Citrus Sinensis ID: 043870

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520------

MELNGFSSISSGMPQQERLLPTSSFSGIRVSTATGQPNSSVSGVQLGKFNIPRKTRATSKRFSVRSILADVAKDYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFLEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKDGTII

ccccccccccccccccccccccccccccEEccccccccccccEEccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccccEEEEEEcccHHHHHHHHHHHcccccccccccccEEEEcccEEcccccccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEEcccccccccEEEEcccccEEEEEEccccccccccccccccccccHHccccccEEEEcccEEEcHHHHHHHHHHHccccccccccHHccccccccEEEEcccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccEEEEcEEcccEEEcccEEEEEEEEcccEEccccEEEcEEEEcccccccHHHHHHHHHcccccEEEccccEEEcEEEccccEEccccEEcccccccccccccccEEEEccEEEEccccEEcccccc

ccccccccccccccccccccccccccccEEEEccccccccEEEEEccccccccccccccccEEEEEEEccccccccccccccccccccccccEEEEEEcccccccccccHHHccccccccccEEEEEEccccccccccccEEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccccHcHHHHHHHHHHHHHHHccccccEEEEEcccccEcccHHHHHHHHHHccccEEEEEEEccHHHHHHccEEEEccccEEEEEEEccccHHHHHHccccccccccHHHHcccccEEEEEEEEEcHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccccEEEEEEEEccEEEEccEEEEEEEEEEEEEcccEEEEcEEEEcccccccHHHHHHHHHcccccEEcccccEEEEEEEEcccEccccEEEEccccccccccccccEEEEccEEEEEcccEcccccEc

melngfssissgmpqqerllptssfsgirvstatgqpnssvsgvqlgkfniprktratskrfsVRSILADVAKDYmtfqapvfekpeadpKAVASIIlgggagtrlfpltgrrakpavpiggcyrlidvpmsncinsgIKKIYILTQFNSQSLNRHISrtynlgdgmnfgDGFVEVLAATQrqgesgkkwFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHinsggdisvcclpvdesrasdfglmkidetgrirqflekpkgenlrsmqIDTTALGLsaqearnfpyiasMGIYLFKTEVLLKVLRWHypeandfgsevipmatkdfNVQAYLFNdywedigtIKSFfdanlsltdkppkfhfydpqkpiftsprflppskiekcrvqdsiishgcflrecSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAegkvpvgigrdtkiknciidknakigknviiankdgveeaerpsdgfyirSGITVVLknttikdgtii

melngfssissgmpqqerLLPTSSFSGIRVSTatgqpnssvsgvqlgkfniprktratskrfsvrSILADVAKDYMTFQAPvfekpeadpKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRqgesgkkwfQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDfglmkidetgrirqflekpkgenlrsmQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAegkvpvgigrdtkiknciidknakigknviiankdgveeaerpsdgfyirsgitvvlknttikdgtii

************************************************************RFSVRSILADVAKDYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFL************IDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVE*****SDGFYIRSGITVVLKNTTI******

********************************************************************************************VASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFLEKPKGENL****************ARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKDGTII

***********GMPQQERLLPTSSFSGIRVST********VSGVQLGKFNIPRKTRATSKRFSVRSILADVAKDYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFLEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKDGTII

************************FSGIRVSTATGQPNSSVSGVQLGKFN********SKRFSVRSILADVAKDYMTFQAPVFEKPEADPKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFLEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVVLKNTTIKD*TII

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		526	2.2.26 [Sep-21-2011]
P55230		518	Glucose-1-phosphate adeny	yes	no	0.923	0.938	0.716	0.0
P55233		522	Glucose-1-phosphate adeny	N/A	no	0.863	0.869	0.729	0.0
P55242		519	Glucose-1-phosphate adeny	N/A	no	0.865	0.876	0.727	0.0
P55231		521	Glucose-1-phosphate adeny	no	no	0.901	0.909	0.671	0.0
Q00081		470	Glucose-1-phosphate adeny	N/A	no	0.846	0.946	0.706	0.0
P55229		522	Glucose-1-phosphate adeny	no	no	0.927	0.934	0.660	0.0
Q9SIK1		523	Probable glucose-1-phosph	no	no	0.986	0.992	0.630	0.0
P55243		483	Glucose-1-phosphate adeny	N/A	no	0.840	0.915	0.681	0.0
P30524		523	Glucose-1-phosphate adeny	N/A	no	0.840	0.845	0.642	0.0
P12299		522	Glucose-1-phosphate adeny	N/A	no	0.840	0.846	0.640	0.0

>sp\|P55230\|GLGL2_ARATH Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic OS=Arabidopsis thaliana GN=APL2 PE=2 SV=2	Back alignment and function desciption

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/494 (71%), Positives = 419/494 (84%), Gaps = 8/494 (1%)

Query: 39  SSVSGVQLGKFNIPRKTR---ATSKRFS---VRSILADVAKDYMTFQAPVFEKPEADPKA 92
           S+  G Q+ K N  R T+   A  K+     +RS+L            P+     ADPK 
Sbjct: 27  SAFWGTQVVKPNHLRTTKLRSAPQKKIQTNLIRSVLTPFVDQES--HEPLLRTQNADPKN 84

Query: 93  VASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQS 152
           VASIILGGGAGTRLFPLT +RAKPAVPIGGCYRLID+PMSNCINSGI+KI+ILTQFNS S
Sbjct: 85  VASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFS 144

Query: 153 LNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRN 212
           LNRH+SRTYN G+G+NFGDGFVEVLAATQ  G++GKKWFQGTADAVRQFIW+FEDAK +N
Sbjct: 145 LNRHLSRTYNFGNGVNFGDGFVEVLAATQTSGDAGKKWFQGTADAVRQFIWVFEDAKTKN 204

Query: 213 IENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQF 272
           +E++LILSGDHLYRMDYM+FVQ HI S  DI+V CLP+DESRASDFGL+KID++G+I QF
Sbjct: 205 VEHVLILSGDHLYRMDYMNFVQKHIESNADITVSCLPMDESRASDFGLLKIDQSGKIIQF 264

Query: 273 LEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFG 332
            EKPKG++L++MQ+DT+ LGL  +EA   PYIASMG+Y+F+ EVLLK+LR  YP +NDFG
Sbjct: 265 SEKPKGDDLKAMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFG 324

Query: 333 SEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRF 392
           SE+IP+A  + NVQA+LFNDYWEDIGTI SFFDANL+LT++PPKF FYD + P FTSPRF
Sbjct: 325 SEIIPLAVGEHNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDQKTPFFTSPRF 384

Query: 393 LPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAE 452
           LPP+K++KCR+ DSI+SHGCFLRECSV+HSIVGIRSRLE GVEL+DTMMMGAD+YQTEAE
Sbjct: 385 LPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADFYQTEAE 444

Query: 453 IAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGIT 512
           IA+LLAEGKVPVG+G++TKIKNCIIDKNAKIGKNV+IAN DGVEE +RP +GF+IRSGIT
Sbjct: 445 IASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFHIRSGIT 504

Query: 513 VVLKNTTIKDGTII 526
           VVLKN TI+DG  I
Sbjct: 505 VVLKNATIRDGLHI 518

This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP-glucose from Glc-1-P and ATP.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 2EC: 7

>sp\|P55233\|GLGL1_BETVU Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic OS=Beta vulgaris GN=AGPS1 PE=2 SV=1	Back alignment and function description

>sp\|P55242\|GLGL2_SOLTU Glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic/amyloplastic OS=Solanum tuberosum GN=AGPS2 PE=2 SV=1	Back alignment and function description

>sp\|P55231\|GLGL3_ARATH Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic OS=Arabidopsis thaliana GN=APL3 PE=2 SV=2	Back alignment and function description

>sp\|Q00081\|GLGL1_SOLTU Glucose-1-phosphate adenylyltransferase large subunit 1 (Fragment) OS=Solanum tuberosum GN=AGPS1 PE=2 SV=1	Back alignment and function description

>sp\|P55229\|GLGL1_ARATH Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ADG2 PE=1 SV=3	Back alignment and function description

>sp\|Q9SIK1\|GLGL4_ARATH Probable glucose-1-phosphate adenylyltransferase large subunit, chloroplastic OS=Arabidopsis thaliana GN=At2g21590 PE=2 SV=1	Back alignment and function description

>sp\|P55243\|GLGL3_SOLTU Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic/amyloplastic OS=Solanum tuberosum GN=AGPS3 PE=2 SV=1	Back alignment and function description

>sp\|P30524\|GLGL1_HORVU Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic OS=Hordeum vulgare PE=2 SV=2	Back alignment and function description

>sp\|P12299\|GLGL2_WHEAT Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic OS=Triticum aestivum GN=AGP-L PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		526
255548169		528	glucose-1-phosphate adenylyltransferase,	0.935	0.931	0.808	0.0
359479997		514	PREDICTED: glucose-1-phosphate adenylylt	0.914	0.935	0.811	0.0
224128113		445	predicted protein [Populus trichocarpa]	0.846	1.0	0.853	0.0
147818953		452	hypothetical protein VITISV_040166 [Viti	0.855	0.995	0.848	0.0
297744104		476	unnamed protein product [Vitis vinifera]	0.855	0.945	0.817	0.0
359357900		536	ADP-glucose pyrophosphorylase 2 [Spirode	0.882	0.865	0.788	0.0
2642640		481	ADP-glucose pyrophosphorylase large subu	0.903	0.987	0.743	0.0
356571037		528	PREDICTED: glucose-1-phosphate adenylylt	0.965	0.962	0.740	0.0
224085694		475	predicted protein [Populus trichocarpa]	0.874	0.968	0.769	0.0
449460245		532	PREDICTED: glucose-1-phosphate adenylylt	0.874	0.864	0.758	0.0

>gi\|255548169\|ref\|XP_002515141.1\| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis] gi\|223545621\|gb\|EEF47125.1\| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/492 (80%), Positives = 448/492 (91%)

Query: 35  GQPNSSVSGVQLGKFNIPRKTRATSKRFSVRSILADVAKDYMTFQAPVFEKPEADPKAVA 94
           G  ++SVS  QLGK N PRK   T+ RF   S+LADVAKD+  FQA V  K EADPK VA
Sbjct: 37  GHSHTSVSSFQLGKINFPRKMCKTTTRFLTTSVLADVAKDFTNFQATVLRKQEADPKTVA 96

Query: 95  SIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLN 154
           SIILGGGAGTRLFPLT  RAKPAVPIGGCYRLIDVPMSNCINSGI KIYILTQFNSQSLN
Sbjct: 97  SIILGGGAGTRLFPLTRTRAKPAVPIGGCYRLIDVPMSNCINSGINKIYILTQFNSQSLN 156

Query: 155 RHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIE 214
           RHI+RTYN G+G+NFGDGFVEVLAATQ  GESGKKWFQGTADAVRQF+W+FEDAKH +IE
Sbjct: 157 RHIARTYNSGNGVNFGDGFVEVLAATQTPGESGKKWFQGTADAVRQFLWLFEDAKHSHIE 216

Query: 215 NILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQFLE 274
           NILILSGDHLYRMDYMDF+Q HI+SG DI+V CLPVDESRASDFGL+KIDETG+IRQFLE
Sbjct: 217 NILILSGDHLYRMDYMDFLQKHIDSGADITVSCLPVDESRASDFGLIKIDETGQIRQFLE 276

Query: 275 KPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFGSE 334
           KPKGE+L+SM++DT+ LGLS  +AR  PYIASMGIY+FKT+VLLK+LRWHYP ANDFGSE
Sbjct: 277 KPKGESLKSMRVDTSTLGLSISDARKLPYIASMGIYMFKTDVLLKLLRWHYPTANDFGSE 336

Query: 335 VIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLP 394
           +IP++ KD+NV+AYLFNDYWEDIGTIKSFFD+NL+LTD+PP+F F+DP KPIFTSPRFLP
Sbjct: 337 IIPLSAKDYNVRAYLFNDYWEDIGTIKSFFDSNLALTDQPPEFQFFDPLKPIFTSPRFLP 396

Query: 395 PSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIA 454
           P+KIE+C+V+DSIISHGCFLRECSVEHSIVG+RSRLEYGVELKDTMMMGADYYQTEAE+A
Sbjct: 397 PTKIERCQVKDSIISHGCFLRECSVEHSIVGVRSRLEYGVELKDTMMMGADYYQTEAEVA 456

Query: 455 ALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGITVV 514
           A LA GKVP+G+G++TKI NCIIDKNA+IGKNV+IANKD VEEA+RPS+GFYIRSGITVV
Sbjct: 457 ASLAGGKVPIGVGQETKIMNCIIDKNARIGKNVVIANKDHVEEADRPSEGFYIRSGITVV 516

Query: 515 LKNTTIKDGTII 526
           LKN+ IKDGTII
Sbjct: 517 LKNSEIKDGTII 528

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359479997\|ref\|XP_002274245.2\| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224128113\|ref\|XP_002320247.1\| predicted protein [Populus trichocarpa] gi\|222861020\|gb\|EEE98562.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147818953\|emb\|CAN67125.1\| hypothetical protein VITISV_040166 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297744104\|emb\|CBI37074.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359357900\|gb\|AEV40472.1\| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza] gi\|359357902\|gb\|AEV40473.1\| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]	Back alignment and taxonomy information

>gi\|2642640\|gb\|AAB91468.1\| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus subsp. vulgaris]	Back alignment and taxonomy information

>gi\|356571037\|ref\|XP_003553688.1\| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|224085694\|ref\|XP_002307668.1\| predicted protein [Populus trichocarpa] gi\|222857117\|gb\|EEE94664.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449460245\|ref\|XP_004147856.1\| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		526
TAIR\|locus:2199241		518	APL2 "ADPGLC-PPase large subun	0.918	0.932	0.720	1.2e-193
TAIR\|locus:2049364		523	APL4 [Arabidopsis thaliana (ta	0.982	0.988	0.643	4.8e-181
TAIR\|locus:2136358		521	APL3 [Arabidopsis thaliana (ta	0.863	0.871	0.701	1e-180
TAIR\|locus:2182132		522	APL1 "ADP glucose pyrophosphor	0.956	0.963	0.647	6.3e-179
TAIR\|locus:2156263		520	ADG1 "ADP glucose pyrophosphor	0.823	0.832	0.575	1.4e-135
UNIPROTKB\|P15280		514	AGPS "Glucose-1-phosphate aden	0.927	0.949	0.520	6.9e-134
TAIR\|locus:2032003		476	APS2 "AT1G05610" [Arabidopsis	0.800	0.884	0.403	2.7e-84
TIGR_CMR\|SO_1498		420	SO_1498 "glucose-1-phosphate a	0.712	0.892	0.360	2.4e-53
UNIPROTKB\|Q9KLP4		407	glgC2 "Glucose-1-phosphate ade	0.657	0.850	0.347	5.6e-52
TIGR_CMR\|VC_A0699		407	VC_A0699 "glucose-1-phosphate	0.657	0.850	0.347	5.6e-52

TAIR\|locus:2199241 APL2 "ADPGLC-PPase large subunit" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1876 (665.4 bits), Expect = 1.2e-193, P = 1.2e-193
 Identities = 354/491 (72%), Positives = 421/491 (85%)

Query:    39 SSVSGVQLGKFNIPRKTR---ATSKRFS---VRSILADVAKDYMTFQAPVFEKPEADPKA 92
             S+  G Q+ K N  R T+   A  K+     +RS+L     D  + + P+     ADPK 
Sbjct:    27 SAFWGTQVVKPNHLRTTKLRSAPQKKIQTNLIRSVLTPFV-DQESHE-PLLRTQNADPKN 84

Query:    93 VASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQS 152
             VASIILGGGAGTRLFPLT +RAKPAVPIGGCYRLID+PMSNCINSGI+KI+ILTQFNS S
Sbjct:    85 VASIILGGGAGTRLFPLTSKRAKPAVPIGGCYRLIDIPMSNCINSGIRKIFILTQFNSFS 144

Query:   153 LNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRN 212
             LNRH+SRTYN G+G+NFGDGFVEVLAATQ  G++GKKWFQGTADAVRQFIW+FEDAK +N
Sbjct:   145 LNRHLSRTYNFGNGVNFGDGFVEVLAATQTSGDAGKKWFQGTADAVRQFIWVFEDAKTKN 204

Query:   213 IENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRIRQF 272
             +E++LILSGDHLYRMDYM+FVQ HI S  DI+V CLP+DESRASDFGL+KID++G+I QF
Sbjct:   205 VEHVLILSGDHLYRMDYMNFVQKHIESNADITVSCLPMDESRASDFGLLKIDQSGKIIQF 264

Query:   273 LEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEANDFG 332
              EKPKG++L++MQ+DT+ LGL  +EA   PYIASMG+Y+F+ EVLLK+LR  YP +NDFG
Sbjct:   265 SEKPKGDDLKAMQVDTSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTSNDFG 324

Query:   333 SEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRF 392
             SE+IP+A  + NVQA+LFNDYWEDIGTI SFFDANL+LT++PPKF FYD + P FTSPRF
Sbjct:   325 SEIIPLAVGEHNVQAFLFNDYWEDIGTIGSFFDANLALTEQPPKFQFYDQKTPFFTSPRF 384

Query:   393 LPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAE 452
             LPP+K++KCR+ DSI+SHGCFLRECSV+HSIVGIRSRLE GVEL+DTMMMGAD+YQTEAE
Sbjct:   385 LPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDTMMMGADFYQTEAE 444

Query:   453 IAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIRSGIT 512
             IA+LLAEGKVPVG+G++TKIKNCIIDKNAKIGKNV+IAN DGVEE +RP +GF+IRSGIT
Sbjct:   445 IASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKNVVIANADGVEEGDRPEEGFHIRSGIT 504

Query:   513 VVLKNTTIKDG 523
             VVLKN TI+DG
Sbjct:   505 VVLKNATIRDG 515

GO:0008878 "glucose-1-phosphate adenylyltransferase activity" evidence=IEA;ISS;IDA

GO:0009058 "biosynthetic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

GO:0016779 "nucleotidyltransferase activity" evidence=IEA

GO:0019252 "starch biosynthetic process" evidence=TAS

TAIR\|locus:2049364 APL4 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2136358 APL3 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2182132 APL1 "ADP glucose pyrophosphorylase large subunit 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2156263 ADG1 "ADP glucose pyrophosphorylase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P15280 AGPS "Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2032003 APS2 "AT1G05610" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1498 SO_1498 "glucose-1-phosphate adenylyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KLP4 glgC2 "Glucose-1-phosphate adenylyltransferase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_A0699 VC_A0699 "glucose-1-phosphate adenylyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B2IUY3	GLGC_NOSP7	2, ., 7, ., 7, ., 2, 7	0.6086	0.8117	0.9953	yes	no
P12300	GLGL3_WHEAT	2, ., 7, ., 7, ., 2, 7	0.6136	0.8422	0.886	N/A	no
Q00081	GLGL1_SOLTU	2, ., 7, ., 7, ., 2, 7	0.7062	0.8460	0.9468	N/A	no
B8HM61	GLGC_CYAP4	2, ., 7, ., 7, ., 2, 7	0.5743	0.8117	0.9953	yes	no
B1XLF1	GLGC_SYNP2	2, ., 7, ., 7, ., 2, 7	0.5778	0.7870	0.9650	yes	no
P55242	GLGL2_SOLTU	2, ., 7, ., 7, ., 2, 7	0.7270	0.8650	0.8766	N/A	no
P55243	GLGL3_SOLTU	2, ., 7, ., 7, ., 2, 7	0.6817	0.8403	0.9151	N/A	no
P55241	GLGL1_MAIZE	2, ., 7, ., 7, ., 2, 7	0.5835	0.8707	0.8875	N/A	no
P52415	GLGC_SYNY3	2, ., 7, ., 7, ., 2, 7	0.5720	0.8117	0.9726	N/A	no
Q3MBJ4	GLGC_ANAVT	2, ., 7, ., 7, ., 2, 7	0.5926	0.8117	0.9953	yes	no
A5GLA9	GLGC_SYNPW	2, ., 7, ., 7, ., 2, 7	0.5547	0.8136	0.9930	yes	no
P12299	GLGL2_WHEAT	2, ., 7, ., 7, ., 2, 7	0.6404	0.8403	0.8467	N/A	no
P55233	GLGL1_BETVU	2, ., 7, ., 7, ., 2, 7	0.7290	0.8631	0.8697	N/A	no
P55232	GLGS_BETVU	2, ., 7, ., 7, ., 2, 7	0.5182	0.8250	0.8875	N/A	no
P55230	GLGL2_ARATH	2, ., 7, ., 7, ., 2, 7	0.7165	0.9239	0.9382	yes	no
Q5N3K9	GLGC_SYNP6	2, ., 7, ., 7, ., 2, 7	0.5835	0.8136	0.9953	yes	no
P55234	GLGL2_MAIZE	2, ., 7, ., 7, ., 2, 7	0.6155	0.8707	0.8790	N/A	no
P30524	GLGL1_HORVU	2, ., 7, ., 7, ., 2, 7	0.6426	0.8403	0.8451	N/A	no
B7KDB8	GLGC_CYAP7	2, ., 7, ., 7, ., 2, 7	0.5926	0.8117	0.9953	yes	no
P30521	GLGC_NOSS1	2, ., 7, ., 7, ., 2, 7	0.5926	0.8117	0.9953	yes	no
B7K5U7	GLGC_CYAP8	2, ., 7, ., 7, ., 2, 7	0.5720	0.8117	0.9953	yes	no
Q31QN4	GLGC_SYNE7	2, ., 7, ., 7, ., 2, 7	0.5835	0.8136	0.9953	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.7	0.976
4th Layer	2.7.7.27	0.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pm.C_LG_XIV000240	glucose-1-phosphate adenylyltransferase (EC-2.7.7.27); This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP- glucose from Glc-1-P and ATP (By similarity) (445 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.XV.361.1	hypothetical protein (586 aa)	•	•	•	•	0.970
	gw1.164.92.1	hypothetical protein (387 aa)	•	•	•	•	0.960
	gw1.XVII.1126.1	hypothetical protein (688 aa)	•	•	•	•	0.952
	estExt_fgenesh4_pg.C_LG_IX1158	hypothetical protein; Phosphorylase is an important allosteric enzyme in carbohydrate metabolis [...] (853 aa)	•	•	•	•	0.943
	estExt_Genewise1_v1.C_LG_IV2986	hypothetical protein; Phosphorylase is an important allosteric enzyme in carbohydrate metabolis [...] (819 aa)	•	•	•	•	0.943
	estExt_Genewise1_v1.C_LG_IV0101	hypothetical protein; Phosphorylase is an important allosteric enzyme in carbohydrate metabolis [...] (950 aa)	•	•	•	•	0.935
	estExt_fgenesh4_pg.C_LG_XV1054	phosphoglucomutase (EC-5.4.2.2) (551 aa)			•	•	0.908
	eugene3.00121193	phosphoglucomutase (EC-5.4.2.2) (631 aa)			•	•	0.907
	estExt_fgenesh4_pm.C_LG_VIII0571	phosphoglucomutase (EC-5.4.2.2) (582 aa)			•	•	0.907
	estExt_fgenesh4_pg.C_LG_X0989	phosphoglucomutase (EC-5.4.2.2) (582 aa)			•	•	0.907

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		526
PLN02241		436	PLN02241, PLN02241, glucose-1-phosphate adenylyltr	0.0
PRK02862		429	PRK02862, glgC, glucose-1-phosphate adenylyltransf	0.0
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	1e-175
COG0448		393	COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb	1e-148
PRK00844		407	PRK00844, glgC, glucose-1-phosphate adenylyltransf	1e-119
PRK00725		425	PRK00725, glgC, glucose-1-phosphate adenylyltransf	1e-116
PRK05293		380	PRK05293, glgC, glucose-1-phosphate adenylyltransf	4e-97
pfam00483		247	pfam00483, NTP_transferase, Nucleotidyl transferas	1e-90
cd02508		200	cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory	4e-75
COG1208		358	COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph	2e-39
cd04181		217	cd04181, NTP_transferase, NTP_transferases catalyz	3e-37
TIGR02092		369	TIGR02092, glgD, glucose-1-phosphate adenylyltrans	3e-34
cd04651		104	cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly	3e-31
COG1209		286	COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel	1e-17
cd06915		223	cd06915, NTP_transferase_WcbM_like, WcbM_like is a	2e-17
cd04189		236	cd04189, G1P_TT_long, G1P_TT_long represents the l	2e-16
cd06426		220	cd06426, NTP_transferase_like_2, NTP_trnasferase_l	3e-16
TIGR01208		353	TIGR01208, rmlA_long, glucose-1-phosphate thymidyl	3e-15
TIGR03992		393	TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph	3e-15
cd02538		240	cd02538, G1P_TT_short, G1P_TT_short is the short f	6e-10
cd02507		216	cd02507, eIF-2B_gamma_N_like, The N-terminal of eI	8e-08
cd04198		214	cd04198, eIF-2B_gamma_N, The N-terminal domain of	3e-07
TIGR01207		286	TIGR01207, rmlA, glucose-1-phosphate thymidylyltra	2e-06
cd05787		79	cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit	2e-05
cd06425		233	cd06425, M1P_guanylylT_B_like_N, N-terminal domain	5e-05
cd06422		221	cd06422, NTP_transferase_like_1, NTP_transferase_l	8e-05
cd02523		229	cd02523, PC_cytidylyltransferase, Phosphocholine c	8e-05
cd03356		79	cd03356, LbH_G1P_AT_C_like, Left-handed parallel b	5e-04
cd02540		229	cd02540, GT2_GlmU_N_bac, N-terminal domain of bact	0.001
PRK15480		292	PRK15480, PRK15480, glucose-1-phosphate thymidylyl	0.002
cd02541		267	cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca	0.004

>gnl\|CDD\|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

 Score =  893 bits (2309), Expect = 0.0
 Identities = 331/438 (75%), Positives = 387/438 (88%), Gaps = 3/438 (0%)

Query: 90  PKAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFN 149
           PK+VA+IILGGGAGTRLFPLT RRAKPAVPIGG YRLID+PMSNCINSGI KIY+LTQFN
Sbjct: 1   PKSVAAIILGGGAGTRLFPLTKRRAKPAVPIGGNYRLIDIPMSNCINSGINKIYVLTQFN 60

Query: 150 SQSLNRHISRTYNLGDGMNFGDGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAK 209
           S SLNRH+SR YN G+G NFGDGFVEVLAATQ  GE G  WFQGTADAVRQF+W+FEDAK
Sbjct: 61  SASLNRHLSRAYNFGNGGNFGDGFVEVLAATQTPGEKG--WFQGTADAVRQFLWLFEDAK 118

Query: 210 HRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPVDESRASDFGLMKIDETGRI 269
           ++N+E +LILSGDHLYRMDYMDFVQ H  SG DI++ CLPVDESRASDFGLMKID+TGRI
Sbjct: 119 NKNVEEVLILSGDHLYRMDYMDFVQKHRESGADITIACLPVDESRASDFGLMKIDDTGRI 178

Query: 270 RQFLEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEAN 329
            +F EKPKG+ L++MQ+DTT LGLS +EA+  PYIASMGIY+FK +VLLK+LRW +P AN
Sbjct: 179 IEFSEKPKGDELKAMQVDTTVLGLSPEEAKEKPYIASMGIYVFKKDVLLKLLRWRFPTAN 238

Query: 330 DFGSEVIPMATKD-FNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFT 388
           DFGSE+IP A K+ +NVQAYLF+ YWEDIGTIKSF++ANL+LT +PPKF FYDP  PI+T
Sbjct: 239 DFGSEIIPGAIKEGYNVQAYLFDGYWEDIGTIKSFYEANLALTKQPPKFSFYDPDAPIYT 298

Query: 389 SPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQ 448
           SPRFLPPSKIE CR+ DSIISHGCFLREC +EHS+VG+RSR+  GVE++DT+MMGADYY+
Sbjct: 299 SPRFLPPSKIEDCRITDSIISHGCFLRECKIEHSVVGLRSRIGEGVEIEDTVMMGADYYE 358

Query: 449 TEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAERPSDGFYIR 508
           TE EIA+LLAEGKVP+GIG +TKI+N IIDKNA+IGKNV+I NKDGV+EA+R  +G+YIR
Sbjct: 359 TEEEIASLLAEGKVPIGIGENTKIRNAIIDKNARIGKNVVIINKDGVQEADREEEGYYIR 418

Query: 509 SGITVVLKNTTIKDGTII 526
           SGI V+LKN  I DGT+I
Sbjct: 419 SGIVVILKNAVIPDGTVI 436

Length = 436

>gnl\|CDD\|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|215940 pfam00483, NTP_transferase, Nucleotidyl transferase	Back alignment and domain information

>gnl\|CDD\|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>gnl\|CDD\|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>gnl\|CDD\|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>gnl\|CDD\|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>gnl\|CDD\|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>gnl\|CDD\|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>gnl\|CDD\|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>gnl\|CDD\|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>gnl\|CDD\|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>gnl\|CDD\|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>gnl\|CDD\|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>gnl\|CDD\|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU	Back alignment and domain information

>gnl\|CDD\|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>gnl\|CDD\|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		526
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	100.0
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	100.0
PLN02241		436	glucose-1-phosphate adenylyltransferase	100.0
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	100.0
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	100.0
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	100.0
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	100.0
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	100.0
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	100.0
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	100.0
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
COG1209		286	RfbA dTDP-glucose pyrophosphorylase [Cell envelope	100.0
PF00483		248	NTP_transferase: Nucleotidyl transferase This Pros	100.0
KOG1462		433	consensus Translation initiation factor 2B, gamma	100.0
TIGR01105		297	galF UTP-glucose-1-phosphate uridylyltransferase,	100.0
PRK10122		297	GalU regulator GalF; Provisional	100.0
cd06425		233	M1P_guanylylT_B_like_N N-terminal domain of the M1	100.0
cd06428		257	M1P_guanylylT_A_like_N N-terminal domain of M1P_gu	100.0
KOG1461		673	consensus Translation initiation factor 2B, epsilo	100.0
cd02538		240	G1P_TT_short G1P_TT_short is the short form of glu	100.0
PRK15480		292	glucose-1-phosphate thymidylyltransferase RfbA; Pr	100.0
cd02541		267	UGPase_prokaryotic Prokaryotic UGPase catalyses th	100.0
TIGR01207		286	rmlA glucose-1-phosphate thymidylyltransferase, sh	100.0
TIGR02623		254	G1P_cyt_trans glucose-1-phosphate cytidylyltransfe	100.0
TIGR01099		260	galU UTP-glucose-1-phosphate uridylyltransferase.	100.0
PRK13389		302	UTP--glucose-1-phosphate uridylyltransferase subun	100.0
cd04189		236	G1P_TT_long G1P_TT_long represents the long form o	100.0
cd06422		221	NTP_transferase_like_1 NTP_transferase_like_1 is a	100.0
cd02524		253	G1P_cytidylyltransferase G1P_cytidylyltransferase	100.0
cd06915		223	NTP_transferase_WcbM_like WcbM_like is a subfamily	100.0
cd04181		217	NTP_transferase NTP_transferases catalyze the tran	100.0
cd06426		220	NTP_transferase_like_2 NTP_trnasferase_like_2 is a	99.98
COG1210		291	GalU UDP-glucose pyrophosphorylase [Cell envelope	99.97
cd04197		217	eIF-2B_epsilon_N The N-terminal domain of epsilon	99.96
cd02523		229	PC_cytidylyltransferase Phosphocholine cytidylyltr	99.96
cd02508		200	ADP_Glucose_PP ADP-glucose pyrophosphorylase is in	99.96
cd04183		231	GT2_BcE_like GT2_BcbE_like is likely involved in t	99.96
cd02509		274	GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf	99.94
cd02540		229	GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	99.94
cd02507		216	eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma	99.93
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	99.92
cd04198		214	eIF-2B_gamma_N The N-terminal domain of gamma subu	99.91
PRK05450		245	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.91
COG1213		239	Predicted sugar nucleotidyltransferases [Cell enve	99.9
cd02517		239	CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th	99.9
PRK13368		238	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.88
COG4750		231	LicC CTP:phosphocholine cytidylyltransferase invol	99.86
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	99.85
COG0836		333	{ManC} Mannose-1-phosphate guanylyltransferase [Ce	99.82
PLN02917		293	CMP-KDO synthetase	99.78
TIGR00453		217	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.66
TIGR00466		238	kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe	99.65
PRK00155		227	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.65
cd02516		218	CDP-ME_synthetase CDP-ME synthetase is involved in	99.62
TIGR03310		188	matur_ygfJ molybdenum hydroxylase accessory protei	99.6
PRK09382		378	ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp	99.59
PF12804		160	NTP_transf_3: MobA-like NTP transferase domain; PD	99.58
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.57
PRK13385		230	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.56
cd02513		223	CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-	99.55
TIGR00454		183	conserved hypothetical protein TIGR00454. At this	99.54
cd02503		181	MobA MobA catalyzes the formation of molybdopterin	99.5
PRK00317		193	mobA molybdopterin-guanine dinucleotide biosynthes	99.48
PLN02728		252	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.48
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.48
cd04182		186	GT_2_like_f GT_2_like_f is a subfamily of the glyc	99.46
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.45
COG2068		199	Uncharacterized MobA-related protein [General func	99.45
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.44
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.44
COG2266		177	GTP:adenosylcobinamide-phosphate guanylyltransfera	99.44
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.43
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.42
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.41
TIGR03584		222	PseF pseudaminic acid CMP-transferase. The sequenc	99.41
TIGR02665		186	molyb_mobA molybdopterin-guanine dinucleotide bios	99.4
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.4
TIGR03202		190	pucB xanthine dehydrogenase accessory protein pucB	99.4
PRK02726		200	molybdopterin-guanine dinucleotide biosynthesis pr	99.4
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.4
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.4
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.37
PRK00560		196	molybdopterin-guanine dinucleotide biosynthesis pr	99.37
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	99.33
PF01128		221	IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly	99.3
COG1212		247	KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase	99.3
COG1211		230	IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt	99.27
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	99.26
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.23
cd02518		233	GT2_SpsF SpsF is a glycosyltrnasferase implicated	99.22
COG0746		192	MobA Molybdopterin-guanine dinucleotide biosynthes	99.2
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.19
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.19
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.18
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.15
PRK14500		346	putative bifunctional molybdopterin-guanine dinucl	99.14
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.13
PLN02296		269	carbonate dehydratase	99.13
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.13
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.12
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.11
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.1
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	99.1
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.1
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	99.09
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.07
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.06
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.06
PRK13627		196	carnitine operon protein CaiE; Provisional	99.06
PLN02472		246	uncharacterized protein	99.06
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.05
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	99.04
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	99.04
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.04
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.04
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.02
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.02
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.0
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	98.99
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	98.98
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	98.98
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	98.98
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	98.97
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	98.96
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	98.96
cd04193		323	UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala	98.96
cd04180		266	UGPase_euk_like Eukaryotic UGPase-like includes UD	98.96
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	98.95
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	98.94
KOG1461		673	consensus Translation initiation factor 2B, epsilo	98.93
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	98.92
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	98.92
PRK13627		196	carnitine operon protein CaiE; Provisional	98.9
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	98.9
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	98.9
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	98.9
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	98.9
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	98.89
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	98.88
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	98.88
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	98.88
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	98.88
PLN02474		469	UTP--glucose-1-phosphate uridylyltransferase	98.87
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	98.87
PLN02472		246	uncharacterized protein	98.87
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	98.85
PLN02296		269	carbonate dehydratase	98.85
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	98.84
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	98.84
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	98.84
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	98.84
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	98.83
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	98.83
COG1083		228	NeuA CMP-N-acetylneuraminic acid synthetase [Cell	98.81
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	98.81
COG1043		260	LpxA Acyl-[acyl carrier protein]	98.79
KOG1462		433	consensus Translation initiation factor 2B, gamma	98.78
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	98.78
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	98.78
PTZ00339		482	UDP-N-acetylglucosamine pyrophosphorylase; Provisi	98.77
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	98.76
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	98.76
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	98.76
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	98.75
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	98.75
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	98.72
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	98.7
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	98.62
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	98.62
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	98.6
PRK11132		273	cysE serine acetyltransferase; Provisional	98.58
PLN02694		294	serine O-acetyltransferase	98.55
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	98.53
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	98.52
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.51
PRK10502		182	putative acyl transferase; Provisional	98.46
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.46
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	98.45
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.41
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.41
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.41
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	98.4
PLN02694		294	serine O-acetyltransferase	98.39
PRK10502		182	putative acyl transferase; Provisional	98.37
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	98.37
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.36
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	98.36
PLN02357		360	serine acetyltransferase	98.36
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.35
PLN02241		436	glucose-1-phosphate adenylyltransferase	98.35
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	98.34
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.34
PLN02739		355	serine acetyltransferase	98.33
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.33
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.32
PLN02357		360	serine acetyltransferase	98.32
PRK11132		273	cysE serine acetyltransferase; Provisional	98.3
PRK10191		146	putative acyl transferase; Provisional	98.29
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.29
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	98.28
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	98.27
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	98.27
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	98.26
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.26
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	98.24
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.23
PRK10092		183	maltose O-acetyltransferase; Provisional	98.22
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	98.21
PRK10191		146	putative acyl transferase; Provisional	98.2
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	98.2
PLN02739		355	serine acetyltransferase	98.2
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.2
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	98.17
PRK00576		178	molybdopterin-guanine dinucleotide biosynthesis pr	98.17
cd00897		300	UGPase_euk Eukaryotic UGPase catalyses the synthes	98.16
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	98.15
PF02348		217	CTP_transf_3: Cytidylyltransferase; InterPro: IPR0	98.15
PLN02830		615	UDP-sugar pyrophosphorylase	98.15
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.15
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	98.14
PF01704		420	UDPGP: UTP--glucose-1-phosphate uridylyltransferas	98.13
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.12
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.12
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.05
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.04
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.03
PRK10092		183	maltose O-acetyltransferase; Provisional	98.01
PLN02435		493	probable UDP-N-acetylglucosamine pyrophosphorylase	97.98
COG1861		241	SpsF Spore coat polysaccharide biosynthesis protei	97.97
cd06424		315	UGGPase UGGPase catalyzes the synthesis of UDP-Glu	97.97
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	97.8
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	97.8
COG4284		472	UDP-glucose pyrophosphorylase [Carbohydrate transp	97.72
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	97.68
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	97.61
KOG2638		498	consensus UDP-glucose pyrophosphorylase [Carbohydr	97.58
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	97.54
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	97.47
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	97.31
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	97.25
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	97.22
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	97.04
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	96.99
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	96.85
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	96.82
COG4801		277	Predicted acyltransferase [General function predic	96.74
COG4801		277	Predicted acyltransferase [General function predic	96.71
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	95.79
cd00761		156	Glyco_tranf_GTA_type Glycosyltransferase family A	95.16
TIGR03552		195	F420_cofC 2-phospho-L-lactate guanylyltransferase	94.6
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	94.22
KOG2388		477	consensus UDP-N-acetylglucosamine pyrophosphorylas	93.48
PF00535		169	Glycos_transf_2: Glycosyl transferase family 2; In	93.37
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	88.94
cd04186		166	GT_2_like_c Subfamily of Glycosyltransferase Famil	88.54
cd06423		180	CESA_like CESA_like is the cellulose synthase supe	85.26
cd04179		185	DPM_DPG-synthase_like DPM_DPG-synthase_like is a m	84.31
cd06434		235	GT2_HAS Hyaluronan synthases catalyze polymerizati	83.87
cd04188		211	DPG_synthase DPG_synthase is involved in protein N	82.17
cd02525		249	Succinoglycan_BP_ExoA ExoA is involved in the bios	81.85
cd06439		251	CESA_like_1 CESA_like_1 is a member of the cellulo	80.98

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

Probab=100.00  E-value=2e-71  Score=542.57  Aligned_cols=361  Identities=43%  Similarity=0.721  Sum_probs=329.9

Q ss_pred             CceEEEEEcCCCCccccCccCCCCccceeeCCcchhHHHHHHHHHhcCCcEEEEEeccChhHHHHHhhhcccCCCCcccC
Q 043870           91 KAVASIILGGGAGTRLFPLTGRRAKPAVPIGGCYRLIDVPMSNCINSGIKKIYILTQFNSQSLNRHISRTYNLGDGMNFG  170 (526)
Q Consensus        91 ~~~~aIILAaG~GtRl~Plt~~~pK~LlpV~g~~pLI~~~l~~l~~~gi~~I~Iv~~~~~~~l~~~l~~~~~~~~~~~~~  170 (526)
                      +.|+||||.||+||||+|||..+||||+|++++ |||+++|++|.++||++|++.++|+++++++|+.+.|..    +|+
T Consensus         8 ~~vkaiILvGG~GTRLrPLT~t~pKPlVpfgn~-pmI~hqieal~nsGi~~I~la~~y~s~sl~~~~~k~y~~----~lg   82 (371)
T KOG1322|consen    8 QSVKAIILVGGYGTRLRPLTLTRPKPLVPFGNK-PMILHQIEALINSGITKIVLATQYNSESLNRHLSKAYGK----ELG   82 (371)
T ss_pred             cceeEEEEecCCCceeeceeccCCCcccccCcc-hhhHHHHHHHHhCCCcEEEEEEecCcHHHHHHHHHHhhh----ccc
Confidence            789999999999999999999999999999977 999999999999999999999999999999999999833    344


Q ss_pred             CCeEEEEecccccCcCCCccccChHHHHHHHHHHhhhhccCCCCeEEEEcCCeecccCHHHHHHHHHHcCCcEEEEEEEc
Q 043870          171 DGFVEVLAATQRQGESGKKWFQGTADAVRQFIWMFEDAKHRNIENILILSGDHLYRMDYMDFVQHHINSGGDISVCCLPV  250 (526)
Q Consensus       171 ~~~v~vl~~~~~~~~~~~~~~~Gt~~al~~~~~~i~~~~~~~~e~~lil~gD~l~~~dl~~ll~~h~~~~ad~ti~~~~~  250 (526)
                         |+++...|++    +.|++|++++.|+.+|..++      .+|+||+||++|+++|++|+++|+++++++|+++.++
T Consensus        83 ---Vei~~s~ete----plgtaGpl~laR~~L~~~~~------~~ffVLnsDvi~~~p~~~~vqfH~~~gae~TI~~t~v  149 (371)
T KOG1322|consen   83 ---VEILASTETE----PLGTAGPLALARDFLWVFED------APFFVLNSDVICRMPYKEMVQFHRAHGAEITIVVTKV  149 (371)
T ss_pred             ---eEEEEEeccC----CCcccchHHHHHHHhhhcCC------CcEEEecCCeeecCCHHHHHHHHHhcCCceEEEEEec
Confidence               8999988875    78999999999999998874      4899999999999999999999999999999999999


Q ss_pred             cCCcCCCceEEEEcC-CCCeeeeeccCCccccccccccccccccchhhhcCCCceeeeeEEEEcHHHHHHHHHhhCCCCC
Q 043870          251 DESRASDFGLMKIDE-TGRIRQFLEKPKGENLRSMQIDTTALGLSAQEARNFPYIASMGIYLFKTEVLLKVLRWHYPEAN  329 (526)
Q Consensus       251 ~~~~~~~~g~v~~d~-~g~V~~~~eKp~~~~~~~~~~~~~~l~~s~~~~~~~~~l~~~Giyif~~~~l~~ll~~~~~~~~  329 (526)
                      ++  +++||++++|+ +|+|.+|.|||+..                     .++..++|+|+|++++|++++  .+|.  
T Consensus       150 de--pSkyGvv~~d~~~grV~~F~EKPkd~---------------------vsnkinaGiYi~~~~vL~ri~--~~pt--  202 (371)
T KOG1322|consen  150 DE--PSKYGVVVIDEDTGRVIRFVEKPKDL---------------------VSNKINAGIYILNPEVLDRIL--LRPT--  202 (371)
T ss_pred             cC--ccccceEEEecCCCceeEehhCchhh---------------------hhccccceEEEECHHHHhHhh--hccc--
Confidence            87  88999999998 89999999999943                     345567999999999998876  3454  


Q ss_pred             ChhhchHhhhhcCCcEEEEEecceeeecCChhhHHHhchhhcCCCCCcccCCCCCcccCCCCCCCCeeecCeeEeeeE--
Q 043870          330 DFGSEVIPMATKDFNVQAYLFNDYWEDIGTIKSFFDANLSLTDKPPKFHFYDPQKPIFTSPRFLPPSKIEKCRVQDSI--  407 (526)
Q Consensus       330 d~~~dil~~li~~~~V~~~~~~~~w~dIgt~~d~~~An~~ll~~~~~~~~~~~~~~i~~~~~~~~~~~i~~~~i~~s~--  407 (526)
                      +|++|++|.+++++++++|.++|||+|||+|+||+.+          +.||+.+.+.++++++.||+++.++++.|++  
T Consensus       203 SiekEifP~~a~~~~l~a~~l~gfWmDIGqpkdf~~g----------~~~Yl~s~~~~t~~r~~p~~~i~~nvlvd~~~~  272 (371)
T KOG1322|consen  203 SIEKEIFPAMAEEHQLYAFDLPGFWMDIGQPKDFLTG----------FSFYLRSLPKYTSPRLLPGSKIVGNVLVDSIAS  272 (371)
T ss_pred             chhhhhhhhhhhcCceEEEecCchhhhcCCHHHHHHH----------HHHHHhhCcccCCccccCCccccccEeeccccc
Confidence            4899999999999999999999999999999999999          5678888999999999999999999999955  


Q ss_pred             ECCCCEEcceeeeceEECCCcEECCCCEEeceEEECCcccchhHHHHHHhhCCCcceEECCCCEEeceEECCCCEECCCc
Q 043870          408 ISHGCFLRECSVEHSIVGIRSRLEYGVELKDTMMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNV  487 (526)
Q Consensus       408 Ig~~~~i~~~~v~~s~ig~~~~I~~~~~i~~~v~~~~~~~~~~~~~~~~~~~~~~~~~Ig~~~~i~~~iI~~~~~Ig~~~  487 (526)
                      +|++|.|++    +|+||++|+|++|++|.+|++|++++|+++++++++++++++|+++|.       +|+++|+||++|
T Consensus       273 iG~~C~Ig~----~vvIG~r~~i~~gV~l~~s~il~~~~~~~~s~i~s~ivg~~~~IG~~~-------~id~~a~lG~nV  341 (371)
T KOG1322|consen  273 IGENCSIGP----NVVIGPRVRIEDGVRLQDSTILGADYYETHSEISSSIVGWNVPIGIWA-------RIDKNAVLGKNV  341 (371)
T ss_pred             cCCccEECC----CceECCCcEecCceEEEeeEEEccceechhHHHHhhhccccccccCce-------EEecccEeccce
Confidence            456666665    799999999999999999999999999999999999999998877775       899999999999


Q ss_pred             EEccCCCcCCccccCCCeEEccCcEEECCCCEEC
Q 043870          488 IIANKDGVEEAERPSDGFYIRSGITVVLKNTTIK  521 (526)
Q Consensus       488 ~i~~~~~v~~~~~~~~~~~I~~g~~~i~~~~~i~  521 (526)
                      +|.|.+.+.+.    ++.++++++++|.++++|.
T Consensus       342 ~V~d~~~vn~g----~~l~~ks~~~~v~~~~iI~  371 (371)
T KOG1322|consen  342 IVADEDYVNEG----SGLPIKSGITVVLKPAIIM  371 (371)
T ss_pred             EEecccccccc----eeEEeccceeecccccccC
Confidence            99999888876    7899999999999999873

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit	Back alignment and domain information

>PRK10122 GalU regulator GalF; Provisional	Back alignment and domain information

>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional	Back alignment and domain information

>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose	Back alignment and domain information

>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	Back alignment and domain information

>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide	Back alignment and domain information

>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02917 CMP-KDO synthetase	Back alignment and domain information

>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase	Back alignment and domain information

>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed	Back alignment and domain information

>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family	Back alignment and domain information

>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional	Back alignment and domain information

>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional	Back alignment and domain information

>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety	Back alignment and domain information

>TIGR00454 conserved hypothetical protein TIGR00454	Back alignment and domain information

>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide	Back alignment and domain information

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed	Back alignment and domain information

>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>COG2068 Uncharacterized MobA-related protein [General function prediction only]	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>TIGR03584 PseF pseudaminic acid CMP-transferase	Back alignment and domain information

>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB	Back alignment and domain information

>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate []	Back alignment and domain information

>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism]	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat	Back alignment and domain information

>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site

Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc	Back alignment and domain information

>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PLN02474 UTP--glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2	Back alignment and domain information

>PLN02830 UDP-sugar pyrophosphorylase	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>KOG2638 consensus UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold	Back alignment and domain information

>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>KOG2388 consensus UDP-N-acetylglucosamine pyrophosphorylase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function	Back alignment and domain information

>cd06423 CESA_like CESA_like is the cellulose synthase superfamily	Back alignment and domain information

>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily	Back alignment and domain information

>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan	Back alignment and domain information

>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation	Back alignment and domain information

>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan	Back alignment and domain information

>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		526
1yp2_A		451	Crystal Structure Of Potato Tuber Adp-Glucose Pyrop		1e-143
3brk_X		420	Crystal Structure Of Adp-Glucose Pyrophosphorylase		3e-52
1lvw_A		295	Crystal Structure Of Glucose-1-phosphate Thymidylyl		1e-04
3hl3_A		269	2.76 Angstrom Crystal Structure Of A Putative Gluco		2e-04
1mp3_A		292	L89t Variant Of S. Enterica Rmla Length = 292		7e-04

>pdb|1YP2|A Chain A, Crystal Structure Of Potato Tuber Adp-Glucose Pyrophosphorylase Length = 451