~g~~lte~  488 (537)
T KOG1176|consen  409 WFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGETPAAFVVLKKGSTLTEK  488 (537)
T ss_pred             ccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccccccCCcceEEEEecCCCcCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998999999


Q ss_pred             HHHHHHHHhccccCceeEEEEeCCcCCCCCCcccHHHHHHHHHcc
Q 043808          161 DVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSK  205 (206)
Q Consensus       161 ~l~~~~~~~l~~~~~p~~~~~v~~~P~t~~GKv~r~~l~~~~~~~  205 (206)
                      ++.+++++++++|+.|..++++++||+|++|||+|+.|++.+.+.
T Consensus       489 di~~~v~k~l~~y~~~~~V~Fvd~lPKs~~GKi~R~~lr~~~~~~  533 (537)
T KOG1176|consen  489 DIIEYVRKKLPAYKLPGGVVFVDELPKTPNGKILRRKLRDIAKKL  533 (537)
T ss_pred             HHHHHHHhhCChhhccCeEEEeccCCCCCcchHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999998763



>KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information
>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin Back     alignment and domain information
>PLN02249 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02247 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>PLN02620 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PF00818 Ice_nucleation: Ice nucleation protein repeat; InterPro: IPR000258 Certain Gram-negative bacteria express proteins that enable them to promote nucleation of ice at relatively high temperatures (above -5C) [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3tsy_A 979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 2e-49
2d1q_A548 Crystal Structure Of The Thermostable Japanese Fire 4e-49
2d1s_A548 Crystal Structure Of The Thermostable Japanese Fire 5e-49
2d1t_A548 Crystal Structure Of The Thermostable Japanese Fire 5e-49
3qya_A582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 8e-48
3iep_A551 Firefly Luciferase Apo Structure (P41 Form) Length 2e-47
1ba3_A550 Firefly Luciferase In Complex With Bromoform Length 2e-47
3a9u_A536 Crystal Structures And Enzymatic Mechanisms Of A Po 2e-47
4g36_A555 Photinus Pyralis Luciferase In The Adenylate-Formin 2e-47
4g37_A555 Structure Of Cross-Linked Firefly Luciferase In Sec 9e-47
3g7s_A549 Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li 4e-34
3ivr_A509 Crystal Structure Of Putative Long-Chain-Fatty-Acid 8e-34
3r44_A517 Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas 8e-27
4fuq_A503 Crystal Structure Of Apo Matb From Rhodopseudomonas 5e-25
3nyq_A505 Malonyl-Coa Ligase Ternary Product Complex With Met 2e-23
1ult_A541 Crystal Structure Of Tt0168 From Thermus Thermophil 2e-23
4fut_A503 Crystal Structure Of Atp Bound Matb From Rhodopseud 8e-21
4gxq_A506 Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer 1e-20
2wd9_A569 Crystal Structure Of Human Acyl-coa Synthetase Medi 1e-20
3b7w_A570 Crystal Structure Of Human Acyl-Coa Synthetase Medi 1e-20
3etc_A580 2.1 A Structure Of Acyl-Adenylate Synthetase From M 8e-20
4gxr_A503 Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len 1e-19
3ipl_A501 Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig 3e-19
3rg2_A617 Structure Of A Two-Domain Nrps Fusion Protein Conta 9e-17
3o82_A544 Structure Of Base N-Terminal Domain From Acinetobac 3e-16
1mdb_A539 Crystal Structure Of Dhbe In Complex With Dhb-adeny 3e-15
2v7b_A529 Crystal Structures Of A Benzoate Coa Ligase From Bu 3e-15
1md9_A539 Crystal Structure Of Dhbe In Complex With Dhb And A 9e-15
2qvz_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATIO 3e-13
2qvx_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATIO 3e-13
1t5d_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chl 3e-13
2p20_A652 Acetyl-Coa Synthetase, R584a Mutation Length = 652 3e-13
3dlp_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, 4e-13
2p2b_A652 Acetyl-coa Synthetase, V386a Mutation Length = 652 7e-13
2p2m_A652 Acetyl-Coa Synthetase, R194a Mutation Length = 652 7e-13
2p2q_A652 Acetyl-Coa Synthetase, R584e Mutation Length = 652 7e-13
2p2f_A652 Acetyl-coa Synthetase, Wild-type With Acetate, Amp, 7e-13
1pg3_A652 Acetyl Coa Synthetase, Acetylated On Lys609 Length 7e-13
3cw8_X504 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cb 8e-13
1t5h_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SE 9e-13
4gr5_A570 Crystal Structure Of Slgn1deltaasub In Complex With 1e-12
2p2j_A652 Acetyl-Coa Synthetase, K609a Mutation Length = 652 3e-12
3pbk_A583 Structural And Functional Studies Of Fatty Acyl-Ade 3e-11
1ry2_A663 Crystal Structure Of Yeast Acetyl-Coenzyme A Synthe 6e-11
2vsq_A 1304 Structure Of Surfactin A Synthetase C (Srfa-C), A N 7e-11
3fcc_A512 Crystal Structure Of Dlta Protein In Complex With A 7e-10
3dhv_A512 Crystal Structure Of Dlta Protein In Complex With D 8e-10
3e7w_A511 Crystal Structure Of Dlta: Implications For The Rea 6e-09
3t5b_A396 Crystal Structure Of N-Terminal Domain Of Facl13 Fr 6e-09
3kxw_A590 The Crystal Structure Of Fatty Acid Amp Ligase From 7e-09
4dg8_A 620 Structure Of Pa1221, An Nrps Protein Containing Ade 6e-07
3l8c_A521 Structure Of Probable D-Alanine--Poly(Phosphoribito 3e-06
1amu_A563 Phenylalanine Activating Domain Of Gramicidin Synth 1e-05
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure

Iteration: 1

Score = 192 bits (487), Expect = 2e-49, Method: Compositional matrix adjust. Identities = 109/208 (52%), Positives = 139/208 (66%), Gaps = 9/208 (4%) Query: 1 GYGMTETCGVVTVENPLLGVQN------SGSAGRLVAGVEAQIVCVDTLKPLPPNQVGEL 54 GYGMTE V+ + LG SG+ G +V E +IV DT L NQ GE+ Sbjct: 376 GYGMTEAGPVLAMS---LGFAKEPFPVKSGACGTVVRNAEMKIVDPDTGDSLSRNQPGEI 432 Query: 55 WVRGPILMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVA 114 +RG +M GY NN AT IDK+GWLHTGD+G D+ +LFIVDR+KELIK GFQVA Sbjct: 433 CIRGHQIMKGYLNNPAATAETIDKDGWLHTGDIGLIDDDDELFIVDRLKELIKYKGFQVA 492 Query: 115 PAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYK 174 PAELE +L+ HP+I D V+ + AGEVP+A+VV+S +S L+++DV++FV KQV YK Sbjct: 493 PAELEALLIGHPDITDVAVVAMKEEAAGEVPVAFVVKSKDSELSEDDVKQFVSKQVVFYK 552 Query: 175 RLRNVTFTNSIPKTTSGKILRRELIAKL 202 R+ V FT SIPK SGKILR++L AKL Sbjct: 553 RINKVFFTESIPKAPSGKILRKDLRAKL 580
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 Back     alignment and structure
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure
>pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 Back     alignment and structure
>pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 Back     alignment and structure
>pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 Back     alignment and structure
>pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 Back     alignment and structure
>pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 Back     alignment and structure
>pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 Back     alignment and structure
>pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 Back     alignment and structure
>pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 Back     alignment and structure
>pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 Back     alignment and structure
>pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 Back     alignment and structure
>pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 Back     alignment and structure
>pdb|3RG2|A Chain A, Structure Of A Two-Domain Nrps Fusion Protein Containing The Ente Adenylation Domain And Entb Aryl-Carrier Protein From Enterobactin Biosynthesis Length = 617 Back     alignment and structure
>pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 Back     alignment and structure
>pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 Back     alignment and structure
>pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 Back     alignment and structure
>pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 Back     alignment and structure
>pdb|2QVZ|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|2QVX|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|1T5D|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|2P20|A Chain A, Acetyl-Coa Synthetase, R584a Mutation Length = 652 Back     alignment and structure
>pdb|3DLP|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, BOUND To 4cb Length = 504 Back     alignment and structure
>pdb|2P2B|A Chain A, Acetyl-coa Synthetase, V386a Mutation Length = 652 Back     alignment and structure
>pdb|2P2M|A Chain A, Acetyl-Coa Synthetase, R194a Mutation Length = 652 Back     alignment and structure
>pdb|2P2Q|A Chain A, Acetyl-Coa Synthetase, R584e Mutation Length = 652 Back     alignment and structure
>pdb|2P2F|A Chain A, Acetyl-coa Synthetase, Wild-type With Acetate, Amp, And Coa Bound Length = 652 Back     alignment and structure
>pdb|1PG3|A Chain A, Acetyl Coa Synthetase, Acetylated On Lys609 Length = 652 Back     alignment and structure
>pdb|3CW8|X Chain X, 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cba-adenylate Length = 504 Back     alignment and structure
>pdb|1T5H|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SELENOMETHIONINE Length = 504 Back     alignment and structure
>pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 Back     alignment and structure
>pdb|2P2J|A Chain A, Acetyl-Coa Synthetase, K609a Mutation Length = 652 Back     alignment and structure
>pdb|3PBK|A Chain A, Structural And Functional Studies Of Fatty Acyl-Adenylate Ligases From E. Coli And L. Pneumophila Length = 583 Back     alignment and structure
>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In Complex With Amp Length = 663 Back     alignment and structure
>pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A Nonribosomal Peptide Synthetase Termination Module Length = 1304 Back     alignment and structure
>pdb|3FCC|A Chain A, Crystal Structure Of Dlta Protein In Complex With Atp And Magnesium Length = 512 Back     alignment and structure
>pdb|3DHV|A Chain A, Crystal Structure Of Dlta Protein In Complex With D-Alanine Adenylate Length = 512 Back     alignment and structure
>pdb|3E7W|A Chain A, Crystal Structure Of Dlta: Implications For The Reaction Mechanism Of Non-Ribosomal Peptide Synthetase (Nrps) Adenylation Domains Length = 511 Back     alignment and structure
>pdb|3T5B|A Chain A, Crystal Structure Of N-Terminal Domain Of Facl13 From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|3KXW|A Chain A, The Crystal Structure Of Fatty Acid Amp Ligase From Legionella Pneumophila Length = 590 Back     alignment and structure
>pdb|4DG8|A Chain A, Structure Of Pa1221, An Nrps Protein Containing Adenylation And Pcp Domains Length = 620 Back     alignment and structure
>pdb|3L8C|A Chain A, Structure Of Probable D-Alanine--Poly(Phosphoribitol) Ligase Subunit-1 From Streptococcus Pyogenes Length = 521 Back     alignment and structure
>pdb|1AMU|A Chain A, Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine Length = 563 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 1e-118
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-118
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 1e-118
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 1e-116
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 1e-108
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 4e-84
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 7e-81
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 3e-78
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 2e-77
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 1e-76
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 2e-75
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 2e-68
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 8e-66
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 9e-65
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 1e-64
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 4e-60
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 5e-53
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 2e-49
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 7e-40
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 4e-37
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 2e-23
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 3e-19
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 5e-18
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 8e-16
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 4e-15
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 4e-13
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 4e-13
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 3e-12
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 7e-12
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 9e-10
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
 Score =  346 bits (889), Expect = e-118
 Identities = 95/207 (45%), Positives = 132/207 (63%), Gaps = 3/207 (1%)

Query: 1   GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
           GYG+TET   + +  P  G    G+ G++V   EA++V +DT K L  NQ GEL VRGP+
Sbjct: 339 GYGLTETTSAILI-TPE-GDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPM 396

Query: 61  LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
           +M GY NN +AT  +IDK+GWLH+GD+ Y+DE    FIVDR+K LIK  G+QVAPAELE 
Sbjct: 397 IMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELES 456

Query: 121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRN-V 179
           +L+ HP I DA V   PD +AGE+P A VV     ++T++++  +V  QV   K+LR  V
Sbjct: 457 ILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGV 516

Query: 180 TFTNSIPKTTSGKILRRELIAKLRSKI 206
            F + +PK  +GK+  R++   L    
Sbjct: 517 VFVDEVPKGLTGKLDARKIREILIKAK 543


>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Length = 652 Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Length = 663 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 100.0
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 100.0
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 100.0
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 100.0
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 100.0
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 100.0
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 100.0
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 100.0
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.97
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.97
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 99.84
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 99.7
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 99.7
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.1
4b2g_A609 GH3-1 auxin conjugating enzyme; signaling protein, 98.58
4epl_A581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 98.47
4eql_A581 4-substituted benzoates-glutamate ligase GH3.12; f 98.47
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-46  Score=314.11  Aligned_cols=203  Identities=32%  Similarity=0.514  Sum_probs=189.4

Q ss_pred             CcccccCccceeccCCccCCCCCCcceeecCCceEEEEeCCCCCCCCCCCceEEEEEcCCCCcccCCChhhccccccCCC
Q 043808            1 GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEG   80 (206)
Q Consensus         1 ~YG~TE~g~~~~~~~~~~~~~~~~~~G~p~~~~~~~i~~~~~~~~~~~g~~Gel~i~~~~~~~~y~~~~~~~~~~~~~~~   80 (206)
                      .||+||++..++...  .....++++|+|+|+++++|+|+++++++|.|+.|||+|+||+++.||+++++.+...|..++
T Consensus       299 ~YG~TE~~~~~~~~~--~~~~~~~~~G~p~~~~~~~i~d~~~g~~~~~g~~GEl~v~g~~v~~GY~~~~~~t~~~f~~~g  376 (503)
T 4fuq_A          299 RYGMTETNMNTSNPY--DGDRVPGAVGPALPGVSARVTDPETGKELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDG  376 (503)
T ss_dssp             CCEETTTEECBCCCS--SSCCCTTEEEEBCTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCCCBTTCHHHHHHTBCTTS
T ss_pred             eEcccccCcccccCC--CCCCcCCccccCCCCeEEEEEECCCCCCCcCCCceEEEEECCchhhhhcCChhhhHhhhCCCC
Confidence            599999987654322  234567899999999999999989999999999999999999999999999999999887899


Q ss_pred             eEecCceEEEecCCcEEEeccccceEEECCeEeChHHHHHHHhcCCCcceeEEEeecCCCCCceeEEEEEeCCCCCCCHH
Q 043808           81 WLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKE  160 (206)
Q Consensus        81 ~~~TGDl~~~~~~g~l~~~GR~dd~i~~~G~~v~~~~ie~~i~~~~~v~~~~v~~~~~~~~~~~~~~~v~~~~~~~~~~~  160 (206)
                      ||+|||+++++++|.++|+||.||+||++|++|+|.+||+.|.++|+|.+++|++.+++..++.++++++..+....+.+
T Consensus       377 ~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~~l~~~p~V~~a~vv~~~~~~~~~~~~a~v~~~~~~~~~~~  456 (503)
T 4fuq_A          377 FFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVVVRDKGATIDEA  456 (503)
T ss_dssp             CEEEEEEEEECTTCEEEECCSSTTCEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHH
T ss_pred             CeEcceeEEEcCCCcEEEEecCCCEEEECCEEECHHHHHHHHHhCCCeeEEEEEEeEchhcCceeEEEEEeCCCCCCCHH
Confidence            99999999999999999999999999999999999999999999999999999999998888999999999888888899


Q ss_pred             HHHHHHHHhccccCceeEEEEeCCcCCCCCCcccHHHHHHHHHcc
Q 043808          161 DVQKFVVKQVARYKRLRNVTFTNSIPKTTSGKILRRELIAKLRSK  205 (206)
Q Consensus       161 ~l~~~~~~~l~~~~~p~~~~~v~~~P~t~~GKv~r~~l~~~~~~~  205 (206)
                      ++++++++.|+.|++|..++++++||+|++||++|++|++++++.
T Consensus       457 ~l~~~l~~~L~~~~~P~~i~~v~~lP~t~~GKi~R~~L~~~~~~~  501 (503)
T 4fuq_A          457 QVLHGLDGQLAKFKMPKKVIFVDDLPRNTMGKVQKNVLRETYKDI  501 (503)
T ss_dssp             HHHHHHBTTBCGGGCCSEEEEESCCCBCTTSCBCHHHHHHHTTTT
T ss_pred             HHHHHHHhhcccCCCCCEEEEECCCCCCcccceeHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999998764



>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 3e-70
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 5e-63
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 6e-62
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 1e-54
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 6e-53
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 5e-50
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 9e-45
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Luciferase
species: Firefly (Photinus pyralis) [TaxId: 7054]
 Score =  220 bits (562), Expect = 3e-70
 Identities = 93/199 (46%), Positives = 130/199 (65%), Gaps = 3/199 (1%)

Query: 1   GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPI 60
           GYG+TET   + +     G    G+ G++V   EA++V +DT K L  NQ GEL VRGP+
Sbjct: 336 GYGLTETTSAILITPE--GDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPM 393

Query: 61  LMPGYFNNEQATKLIIDKEGWLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEG 120
           +M GY NN +AT  +IDK+GWLH+GD+ Y+DE    FIVDR+K LIK  G+QVAPAELE 
Sbjct: 394 IMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELES 453

Query: 121 VLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKEDVQKFVVKQVARYKRLRN-V 179
           +L+ HP I DA V   PD +AGE+P A VV     ++T++++  +V  QV   K+LR  V
Sbjct: 454 ILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGV 513

Query: 180 TFTNSIPKTTSGKILRREL 198
            F + +PK  +GK+  R++
Sbjct: 514 VFVDEVPKGLTGKLDARKI 532


>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1amua_514 Phenylalanine activating domain of gramicidin synt 100.0
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 100.0
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 100.0
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Luciferase
species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=100.00  E-value=1.3e-45  Score=307.17  Aligned_cols=202  Identities=46%  Similarity=0.773  Sum_probs=175.6

Q ss_pred             CcccccCccceeccCCccCCCCCCcceeecCCceEEEEeCCCCCCCCCCCceEEEEEcCCCCcccCCChhhccccccCCC
Q 043808            1 GYGMTETCGVVTVENPLLGVQNSGSAGRLVAGVEAQIVCVDTLKPLPPNQVGELWVRGPILMPGYFNNEQATKLIIDKEG   80 (206)
Q Consensus         1 ~YG~TE~g~~~~~~~~~~~~~~~~~~G~p~~~~~~~i~~~~~~~~~~~g~~Gel~i~~~~~~~~y~~~~~~~~~~~~~~~   80 (206)
                      +||+||+++.++....  ....++++|+|+|+++++|+|++++++++.|+.|||+|+|++++.||++++..+...+..++
T Consensus       336 ~YG~TE~~~~~~~~~~--~~~~~~svG~p~~~~~~~i~d~d~~~~~~~g~~Gel~v~g~~~~~gY~~~~~~~~~~~~~~~  413 (541)
T d1lcia_         336 GYGLTETTSAILITPE--GDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDG  413 (541)
T ss_dssp             EECCGGGSSCSEECCC--C---CCCCBEECTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEETTBHHHHHHHBCTTS
T ss_pred             cCCccccCceEEecCc--ccCCCCccccccCCCEEEEEECCCCcCCCCCCeEEEEEccCccCCeeCCChhhhhhcccCCc
Confidence            4999999988876543  34567899999999999999999999999999999999999999999999988887777899


Q ss_pred             eEecCceEEEecCCcEEEeccccceEEECCeEeChHHHHHHHhcCCCcceeEEEeecCCCCCceeEEEEEeCCCCCCCHH
Q 043808           81 WLHTGDLGYFDEHGQLFIVDRIKELIKCNGFQVAPAELEGVLVSHPEILDAVVIPFPDPEAGEVPIAYVVRSPNSSLTKE  160 (206)
Q Consensus        81 ~~~TGDl~~~~~~g~l~~~GR~dd~i~~~G~~v~~~~ie~~i~~~~~v~~~~v~~~~~~~~~~~~~~~v~~~~~~~~~~~  160 (206)
                      ||+|||+++++++|.++++||.+|+|+++|++|+|.+||+.|.++|+|.+++|++.+++..++.++++|++.+....+.+
T Consensus       414 ~~~TGDl~~~~~~G~~~~~GR~~d~i~~~G~~v~~~~IE~~l~~~p~V~~~~v~~~~~~~~g~~~~a~v~~~~~~~~~~~  493 (541)
T d1lcia_         414 WLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEK  493 (541)
T ss_dssp             CEEEEEEEEECTTCCEEEC-----CEEETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHH
T ss_pred             cccCCCeeEEcCCeEEEEeeeecCEEEECCEEECHHHHHHHHHhCCCccEEEEEEEECCCCCEEEEEEEEECCCCCCCHH
Confidence            99999999999999999999999999999999999999999999999999999999988888999999999888888899


Q ss_pred             HHHHHHHHhccccC-ceeEEEEeCCcCCCCCCcccHHHHHHHHHc
Q 043808          161 DVQKFVVKQVARYK-RLRNVTFTNSIPKTTSGKILRRELIAKLRS  204 (206)
Q Consensus       161 ~l~~~~~~~l~~~~-~p~~~~~v~~~P~t~~GKv~r~~l~~~~~~  204 (206)
                      ++++++++++.+++ .|..++++++||+|++||++|++|++++.+
T Consensus       494 ~l~~~~~~~l~~~~~~p~~i~~v~~lP~t~~GKi~r~~l~~~~~~  538 (541)
T d1lcia_         494 EIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILIK  538 (541)
T ss_dssp             HHHHHHHHHSCGGGSCTTEEEEESSCCC-----CCHHHHHHHHHH
T ss_pred             HHHHHHHHhCCccccCCcEEEEeCCCCcCCCcCccHHHHHHHHHH
Confidence            99999999998765 688999999999999999999999999875



>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure