Citrus Sinensis ID: 043888

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370--
QQQQRTQGEKNKEKTDQMQSQNGDVAENSSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK
cHHHHHHHHHcHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHccccHHHHccccccccccHHHHHHHHHccccEEEEEccccccccccEEEEcccccccccHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccHHHHccccccc
ccHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHcccccHHHHHHHHcccccccccccccccccccccccEEEEEcccccEcccccccccccHHHHHHHHHcccEEEEEEcccccccccEEEEccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccEEEEccccHHHHHHHcccccccccccccccHHHcccccHcccccccccccccccccccccccccHHHHHHEEEEcccccccHHHHHcccccc
qqqqrtqgeknkeKTDQMqsqngdvaenssndgsyhyRMFNFfnrkfkirepeppldvKMAFMHFsqdglhmkpSEFRRFMVEhqgetgctLSRAEEIVNNIISSRHHITrftrnglnlddffhfllfdddingpiklevhndmtaplsnyfiytghnsyltgnqlssdcsevPIAKALQRGVRVIeldiwpnstredinvlhgrtlttpvSLINCLKsirdnafvsspypviitledhltpDLQAKAAEMITQIFGKmlyfpesnklaefpspeslkqriiistkppkeylekdhvsastklrdasfddastnssdlegydsdqdlddfeisdpksgsglrvapeykhlitihagkpkgtlkdglKVAADK
qqqqrtqgeknkektdqmqsqngdvaenssndgSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIEldiwpnstredinvlhgrtlttpVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAefpspeslkqRIIIstkppkeylekDHVSastklrdasfddastnssdlegydsdqdlDDFEISdpksgsglrvaPEYKHLitihagkpkgtlkdglkvaadk
QQQQRTQGEKNKEKTDQMQSQNGDVAENSSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGlnlddffhfllfdddINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK
**********************************YHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPE*********************************************************************************EYKHLITIHA*****************
*QQQ*****KN***TDQM***************SYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIIS************LNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESN***EFPSPESLKQRIIIST****************************************************************LITIHAGKPKGT****L******
****************************SSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK
*QQ*RTQGEKNKEKTDQMQSQNGDVAENSSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKD*********************************************LRVAPEYKHLITIHAGKPKGTLKDGLK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QQQQRTQGEKNKEKTDQMQSQNGDVAENSSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query372 2.2.26 [Sep-21-2011]
Q8GV43 613 Phosphoinositide phosphol yes no 0.905 0.549 0.583 1e-110
Q944C1 597 Phosphoinositide phosphol no no 0.919 0.572 0.508 1e-91
Q944C2 578 Phosphoinositide phosphol no no 0.865 0.557 0.507 9e-90
Q39033 581 Phosphoinositide phosphol no no 0.873 0.559 0.507 6e-85
Q9LY51 584 Phosphoinositide phosphol no no 0.865 0.551 0.502 3e-79
Q39032 561 Phosphoinositide phosphol no no 0.795 0.527 0.444 1e-65
Q56W08 564 Phosphoinositide phosphol no no 0.806 0.531 0.426 2e-61
Q9STZ3 531 Phosphoinositide phosphol no no 0.682 0.478 0.362 3e-41
Q6NMA7 531 Phosphoinositide phosphol no no 0.771 0.540 0.326 2e-34
Q5RET0 762 1-phosphatidylinositol 4, yes no 0.680 0.332 0.315 5e-33
>sp|Q8GV43|PLCD6_ARATH Phosphoinositide phospholipase C 6 OS=Arabidopsis thaliana GN=PLC6 PE=2 SV=2 Back     alignment and function desciption
 Score =  400 bits (1027), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 220/377 (58%), Positives = 262/377 (69%), Gaps = 40/377 (10%)

Query: 26  AENSSND-GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLH------------- 71
            E+ +ND GSY+YRMF F+NRKFKI E  P  DV+ AF  F+  G               
Sbjct: 7   TESYNNDSGSYNYRMFKFYNRKFKINEVTPTDDVRDAFCQFAVGGGGGGTDGDSSDGDGS 66

Query: 72  ---MKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLF 128
              M   +   F+ +H GE+  T++ A+ +++ +I  RHH+TRFTR+GL+LDDFF+FL +
Sbjct: 67  TGVMGAEQLCSFLDDH-GES-TTVAEAQRLIDEVIRRRHHVTRFTRHGLDLDDFFNFLFY 124

Query: 129 DDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIEL 188
           DD +N PI   VH DMTAPLS+YFIYTGHNSYLTGNQLSSDCSEVP+ KALQRGVRVIEL
Sbjct: 125 DD-LNPPITPHVHQDMTAPLSHYFIYTGHNSYLTGNQLSSDCSEVPVIKALQRGVRVIEL 183

Query: 189 DIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKA 248
           D+WPNST  DINVLHGRTLTTPV L+ CLKSIRD AF SSPYPVIITLEDHLTPDLQAK 
Sbjct: 184 DLWPNSTGTDINVLHGRTLTTPVPLMKCLKSIRDYAFSSSPYPVIITLEDHLTPDLQAKV 243

Query: 249 AEMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEK---------DHVSA 299
           AEM TQIFG+MLY+PES+ L EFPSP SL  RIIISTKPPKEYLE          ++VS 
Sbjct: 244 AEMATQIFGQMLYYPESDSLLEFPSPASLLHRIIISTKPPKEYLESRNPIVKQKDNNVSP 303

Query: 300 STKLRDASFDDASTNSSDLEGYD----SDQDLDDFEISDPKSGSGLRVAPEYKHLITIHA 355
           S++      ++  T  S L   D    SD D +D E S+ +        P YK LITIHA
Sbjct: 304 SSEDETPRTEEIQTLESMLFDQDFESKSDSDQEDEEASEDQK-------PAYKRLITIHA 356

Query: 356 GKPKGTLKDGLKVAADK 372
           GKPKGT+K+ +KV  DK
Sbjct: 357 GKPKGTVKEEMKVVVDK 373
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 4EC: .EC: 1EC: 1
>sp|Q944C1|PLCD4_ARATH Phosphoinositide phospholipase C 4 OS=Arabidopsis thaliana GN=PLC4 PE=2 SV=2 Back     alignment and function description
>sp|Q944C2|PLCD5_ARATH Phosphoinositide phospholipase C 5 OS=Arabidopsis thaliana GN=PLC5 PE=2 SV=2 Back     alignment and function description
>sp|Q39033|PLCD2_ARATH Phosphoinositide phospholipase C 2 OS=Arabidopsis thaliana GN=PLC2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LY51|PLCD7_ARATH Phosphoinositide phospholipase C 7 OS=Arabidopsis thaliana GN=PLC7 PE=1 SV=1 Back     alignment and function description
>sp|Q39032|PLCD1_ARATH Phosphoinositide phospholipase C 1 OS=Arabidopsis thaliana GN=PLC1 PE=2 SV=1 Back     alignment and function description
>sp|Q56W08|PLCD3_ARATH Phosphoinositide phospholipase C 3 OS=Arabidopsis thaliana GN=PLC3 PE=2 SV=1 Back     alignment and function description
>sp|Q9STZ3|PLCD8_ARATH Phosphoinositide phospholipase C 8 OS=Arabidopsis thaliana GN=PLC8 PE=2 SV=1 Back     alignment and function description
>sp|Q6NMA7|PLCD9_ARATH Phosphoinositide phospholipase C 9 OS=Arabidopsis thaliana GN=PLC9 PE=2 SV=1 Back     alignment and function description
>sp|Q5RET0|PLCD4_PONAB 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Pongo abelii GN=PLCD4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query372
224098604 590 predicted protein [Populus trichocarpa] 0.911 0.574 0.662 1e-125
224112505 571 predicted protein [Populus trichocarpa] 0.876 0.570 0.648 1e-123
255585956 601 1-phosphatidylinositol-4,5-bisphosphate 0.908 0.562 0.658 1e-122
297823927 618 phosphoinositide-specific phospholipase 0.911 0.548 0.581 1e-112
42570393 613 phosphoinositide phospholipase C 6 [Arab 0.905 0.549 0.583 1e-109
359478841 559 PREDICTED: phosphoinositide phospholipas 0.884 0.588 0.571 1e-108
225434580 588 PREDICTED: phosphoinositide phospholipas 0.884 0.559 0.571 1e-108
359478837 557 PREDICTED: phosphoinositide phospholipas 0.844 0.563 0.589 1e-107
359478839 583 PREDICTED: phosphoinositide phospholipas 0.892 0.569 0.584 1e-107
359486407 591 PREDICTED: phosphoinositide phospholipas 0.908 0.571 0.571 1e-106
>gi|224098604|ref|XP_002311222.1| predicted protein [Populus trichocarpa] gi|222851042|gb|EEE88589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/350 (66%), Positives = 270/350 (77%), Gaps = 11/350 (3%)

Query: 33  GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTL 92
           GSY+Y+MFN FNRKFKI E EPP DVK  F  FS  G HM   + RRF+V HQ E  CTL
Sbjct: 2   GSYNYKMFNLFNRKFKITEAEPPKDVKQLFSKFSNGGSHMTADQLRRFLVLHQDELDCTL 61

Query: 93  SRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYF 152
           + A++IV  +I+ RHH+TR++R+ LNLDDFFHFLL+DD +NGPI  +VHNDMTAPL+ YF
Sbjct: 62  ADAQKIVEEVINRRHHLTRYSRHSLNLDDFFHFLLYDD-LNGPITSQVHNDMTAPLAQYF 120

Query: 153 IYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVS 212
           IYTGHNSYLTGNQLSSDCSEVPI KALQRGVRVIELD+WP S +++I VLHGRTLTTPV 
Sbjct: 121 IYTGHNSYLTGNQLSSDCSEVPIVKALQRGVRVIELDLWPGSAKDEILVLHGRTLTTPVP 180

Query: 213 LINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFP 272
           LI CLKSIRD AF SSPYPVIITLEDHLTP+LQAK AEM+TQ FG MLY+PES+ L +FP
Sbjct: 181 LIKCLKSIRDYAFASSPYPVIITLEDHLTPELQAKVAEMVTQTFGGMLYYPESDSLLQFP 240

Query: 273 SPESLKQRIIISTKPPKEYLEKDHVSASTKL----RDASFDD-----ASTNSSDLEG-YD 322
           SPESLK RIIISTKPPKEYLE   +     L    R++S +D        ++++LE    
Sbjct: 241 SPESLKHRIIISTKPPKEYLESSGIKRKGPLSPGGRNSSEEDDEASGIPCHTAELEADDR 300

Query: 323 SDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK 372
           SD D DD +++D  + SG   AP YK LITIHAGKPKG LKD LKVAADK
Sbjct: 301 SDSDQDDVDLTDCDNKSGQLGAPAYKRLITIHAGKPKGCLKDALKVAADK 350

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112505|ref|XP_002316213.1| predicted protein [Populus trichocarpa] gi|222865253|gb|EEF02384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585956|ref|XP_002533649.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Ricinus communis] gi|223526462|gb|EEF28737.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297823927|ref|XP_002879846.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis lyrata subsp. lyrata] gi|297325685|gb|EFH56105.1| phosphoinositide-specific phospholipase C family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42570393|ref|NP_850327.2| phosphoinositide phospholipase C 6 [Arabidopsis thaliana] gi|172045743|sp|Q8GV43.2|PLCD6_ARATH RecName: Full=Phosphoinositide phospholipase C 6; AltName: Full=Phosphoinositide phospholipase PLC6; Short=AtPLC6; Short=AtPLC8; Short=PI-PLC6 gi|330254689|gb|AEC09783.1| phosphoinositide phospholipase C 6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359478841|ref|XP_003632177.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform 4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225434580|ref|XP_002278527.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478837|ref|XP_003632175.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478839|ref|XP_003632176.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486407|ref|XP_002271986.2| PREDICTED: phosphoinositide phospholipase C 6 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query372
TAIR|locus:504956034 613 AT2G40116 [Arabidopsis thalian 0.922 0.559 0.563 3.7e-96
TAIR|locus:2178848 597 PLC4 "phosphatidylinositol-spe 0.919 0.572 0.488 1.2e-79
TAIR|locus:2103437 581 PLC2 "phospholipase C 2" [Arab 0.862 0.552 0.492 1e-77
TAIR|locus:2082018 584 AT3G55940 [Arabidopsis thalian 0.879 0.559 0.495 8.1e-76
TAIR|locus:2178833 578 PLC5 "phosphatidylinositol-spe 0.876 0.564 0.480 8.1e-76
TAIR|locus:2121239 564 PLC1 "phospholipase C1" [Arabi 0.819 0.540 0.408 1.8e-55
TAIR|locus:2178803 561 PLC1 "phospholipase C1" [Arabi 0.739 0.490 0.441 2.3e-55
TAIR|locus:2099530 531 PLC8 "phosphatidylinositol-spe 0.548 0.384 0.412 2.8e-40
TAIR|locus:2075696 531 PLC9 "AT3G47220" [Arabidopsis 0.704 0.493 0.347 7.3e-36
ZFIN|ZDB-GENE-081222-2 769 plcd3b "phospholipase C, delta 0.771 0.373 0.327 3e-30
TAIR|locus:504956034 AT2G40116 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 956 (341.6 bits), Expect = 3.7e-96, P = 3.7e-96
 Identities = 208/369 (56%), Positives = 248/369 (67%)

Query:    27 ENSSND-GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHF------------SQDGLH-- 71
             E+ +ND GSY+YRMF F+NRKFKI E  P  DV+ AF  F            S DG    
Sbjct:     8 ESYNNDSGSYNYRMFKFYNRKFKINEVTPTDDVRDAFCQFAVGGGGGGTDGDSSDGDGST 67

Query:    72 --MKPSEFRRFMVEHQGETGCTLSRAEEIVNNIISSRHHITRFTRNGXXXXXXXXXXXXX 129
               M   +   F+ +H GE+  T++ A+ +++ +I  RHH+TRFTR+G             
Sbjct:    68 GVMGAEQLCSFLDDH-GES-TTVAEAQRLIDEVIRRRHHVTRFTRHGLDLDDFFNFLFYD 125

Query:   130 XXINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELD 189
               +N PI   VH DMTAPLS+YFIYTGHNSYLTGNQLSSDCSEVP+ KALQRGVRVIELD
Sbjct:   126 D-LNPPITPHVHQDMTAPLSHYFIYTGHNSYLTGNQLSSDCSEVPVIKALQRGVRVIELD 184

Query:   190 IWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAA 249
             +WPNST  DINVLHGRTLTTPV L+ CLKSIRD AF SSPYPVIITLEDHLTPDLQAK A
Sbjct:   185 LWPNSTGTDINVLHGRTLTTPVPLMKCLKSIRDYAFSSSPYPVIITLEDHLTPDLQAKVA 244

Query:   250 EMITQIFGKMLYFPESNKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDAS-- 307
             EM TQIFG+MLY+PES+ L EFPSP SL  RIIISTKPPKEYLE  +     K  + S  
Sbjct:   245 EMATQIFGQMLYYPESDSLLEFPSPASLLHRIIISTKPPKEYLESRNPIVKQKDNNVSPS 304

Query:   308 FDDASTNSSDLEGYDS---DQDLDDFEISDPKSGSGLR-VAPEYKHLITIHAGKPKGTLK 363
              +D +  + +++  +S   DQD +    SD +         P YK LITIHAGKPKGT+K
Sbjct:   305 SEDETPRTEEIQTLESMLFDQDFESKSDSDQEDEEASEDQKPAYKRLITIHAGKPKGTVK 364

Query:   364 DGLKVAADK 372
             + +KV  DK
Sbjct:   365 EEMKVVVDK 373
GO:0004435 "phosphatidylinositol phospholipase C activity" evidence=IEA;ISS
GO:0004629 "phospholipase C activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0008081 "phosphoric diester hydrolase activity" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA;ISS
TAIR|locus:2178848 PLC4 "phosphatidylinositol-speciwc phospholipase C4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2103437 PLC2 "phospholipase C 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082018 AT3G55940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178833 PLC5 "phosphatidylinositol-speciwc phospholipase C5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121239 PLC1 "phospholipase C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178803 PLC1 "phospholipase C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099530 PLC8 "phosphatidylinositol-speciwc phospholipase C8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075696 PLC9 "AT3G47220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081222-2 plcd3b "phospholipase C, delta 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.4.110.824
3rd Layer3.1.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_VIII000270
phosphoinositide phospholipase C (EC-3.1.4.11) (590 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_I1618
hypothetical protein (586 aa)
     •••0.915
fgenesh4_pm.C_LG_X000745
phosphoinositide phospholipase C (EC-3.1.4.11) (571 aa)
     •••0.915
eugene3.00101828
hypothetical protein (587 aa)
     •••0.914
eugene3.00080618
hypothetical protein (590 aa)
     •••0.914
fgenesh4_pg.C_LG_I001629
hypothetical protein (573 aa)
     •••0.913
gw1.IX.3737.1
hypothetical protein (573 aa)
     •••0.910
gw1.XVII.1286.1
hypothetical protein (419 aa)
     •  0.899
gw1.VII.2836.1
hypothetical protein (536 aa)
     •  0.899
gw1.V.5135.1
hypothetical protein (727 aa)
     •  0.899
gw1.IV.1202.1
hypothetical protein (226 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query372
PLN02952 599 PLN02952, PLN02952, phosphoinositide phospholipase 1e-176
PLN02222 581 PLN02222, PLN02222, phosphoinositide phospholipase 1e-110
PLN02230 598 PLN02230, PLN02230, phosphoinositide phospholipase 1e-110
PLN02228 567 PLN02228, PLN02228, Phosphoinositide phospholipase 5e-88
cd08599228 cd08599, PI-PLCc_plant, Catalytic domain of plant 7e-85
cd08558226 cd08558, PI-PLCc_eukaryota, Catalytic domain of eu 2e-67
pfam00388145 pfam00388, PI-PLC-X, Phosphatidylinositol-specific 4e-67
smart00148143 smart00148, PLCXc, Phospholipase C, catalytic doma 5e-53
cd08598231 cd08598, PI-PLC1c_yeast, Catalytic domain of putat 1e-46
PLN02223 537 PLN02223, PLN02223, phosphoinositide phospholipase 2e-46
cd08597260 cd08597, PI-PLCc_PRIP_metazoa, Catalytic domain of 3e-38
cd08593257 cd08593, PI-PLCc_delta, Catalytic domain of metazo 4e-37
cd08592229 cd08592, PI-PLCc_gamma, Catalytic domain of metazo 5e-37
cd08594227 cd08594, PI-PLCc_eta, Catalytic domain of metazoan 6e-35
cd08591257 cd08591, PI-PLCc_beta, Catalytic domain of metazoa 2e-33
cd08629258 cd08629, PI-PLCc_delta1, Catalytic domain of metaz 5e-32
cd08630258 cd08630, PI-PLCc_delta3, Catalytic domain of metaz 6e-32
cd08596254 cd08596, PI-PLCc_epsilon, Catalytic domain of meta 3e-29
cd08628254 cd08628, PI-PLCc_gamma2, Catalytic domain of metaz 4e-29
cd08627229 cd08627, PI-PLCc_gamma1, Catalytic domain of metaz 6e-29
cd08626257 cd08626, PI-PLCc_beta4, Catalytic domain of metazo 8e-29
cd08633254 cd08633, PI-PLCc_eta2, Catalytic domain of metazoa 3e-28
cd08632253 cd08632, PI-PLCc_eta1, Catalytic domain of metazoa 5e-27
cd08595257 cd08595, PI-PLCc_zeta, Catalytic domain of metazoa 1e-26
cd08625258 cd08625, PI-PLCc_beta3, Catalytic domain of metazo 9e-26
cd08624261 cd08624, PI-PLCc_beta2, Catalytic domain of metazo 2e-25
cd08631258 cd08631, PI-PLCc_delta4, Catalytic domain of metaz 2e-25
cd08623258 cd08623, PI-PLCc_beta1, Catalytic domain of metazo 7e-25
cd00137274 cd00137, PI-PLCc, Catalytic domain of prokaryotic 1e-19
cd08557271 cd08557, PI-PLCc_bacteria_like, Catalytic domain o 3e-11
pfam0927983 pfam09279, efhand_like, Phosphoinositide-specific 4e-11
cd08555179 cd08555, PI-PLCc_GDPD_SF, Catalytic domain of phos 1e-08
cd08588270 cd08588, PI-PLCc_At5g67130_like, Catalytic domain 8e-05
>gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C Back     alignment and domain information 
 Score =  502 bits (1294), Expect = e-176
 Identities = 232/348 (66%), Positives = 263/348 (75%), Gaps = 11/348 (3%)

Query: 33  GSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGCTL 92
           GSY+Y+MFN FNRKFKI E EPP DVK  F  FS  G HM   + RRF+V HQ E  CTL
Sbjct: 15  GSYNYKMFNLFNRKFKITEAEPPDDVKDVFCKFSVGGGHMGADQLRRFLVLHQDELDCTL 74

Query: 93  SRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYF 152
           + A+ IV  +I+ RHH+TR+TR+GLNLDDFFHFLL+DD +NGPI  +VH+DMTAPLS+YF
Sbjct: 75  AEAQRIVEEVINRRHHVTRYTRHGLNLDDFFHFLLYDD-LNGPITPQVHHDMTAPLSHYF 133

Query: 153 IYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVS 212
           IYTGHNSYLTGNQLSSDCSEVPI KALQRGVRVIELD+WP ST+++I VLHGRTLTTPV 
Sbjct: 134 IYTGHNSYLTGNQLSSDCSEVPIVKALQRGVRVIELDLWPGSTKDEILVLHGRTLTTPVP 193

Query: 213 LINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLAEFP 272
           LI CLKSIRD AF SSPYPVIITLEDHLTPDLQAK AEM TQIFG+MLY+PES+ L +FP
Sbjct: 194 LIKCLKSIRDYAFSSSPYPVIITLEDHLTPDLQAKVAEMATQIFGQMLYYPESDSLVQFP 253

Query: 273 SPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSD-------LEGYDSDQ 325
           SPESLK RIIISTKPPKEYLE          +  +   +  NSS+       LE    +Q
Sbjct: 254 SPESLKHRIIISTKPPKEYLESS--GPIVIKKKNNVSPSGRNSSEETEEAQTLESMLFEQ 311

Query: 326 DLDDFEISDPKSG-SGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK 372
           + D    SD     SG    P YK LITIHAGKPKGTLKD +KVA DK
Sbjct: 312 EADSRSDSDQDDNKSGELQKPAYKRLITIHAGKPKGTLKDAMKVAVDK 359

Length = 599
>gnl|CDD|177868 PLN02222, PLN02222, phosphoinositide phospholipase C 2 Back     alignment and domain information
>gnl|CDD|177875 PLN02230, PLN02230, phosphoinositide phospholipase C 4 Back     alignment and domain information
>gnl|CDD|177873 PLN02228, PLN02228, Phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|176541 cd08599, PI-PLCc_plant, Catalytic domain of plant phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>gnl|CDD|176501 cd08558, PI-PLCc_eukaryota, Catalytic domain of eukaryotic phosphoinositide-specific phospholipase C and similar proteins Back     alignment and domain information
>gnl|CDD|215892 pfam00388, PI-PLC-X, Phosphatidylinositol-specific phospholipase C, X domain Back     alignment and domain information
>gnl|CDD|197543 smart00148, PLCXc, Phospholipase C, catalytic domain (part); domain X Back     alignment and domain information
>gnl|CDD|176540 cd08598, PI-PLC1c_yeast, Catalytic domain of putative yeast phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>gnl|CDD|165867 PLN02223, PLN02223, phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|176539 cd08597, PI-PLCc_PRIP_metazoa, Catalytic domain of metazoan phospholipase C related, but catalytically inactive protein Back     alignment and domain information
>gnl|CDD|176535 cd08593, PI-PLCc_delta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta Back     alignment and domain information
>gnl|CDD|176534 cd08592, PI-PLCc_gamma, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma Back     alignment and domain information
>gnl|CDD|176536 cd08594, PI-PLCc_eta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta Back     alignment and domain information
>gnl|CDD|176533 cd08591, PI-PLCc_beta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta Back     alignment and domain information
>gnl|CDD|176566 cd08629, PI-PLCc_delta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta1 Back     alignment and domain information
>gnl|CDD|176567 cd08630, PI-PLCc_delta3, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta3 Back     alignment and domain information
>gnl|CDD|176538 cd08596, PI-PLCc_epsilon, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-epsilon Back     alignment and domain information
>gnl|CDD|176565 cd08628, PI-PLCc_gamma2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma2 Back     alignment and domain information
>gnl|CDD|176564 cd08627, PI-PLCc_gamma1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma1 Back     alignment and domain information
>gnl|CDD|176563 cd08626, PI-PLCc_beta4, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta4 Back     alignment and domain information
>gnl|CDD|176570 cd08633, PI-PLCc_eta2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2 Back     alignment and domain information
>gnl|CDD|176569 cd08632, PI-PLCc_eta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1 Back     alignment and domain information
>gnl|CDD|176537 cd08595, PI-PLCc_zeta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-zeta Back     alignment and domain information
>gnl|CDD|176562 cd08625, PI-PLCc_beta3, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta3 Back     alignment and domain information
>gnl|CDD|176561 cd08624, PI-PLCc_beta2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta2 Back     alignment and domain information
>gnl|CDD|176568 cd08631, PI-PLCc_delta4, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4 Back     alignment and domain information
>gnl|CDD|176560 cd08623, PI-PLCc_beta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta1 Back     alignment and domain information
>gnl|CDD|176497 cd00137, PI-PLCc, Catalytic domain of prokaryotic and eukaryotic phosphoinositide-specific phospholipase C Back     alignment and domain information
>gnl|CDD|176500 cd08557, PI-PLCc_bacteria_like, Catalytic domain of bacterial phosphatidylinositol-specific phospholipase C and similar proteins Back     alignment and domain information
>gnl|CDD|150071 pfam09279, efhand_like, Phosphoinositide-specific phospholipase C, efhand-like Back     alignment and domain information
>gnl|CDD|176498 cd08555, PI-PLCc_GDPD_SF, Catalytic domain of phosphoinositide-specific phospholipase C-like phosphodiesterases superfamily Back     alignment and domain information
>gnl|CDD|176530 cd08588, PI-PLCc_At5g67130_like, Catalytic domain of Arabidopsis thaliana PI-PLC X domain-containing protein At5g67130 and its uncharacterized homologs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 372
PLN02230 598 phosphoinositide phospholipase C 4 100.0
PLN02952 599 phosphoinositide phospholipase C 100.0
PLN02222 581 phosphoinositide phospholipase C 2 100.0
PLN02223 537 phosphoinositide phospholipase C 100.0
KOG0169 746 consensus Phosphoinositide-specific phospholipase 100.0
PLN02228 567 Phosphoinositide phospholipase C 100.0
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 100.0
cd08633254 PI-PLCc_eta2 Catalytic domain of metazoan phosphoi 100.0
cd08632253 PI-PLCc_eta1 Catalytic domain of metazoan phosphoi 100.0
cd08629258 PI-PLCc_delta1 Catalytic domain of metazoan phosph 100.0
cd08594227 PI-PLCc_eta Catalytic domain of metazoan phosphoin 100.0
cd08630258 PI-PLCc_delta3 Catalytic domain of metazoan phosph 100.0
cd08596254 PI-PLCc_epsilon Catalytic domain of metazoan phosp 100.0
cd08626257 PI-PLCc_beta4 Catalytic domain of metazoan phospho 100.0
cd08595257 PI-PLCc_zeta Catalytic domain of metazoan phosphoi 100.0
cd08631258 PI-PLCc_delta4 Catalytic domain of metazoan phosph 100.0
cd08624261 PI-PLCc_beta2 Catalytic domain of metazoan phospho 100.0
cd08591257 PI-PLCc_beta Catalytic domain of metazoan phosphoi 100.0
cd08593257 PI-PLCc_delta Catalytic domain of metazoan phospho 100.0
cd08623258 PI-PLCc_beta1 Catalytic domain of metazoan phospho 100.0
cd08627229 PI-PLCc_gamma1 Catalytic domain of metazoan phosph 100.0
cd08558226 PI-PLCc_eukaryota Catalytic domain of eukaryotic p 100.0
cd08598231 PI-PLC1c_yeast Catalytic domain of putative yeast 100.0
cd08625258 PI-PLCc_beta3 Catalytic domain of metazoan phospho 100.0
cd08628254 PI-PLCc_gamma2 Catalytic domain of metazoan phosph 100.0
cd08599228 PI-PLCc_plant Catalytic domain of plant phosphatid 100.0
KOG1264 1267 consensus Phospholipase C [Lipid transport and met 100.0
cd08592229 PI-PLCc_gamma Catalytic domain of metazoan phospho 100.0
cd08597260 PI-PLCc_PRIP_metazoa Catalytic domain of metazoan 100.0
cd00137274 PI-PLCc Catalytic domain of prokaryotic and eukary 100.0
smart00148135 PLCXc Phospholipase C, catalytic domain (part); do 100.0
PF00388146 PI-PLC-X: Phosphatidylinositol-specific phospholip 100.0
cd08589324 PI-PLCc_SaPLC1_like Catalytic domain of Streptomyc 99.94
cd08590267 PI-PLCc_Rv2075c_like Catalytic domain of uncharact 99.82
cd08557271 PI-PLCc_bacteria_like Catalytic domain of bacteria 99.73
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 99.48
cd08555179 PI-PLCc_GDPD_SF Catalytic domain of phosphoinositi 99.28
cd08588270 PI-PLCc_At5g67130_like Catalytic domain of Arabido 99.07
cd08586279 PI-PLCc_BcPLC_like Catalytic domain of Bacillus ce 98.99
cd08622276 PI-PLCXDc_CG14945_like Catalytic domain of Drosoph 97.97
cd08587288 PI-PLCXDc_like Catalytic domain of phosphatidylino 97.95
cd08616290 PI-PLCXD1c Catalytic domain of phosphatidylinosito 97.67
cd08577228 PI-PLCc_GDPD_SF_unchar3 Uncharacterized hypothetic 96.76
cd08619285 PI-PLCXDc_plant Catalytic domain of phosphatidylin 96.7
cd08562229 GDPD_EcUgpQ_like Glycerophosphodiester phosphodies 96.66
cd08556189 GDPD Glycerophosphodiester phosphodiesterase domai 96.65
PF03009256 GDPD: Glycerophosphoryl diester phosphodiesterase 96.62
cd08582233 GDPD_like_2 Glycerophosphodiester phosphodiesteras 96.56
cd08620281 PI-PLCXDc_like_1 Catalytic domain of uncharacteriz 96.49
cd08579220 GDPD_memb_like Glycerophosphodiester phosphodieste 96.42
cd08563230 GDPD_TtGDE_like Glycerophosphodiester phosphodiest 96.16
cd08565235 GDPD_pAtGDE_like Glycerophosphodiester phosphodies 95.91
cd08567263 GDPD_SpGDE_like Glycerophosphodiester phosphodiest 95.8
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 95.73
cd08566240 GDPD_AtGDE_like Glycerophosphodiester phosphodiest 95.59
cd08568226 GDPD_TmGDE_like Glycerophosphodiester phosphodiest 95.25
cd08564265 GDPD_GsGDE_like Glycerophosphodiester phosphodiest 95.11
cd08581229 GDPD_like_1 Glycerophosphodiester phosphodiesteras 95.11
PTZ00184149 calmodulin; Provisional 94.98
cd08584192 PI-PLCc_GDPD_SF_unchar2 Uncharacterized hypothetic 94.66
PTZ00183158 centrin; Provisional 94.55
cd08575264 GDPD_GDE4_like Glycerophosphodiester phosphodieste 94.15
cd08561249 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodieste 93.94
cd08601256 GDPD_SaGlpQ_like Glycerophosphodiester phosphodies 93.84
PTZ00268380 glycosylphosphatidylinositol-specific phospholipas 93.75
cd08574252 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodieste 93.73
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 93.24
cd08607290 GDPD_GDE5 Glycerophosphodiester phosphodiesterase 93.1
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 93.05
cd08612300 GDPD_GDE4 Glycerophosphodiester phosphodiesterase 92.99
PRK11143 355 glpQ glycerophosphodiester phosphodiesterase; Prov 92.66
cd08580263 GDPD_Rv2277c_like Glycerophosphodiester phosphodie 92.63
cd08600 318 GDPD_EcGlpQ_like Glycerophosphodiester phosphodies 92.62
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.5
cd08605282 GDPD_GDE5_like_1_plant Glycerophosphodiester phosp 92.5
cd08573258 GDPD_GDE1 Glycerophosphodiester phosphodiesterase 92.32
cd08571302 GDPD_SHV3_plant Glycerophosphodiester phosphodiest 91.85
PTZ00184149 calmodulin; Provisional 91.8
cd08559296 GDPD_periplasmic_GlpQ_like Periplasmic glycerophos 91.79
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 91.72
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 91.7
cd08583237 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetic 91.61
cd08570234 GDPD_YPL206cp_fungi Glycerophosphodiester phosphod 91.4
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 91.28
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 91.24
cd08606286 GDPD_YPL110cp_fungi Glycerophosphodiester phosphod 91.22
cd08609315 GDPD_GDE3 Glycerophosphodiester phosphodiesterase 91.12
cd08602309 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodie 90.88
PRK09454249 ugpQ cytoplasmic glycerophosphodiester phosphodies 90.81
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 90.58
cd08604300 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodi 90.3
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 90.3
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 89.45
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 89.36
cd08621300 PI-PLCXDc_like_2 Catalytic domain of uncharacteriz 89.31
cd08572293 GDPD_GDE5_like Glycerophosphodiester phosphodieste 89.3
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 89.28
cd08610316 GDPD_GDE6 Glycerophosphodiester phosphodiesterase 88.37
PTZ00183158 centrin; Provisional 87.96
cd0021388 S-100 S-100: S-100 domain, which represents the la 87.23
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 86.88
KOG4306306 consensus Glycosylphosphatidylinositol-specific ph 86.19
cd08585237 GDPD_like_3 Glycerophosphodiester phosphodiesteras 85.95
COG0584257 UgpQ Glycerophosphoryl diester phosphodiesterase [ 85.23
cd0005267 EH Eps15 homology domain; found in proteins implic 84.82
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 84.81
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 84.73
cd08578300 GDPD_NUC-2_fungi Putative glycerophosphodiester ph 84.71
cd08560 356 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodi 84.54
cd08613309 GDPD_GDE4_like_1 Glycerophosphodiester phosphodies 84.53
cd08608 351 GDPD_GDE2 Glycerophosphodiester phosphodiesterase 84.35
PF11422181 IBP39: Initiator binding protein 39 kDa; InterPro: 83.76
KOG2258341 consensus Glycerophosphoryl diester phosphodiester 83.31
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 82.55
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 82.49
PF0102344 S_100: S-100/ICaBP type calcium binding domain; In 81.59
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information 
Probab=100.00  E-value=3.9e-96  Score=764.26  Aligned_cols=337  Identities=51%  Similarity=0.837  Sum_probs=287.6

Q ss_pred             CccccccccccccccccccCCCCCchHHHHHHHHhcCCCCCcCHHHHHHHHHHHhCCC-CCCHHHHHHHHHHHhhccccc
Q 043888           31 NDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGET-GCTLSRAEEIVNNIISSRHHI  109 (372)
Q Consensus        31 ~~~ty~Y~~~~~f~r~~~~~~~~~~~ei~~lF~~ys~~~~~mt~~~l~~FL~~~Q~e~-~~t~~~a~~Ii~~~~~~~~~~  109 (372)
                      .||+|  ++|+||.|+|+.+.++||+||+.||.+|++++++||+++|.+||+++|++. ..+.+.|++||+++++...++
T Consensus         6 ~m~~~--~~~~~~~~~~~~~~~~p~~ei~~lf~~~s~~~~~mt~~~l~~FL~~~Q~~~~~~~~~~~~~i~~~~~~~~~~~   83 (598)
T PLN02230          6 EMGSY--KFCLIFTRKFRMTESGPVADVRDLFEKYADGDAHMSPEQLQKLMAEEGGGEGETSLEEAERIVDEVLRRKHHI   83 (598)
T ss_pred             CCccc--eEEEEecCccccccCCCcHHHHHHHHHHhCCCCccCHHHHHHHHHHhCCCcccCCHHHHHHHHHHHHhhcccc
Confidence            37766  999999999999999999999999999998778999999999999999754 567899999999998654444


Q ss_pred             ccccCCCCCHHHHHHhhhcCCCCCCccccccccCCCCCccccccccCCcccccCCCCCCCCCHHHHHHHHhcCCcEEEEE
Q 043888          110 TRFTRNGLNLDDFFHFLLFDDDINGPIKLEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELD  189 (372)
Q Consensus       110 ~~~~~~~Ltld~F~~yL~~S~d~N~p~~~~v~qDMt~PLShYFIsSSHNTYLtG~QL~g~SS~e~Yi~AL~~GCRcIELD  189 (372)
                      ..+.+..|+++||++|| +|.+.|+|.+..|||||++|||||||+||||||||||||+|.||+++|++||++||||||||
T Consensus        84 ~~~~~~~~~~~~F~~yL-~s~~~~~~~~~~v~qDM~~PLshYfI~sSHNTYL~g~Ql~~~ss~e~y~~aL~~GcRcvElD  162 (598)
T PLN02230         84 AKFTRRNLTLDDFNYYL-FSTDLNPPIADQVHQNMDAPLSHYFIFTGHNSYLTGNQLSSNCSELPIADALRRGVRVVELD  162 (598)
T ss_pred             ccccccccCHHHHHHHH-cCcccCCcccccccccCCCchhhheeecccCccccCCcccCccCHHHHHHHHHcCCcEEEEe
Confidence            55566789999999999 99888989988999999999999999999999999999999999999999999999999999


Q ss_pred             eecCCCCCCceEeeCCcccccchHHHHHHHHhhcccccCCCCeEEEeCCCCCHHHHHHHHHHHHHHhhcccCCCCCCCCC
Q 043888          190 IWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPESNKLA  269 (372)
Q Consensus       190 ~Wdg~~~~~p~V~HG~TlTs~i~f~~vl~aIk~~AF~~S~YPVILSLE~Hcs~~qQ~~mA~~l~~ifGd~L~~p~~~~~~  269 (372)
                      ||||++ ++|+|+||+|||++|+|++||+||++|||++|+||||||||+||+++||.+||+||+++|||+||.|+.+...
T Consensus       163 ~wdg~~-~ep~v~HG~t~t~~i~f~~v~~~I~~~aF~~s~yPvIlslE~hcs~~~Q~~~a~~~~~~~Gd~L~~~~~~~~~  241 (598)
T PLN02230        163 LWPRGT-DDVCVKHGRTLTKEVKLGKCLDSIKANAFAISKYPVIITLEDHLTPKLQFKVAKMITQTFGDMLYYHDSEGCQ  241 (598)
T ss_pred             ccCCCC-CCcEEeeCCCCcCCcCHHHHHHHHHHhccCCCCCCeEEEeccCCCHHHHHHHHHHHHHHHhhhhccCCCcccC
Confidence            999876 6799999999999999999999999999999999999999999999999999999999999999998877778


Q ss_pred             CCCChhhhcCCeEeecCCCCcccccccccc------ccccccccccccCCCCCCCCCC-------CCCCCCCccc-CCCC
Q 043888          270 EFPSPESLKQRIIISTKPPKEYLEKDHVSA------STKLRDASFDDASTNSSDLEGY-------DSDQDLDDFE-ISDP  335 (372)
Q Consensus       270 ~lPSPe~Lk~KILIk~K~pke~l~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~-~~~~  335 (372)
                      .||||++||||||||+|+|+++++++...+      ...+++++||++++++.....+       ..+-+.++.. .+..
T Consensus       242 ~lpsP~~Lk~kilik~Kk~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~  321 (598)
T PLN02230        242 EFPSPEELKEKILISTKPPKEYLEANDAKEKDNGEKGKDSDEDVWGKEPEDLISTQSDLDKVTSSVNDLNQDDEERGSCE  321 (598)
T ss_pred             CCCChHHHcCCEEEEecCCcccccccccccccccccccccchhhhccccccccccccccccccccccccccchhcccccc
Confidence            999999999999999999999998764321      1345566788876554422110       0000000000 0011


Q ss_pred             CCCCCCCCCcCCceeeEeecCCCCCchhcccccccC
Q 043888          336 KSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAAD  371 (372)
Q Consensus       336 ~~~~~~~~~~~y~~li~i~a~k~kg~l~~~l~~~~~  371 (372)
                      +.++.+..+|+|++||+|++|||+|++..+++.+|+
T Consensus       322 ~~~~~~~~~~els~Li~y~~~~~~~~~~~~~~~~~~  357 (598)
T PLN02230        322 SDTSCQLQAPEYKRLIAIHAGKPKGGLRMALKVDPN  357 (598)
T ss_pred             ccccchhcCHHHhhheeeecCccCCCcchhhhcCcc
Confidence            111345679999999999999999999999998875

>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08633 PI-PLCc_eta2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2 Back     alignment and domain information
>cd08632 PI-PLCc_eta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1 Back     alignment and domain information
>cd08629 PI-PLCc_delta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta1 Back     alignment and domain information
>cd08594 PI-PLCc_eta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta Back     alignment and domain information
>cd08630 PI-PLCc_delta3 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta3 Back     alignment and domain information
>cd08596 PI-PLCc_epsilon Catalytic domain of metazoan phosphoinositide-specific phospholipase C-epsilon Back     alignment and domain information
>cd08626 PI-PLCc_beta4 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta4 Back     alignment and domain information
>cd08595 PI-PLCc_zeta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-zeta Back     alignment and domain information
>cd08631 PI-PLCc_delta4 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4 Back     alignment and domain information
>cd08624 PI-PLCc_beta2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta2 Back     alignment and domain information
>cd08591 PI-PLCc_beta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta Back     alignment and domain information
>cd08593 PI-PLCc_delta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta Back     alignment and domain information
>cd08623 PI-PLCc_beta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta1 Back     alignment and domain information
>cd08627 PI-PLCc_gamma1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma1 Back     alignment and domain information
>cd08558 PI-PLCc_eukaryota Catalytic domain of eukaryotic phosphoinositide-specific phospholipase C and similar proteins Back     alignment and domain information
>cd08598 PI-PLC1c_yeast Catalytic domain of putative yeast phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>cd08625 PI-PLCc_beta3 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta3 Back     alignment and domain information
>cd08628 PI-PLCc_gamma2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma2 Back     alignment and domain information
>cd08599 PI-PLCc_plant Catalytic domain of plant phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>cd08592 PI-PLCc_gamma Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma Back     alignment and domain information
>cd08597 PI-PLCc_PRIP_metazoa Catalytic domain of metazoan phospholipase C related, but catalytically inactive protein Back     alignment and domain information
>cd00137 PI-PLCc Catalytic domain of prokaryotic and eukaryotic phosphoinositide-specific phospholipase C Back     alignment and domain information
>smart00148 PLCXc Phospholipase C, catalytic domain (part); domain X Back     alignment and domain information
>PF00388 PI-PLC-X: Phosphatidylinositol-specific phospholipase C, X domain This entry is for the whole phospholipase C protein; InterPro: IPR000909 Phosphatidylinositol-specific phospholipase C (3 Back     alignment and domain information
>cd08589 PI-PLCc_SaPLC1_like Catalytic domain of Streptomyces antibioticus phosphatidylinositol-specific phospholipase C1-like proteins Back     alignment and domain information
>cd08590 PI-PLCc_Rv2075c_like Catalytic domain of uncharacterized Mycobacterium tuberculosis Rv2075c-like proteins Back     alignment and domain information
>cd08557 PI-PLCc_bacteria_like Catalytic domain of bacterial phosphatidylinositol-specific phospholipase C and similar proteins Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>cd08555 PI-PLCc_GDPD_SF Catalytic domain of phosphoinositide-specific phospholipase C-like phosphodiesterases superfamily Back     alignment and domain information
>cd08588 PI-PLCc_At5g67130_like Catalytic domain of Arabidopsis thaliana PI-PLC X domain-containing protein At5g67130 and its uncharacterized homologs Back     alignment and domain information
>cd08586 PI-PLCc_BcPLC_like Catalytic domain of Bacillus cereus phosphatidylinositol-specific phospholipases C and similar proteins Back     alignment and domain information
>cd08622 PI-PLCXDc_CG14945_like Catalytic domain of Drosophila melanogaster CG14945-like proteins similar to phosphatidylinositol-specific phospholipase C, X domain containing Back     alignment and domain information
>cd08587 PI-PLCXDc_like Catalytic domain of phosphatidylinositol-specific phospholipase C X domain containing and similar proteins Back     alignment and domain information
>cd08616 PI-PLCXD1c Catalytic domain of phosphatidylinositol-specific phospholipase C, X domain containing 1 Back     alignment and domain information
>cd08577 PI-PLCc_GDPD_SF_unchar3 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08619 PI-PLCXDc_plant Catalytic domain of phosphatidylinositol-specific phospholipase C, X domain containing proteins found in plants Back     alignment and domain information
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins Back     alignment and domain information
>cd08556 GDPD Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins Back     alignment and domain information
>PF03009 GDPD: Glycerophosphoryl diester phosphodiesterase family; InterPro: IPR004129 Glycerophosphoryl diester phosphodiesterases display broad specificity for glycerophosphodiesters; glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol) all of which are are hydrolysed by this enzyme Back     alignment and domain information
>cd08582 GDPD_like_2 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08620 PI-PLCXDc_like_1 Catalytic domain of uncharacterized hypothetical proteins similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins Back     alignment and domain information
>cd08579 GDPD_memb_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08563 GDPD_TtGDE_like Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins Back     alignment and domain information
>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd08567 GDPD_SpGDE_like Glycerophosphodiester phosphodiesterase domain of putative Silicibacter pomeroyi glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd08566 GDPD_AtGDE_like Glycerophosphodiester phosphodiesterase domain of Agrobacterium tumefaciens and similar proteins Back     alignment and domain information
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins Back     alignment and domain information
>cd08564 GDPD_GsGDE_like Glycerophosphodiester phosphodiesterase domain of putative Galdieria sulphuraria glycerophosphodiester phosphodiesterase and similar proteins Back     alignment and domain information
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd08584 PI-PLCc_GDPD_SF_unchar2 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd08575 GDPD_GDE4_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4-like proteins Back     alignment and domain information
>cd08561 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins Back     alignment and domain information
>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins Back     alignment and domain information
>PTZ00268 glycosylphosphatidylinositol-specific phospholipase C; Provisional Back     alignment and domain information
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd08607 GDPD_GDE5 Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd08612 GDPD_GDE4 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4 and similar proteins Back     alignment and domain information
>PRK11143 glpQ glycerophosphodiester phosphodiesterase; Provisional Back     alignment and domain information
>cd08580 GDPD_Rv2277c_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins Back     alignment and domain information
>cd08600 GDPD_EcGlpQ_like Glycerophosphodiester phosphodiesterase domain of Escherichia coli (GlpQ) and similar proteins Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd08605 GDPD_GDE5_like_1_plant Glycerophosphodiester phosphodiesterase domain of uncharacterized plant glycerophosphodiester phosphodiesterase-like proteins similar to mammalian GDE5 Back     alignment and domain information
>cd08573 GDPD_GDE1 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE1 and similar proteins Back     alignment and domain information
>cd08571 GDPD_SHV3_plant Glycerophosphodiester phosphodiesterase domain of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd08559 GDPD_periplasmic_GlpQ_like Periplasmic glycerophosphodiester phosphodiesterase domain (GlpQ) and similar proteins Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases Back     alignment and domain information
>cd08570 GDPD_YPL206cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd08606 GDPD_YPL110cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins Back     alignment and domain information
>cd08609 GDPD_GDE3 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE3 and similar proteins Back     alignment and domain information
>cd08602 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodiesterase domain of Streptomycin coelicolor (GlpQ1) and similar proteins Back     alignment and domain information
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd08604 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodiesterase domain repeat 2 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd08621 PI-PLCXDc_like_2 Catalytic domain of uncharacterized hypothetical proteins similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins Back     alignment and domain information
>cd08572 GDPD_GDE5_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd08610 GDPD_GDE6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE6 and similar proteins Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4306 consensus Glycosylphosphatidylinositol-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>cd08585 GDPD_like_3 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases Back     alignment and domain information
>COG0584 UgpQ Glycerophosphoryl diester phosphodiesterase [Energy production and conversion] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>cd08578 GDPD_NUC-2_fungi Putative glycerophosphodiester phosphodiesterase domain of ankyrin repeat protein NUC-2 and similar proteins Back     alignment and domain information
>cd08560 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodiesterase domain similar to Escherichia coli periplasmic phosphodiesterase (GlpQ) include uncharacterized proteins Back     alignment and domain information
>cd08613 GDPD_GDE4_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial homologs of mammalian glycerophosphodiester phosphodiesterase GDE4 Back     alignment and domain information
>cd08608 GDPD_GDE2 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2 and similar proteins Back     alignment and domain information
>PF11422 IBP39: Initiator binding protein 39 kDa; InterPro: IPR024238 Initiator binding protein 39kDa (IBP39) recognises the initiator (Inr), which in Trichomonas vaginalis is solely responsible for transcription start site selection Back     alignment and domain information
>KOG2258 consensus Glycerophosphoryl diester phosphodiesterase [Energy production and conversion] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF01023 S_100: S-100/ICaBP type calcium binding domain; InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query372
4gnk_B 1235 Crystal Structure Of Galphaq In Complex With Full-l 7e-25
3ohm_B 885 Crystal Structure Of Activated G Alpha Q Bound To I 1e-24
2fju_B 799 Activated Rac1 Bound To Its Effector Phospholipase 1e-24
1djg_A 624 Phosphoinositide-Specific Phospholipase C-Delta1 Fr 3e-22
1qas_A 622 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodies 4e-22
3qr0_A 816 Crystal Structure Of S. Officinalis Plc21 Length = 6e-17
3qr1_A 813 Crystal Structure Of L. Pealei Plc21 Length = 813 7e-16
>pdb|4GNK|B Chain B, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 1235 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (277), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 88/156 (56%), Gaps = 7/156 (4%)
Query: 138 LEVHNDMTAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNS-TR 196
           L++  DMT PLS YFI + HN+YLT  QL+   S     +AL  G R +ELD+W      
Sbjct: 314 LDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRCVELDVWKGRPPE 373
Query: 197 EDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHL-TPDLQAKAAEMITQI 255
           E+  + HG T+TT V L + L++I + AF +SPYPVI++ E+H+ +   QAK AE    I
Sbjct: 374 EEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAKQQAKMAEYCRSI 433
Query: 256 FGKMLYFPESNKL-----AEFPSPESLKQRIIISTK 286
           FG  L     +K         PSP+ L  RI++  K
Sbjct: 434 FGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNK 469
>pdb|3OHM|B Chain B, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 885 Back     alignment and structure
>pdb|2FJU|B Chain B, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 799 Back     alignment and structure
>pdb|1DJG|A Chain A, Phosphoinositide-Specific Phospholipase C-Delta1 From Rat Complexed With Lanthanum Length = 624 Back     alignment and structure
>pdb|1QAS|A Chain A, 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodiesterase Delta 1 Length = 622 Back     alignment and structure
>pdb|3QR0|A Chain A, Crystal Structure Of S. Officinalis Plc21 Length = 816 Back     alignment and structure
>pdb|3QR1|A Chain A, Crystal Structure Of L. Pealei Plc21 Length = 813 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query372
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 1e-60
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 3e-55
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-52
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 4e-51
3h4x_A339 Phosphatidylinositol-specific phospholipase C1; PI 1e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure
 Score =  204 bits (520), Expect = 1e-60
 Identities = 81/346 (23%), Positives = 134/346 (38%), Gaps = 20/346 (5%)

Query: 29  SSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGET 88
            S   S        F +    R      ++  AF   +     +       F+   Q E 
Sbjct: 58  HSQTDSLEDEEIETFYKMLTQRA-----EIDRAFEEAAGSAETLSVERLVTFLQHQQREE 112

Query: 89  GCTLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDD-DINGPIKLEVHNDMTAP 147
               + A  ++          T   +  +  D F  +LL  D +        V+ DM  P
Sbjct: 113 EAGPALALSLIERY---EPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMDQP 169

Query: 148 LSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTL 207
           LS+Y + + HN+YL  +QL+   S     +AL +G R +ELD W    +E I + HG T 
Sbjct: 170 LSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPI-IYHGYTF 228

Query: 208 TTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLY-FPESN 266
           T+ +   + L++IRD AF +SPYPVI++LE+H + + Q   A  +  I G +L   P   
Sbjct: 229 TSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDG 288

Query: 267 KLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQD 326
                PSPE LK +I++  K     L     + S     +   +A+         + + +
Sbjct: 289 VTTSLPSPEQLKGKILLKGKKLGGLLPAGGENGSEATDVSDEVEAA---------EMEDE 339

Query: 327 LDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK 372
               ++        L++ PE   +I        G            
Sbjct: 340 AVRSQVQHKPKEDKLKLVPELSDMIIYCKSVHFGGFSSPGTSGQAF 385
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Length = 816 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Length = 885 Back     alignment and structure
>3h4x_A Phosphatidylinositol-specific phospholipase C1; PI-PLC, Ca2+-dependent, catalytic TIM barrel, disulfide-LINK loop, hydrolase; 1.23A {Streptomyces antibioticus} PDB: 3h4w_A Length = 339 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query372
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 100.0
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 100.0
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 100.0
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 100.0
3h4x_A339 Phosphatidylinositol-specific phospholipase C1; PI 99.97
2plc_A274 PI-PLC, phosphatidylinositol-specific phospholipas 99.09
3v1h_A306 1-phosphatidylinositol phosphodiesterase; PI-catio 97.79
3ea1_A298 1-phosphatidylinositol phosphodiesterase; phosphat 97.77
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 97.52
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 97.43
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 96.99
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 96.89
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.88
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 96.81
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 96.75
3no3_A238 Glycerophosphodiester phosphodiesterase; structura 96.74
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.64
2jnf_A158 Troponin C; stretch activated muscle contraction, 96.63
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 96.57
3qvq_A252 Phosphodiesterase OLEI02445; structural genomics, 96.56
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.56
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 96.55
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 96.55
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 96.5
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 96.44
1vd6_A224 Glycerophosphoryl diester phosphodiesterase; glyce 96.43
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 96.42
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 96.4
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.36
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 96.35
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 96.35
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 96.31
2o55_A258 Putative glycerophosphodiester phosphodiesterase; 96.3
1exr_A148 Calmodulin; high resolution, disorder, metal trans 96.27
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 96.26
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 96.26
2otd_A247 Glycerophosphodiester phosphodiesterase; structura 96.26
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 96.25
3ks6_A250 Glycerophosphoryl diester phosphodiesterase; struc 96.17
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 96.17
3fwb_A161 Cell division control protein 31; gene gating, com 96.17
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 96.14
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 96.11
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 96.04
1o1z_A234 GDPD, glycerophosphodiester phosphodiesterase; TM1 95.99
3i10_A278 Putative glycerophosphoryl diester phosphodiester; 95.99
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.98
1y1x_A191 Leishmania major homolog of programmed cell death 95.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.97
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 95.92
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.91
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 95.87
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 95.86
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 95.85
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 95.84
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 95.81
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 95.77
3ch0_A272 Glycerophosphodiester phosphodiesterase; YP_677622 95.75
2pz0_A252 Glycerophosphoryl diester phosphodiesterase; glyce 95.75
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 95.74
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 95.7
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 95.68
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 95.68
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 95.66
3akb_A166 Putative calcium binding protein; EF-hand, metal b 95.65
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 95.6
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 95.6
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.59
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 95.58
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 95.58
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 95.56
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 95.55
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.55
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 95.52
3mz2_A292 Glycerophosphoryl diester phosphodiesterase; struc 95.52
3l12_A313 Putative glycerophosphoryl diester phosphodiester; 95.46
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 95.46
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 95.45
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 95.44
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.38
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 95.38
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 95.36
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 95.29
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.29
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 95.26
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 95.23
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 95.22
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 95.2
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 95.16
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 95.13
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 95.04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 95.04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 94.93
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.93
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.93
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 94.9
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 94.89
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 94.87
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 94.85
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 94.79
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 94.78
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 94.7
3fwb_A161 Cell division control protein 31; gene gating, com 94.69
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 94.67
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 94.64
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 94.59
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 94.58
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 94.56
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.55
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 94.48
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 94.45
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 94.42
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 94.38
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 94.38
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.33
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 94.26
1zcc_A248 Glycerophosphodiester phosphodiesterase; NYSGXRC, 94.25
2jnf_A158 Troponin C; stretch activated muscle contraction, 94.18
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 94.09
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 94.01
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 93.95
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.86
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 93.82
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 93.8
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 93.79
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 93.71
2lv7_A100 Calcium-binding protein 7; metal binding protein; 93.63
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 93.59
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 93.42
3a4u_B143 Multiple coagulation factor deficiency protein 2; 93.34
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 93.3
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 93.3
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 93.29
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 93.13
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 93.11
1y1x_A191 Leishmania major homolog of programmed cell death 93.05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 92.95
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 92.94
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 92.89
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 92.84
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 92.82
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 92.79
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 92.77
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 92.72
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 92.61
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 92.56
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 92.54
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 92.46
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 92.45
1xx1_A285 Smase I, sphingomyelinase I; structure, quick cryo 92.37
1ydy_A 356 Glycerophosphoryl diester phosphodiesterase; struc 92.29
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 92.29
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 92.24
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 92.17
1avs_A90 Troponin C; muscle contraction, calcium-activated, 92.12
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 92.02
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 91.99
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 91.97
2oog_A287 Glycerophosphoryl diester phosphodiesterase; phosp 91.89
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 91.88
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 91.86
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 91.86
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 91.85
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 91.79
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 91.76
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 91.73
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 91.71
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 91.6
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 91.52
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 91.51
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 91.35
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 91.35
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 91.19
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 91.19
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 91.15
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 91.09
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 91.06
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 91.01
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 91.0
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 90.97
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 90.96
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 90.82
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 90.81
1qjt_A99 EH1, epidermal growth factor receptor substrate su 90.78
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 90.75
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 90.71
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 90.7
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 90.69
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 90.65
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 90.64
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 90.56
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 90.54
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 90.53
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 90.47
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 90.35
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 90.34
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 90.32
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 90.26
3li6_A66 Calcium-binding protein; calcium signaling protein 90.24
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 90.2
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 90.13
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 90.12
1exr_A148 Calmodulin; high resolution, disorder, metal trans 90.09
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 89.64
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 89.55
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 89.51
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 89.4
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 89.36
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 89.27
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 89.23
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 89.23
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.11
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 89.07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 88.72
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 88.44
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 88.38
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 88.25
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 88.11
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 88.1
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 87.85
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 87.79
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 87.76
1c07_A95 Protein (epidermal growth factor receptor pathway 87.61
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 87.41
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 87.26
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 87.22
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 87.22
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 86.98
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 86.95
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 86.92
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 86.71
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 86.67
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 86.61
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 86.47
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 86.36
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 86.22
3li6_A66 Calcium-binding protein; calcium signaling protein 86.06
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 85.88
2hps_A186 Coelenterazine-binding protein with bound coelent; 85.81
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 85.67
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 85.54
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 85.46
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 85.28
2jq6_A139 EH domain-containing protein 1; metal binding prot 85.02
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 85.02
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 84.99
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 84.72
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 84.67
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 84.44
3rlg_A302 Sphingomyelin phosphodiesterase D lisictox-alphai; 84.38
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 84.1
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 83.79
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 83.77
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 83.57
2lv7_A100 Calcium-binding protein 7; metal binding protein; 83.34
1avs_A90 Troponin C; muscle contraction, calcium-activated, 83.23
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 83.19
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 83.0
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 82.82
3lij_A494 Calcium/calmodulin dependent protein kinase with A 82.61
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 81.88
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 81.49
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 81.22
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 81.18
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 80.85
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 80.74
2jrf_A184 Tubulin polymerization-promoting protein family me 80.73
3akb_A166 Putative calcium binding protein; EF-hand, metal b 80.62
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 80.05
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
Probab=100.00  E-value=6.1e-86  Score=692.10  Aligned_cols=331  Identities=23%  Similarity=0.369  Sum_probs=239.2

Q ss_pred             hHHHHHhhhhhcCccccCCCCccccccccccccccccccCCCCCchHHHHHHHHhcCCCCCcCHHHHHHHHHHHhCCCCC
Q 043888           11 NKEKTDQMQSQNGDVAENSSNDGSYHYRMFNFFNRKFKIREPEPPLDVKMAFMHFSQDGLHMKPSEFRRFMVEHQGETGC   90 (372)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~ty~Y~~~~~f~r~~~~~~~~~~~ei~~lF~~ys~~~~~mt~~~l~~FL~~~Q~e~~~   90 (372)
                      +++.+++|| +++|.+.+    |+.+|..|..+.+.+.     .+++|..+|..|..+.+.|+.++|++||..+||+..+
T Consensus        45 s~~el~~lf-~~~D~d~~----G~I~f~EF~~~~~~l~-----~~~el~~aF~~fD~~~G~Is~~EL~~fL~~~qge~~l  114 (624)
T 1djx_A           45 DDGYARKIF-RECDHSQT----DSLEDEEIETFYKMLT-----QRAEIDRAFEEAAGSAETLSVERLVTFLQHQQREEEA  114 (624)
T ss_dssp             ----------------------------CTTHHHHHHT-----CCHHHHHHHHHHHTTSSSEEHHHHHHHHHHTSCCSSC
T ss_pred             CHHHHHHHH-HHhCCCCC----CeEeHHHHHHHHHHhc-----cHHHHHHHHHHhcCCCCeecHHHHHHHHHHHhCCCCC
Confidence            456788896 88888764    8899999877776543     3589999999998777899999999999999999768


Q ss_pred             CHHHHHHHHHHHhhcccccccccCCCCCHHHHHHhhhcCCCCCCcc---ccccccCCCCCccccccccCCcccccCCCCC
Q 043888           91 TLSRAEEIVNNIISSRHHITRFTRNGLNLDDFFHFLLFDDDINGPI---KLEVHNDMTAPLSNYFIYTGHNSYLTGNQLS  167 (372)
Q Consensus        91 t~~~a~~Ii~~~~~~~~~~~~~~~~~Ltld~F~~yL~~S~d~N~p~---~~~v~qDMt~PLShYFIsSSHNTYLtG~QL~  167 (372)
                      +.++|++||+++....   .....+.|++++|.+|| +|.+ |.++   +..|+|||++|||||||||||||||||+||+
T Consensus       115 s~ee~~~ii~~~d~d~---~~~~dG~Is~deF~~~L-~s~~-~~~~~p~~~~v~~dm~~pLs~Yfi~SsHNTYL~G~Ql~  189 (624)
T 1djx_A          115 GPALALSLIERYEPSE---TAKAQRQMTKDGFLMYL-LSAD-GNAFSLAHRRVYQDMDQPLSHYLVSSSHNTYLLEDQLT  189 (624)
T ss_dssp             SHHHHHHHHHHHCCCH---HHHHTTEECHHHHHHHH-HSTT-TBSBCGGGGSCCSCTTSCGGGEEECEESSTTBSSCSSS
T ss_pred             CHHHHHHHHHHhCCCh---hhccCCCCCHHHHHHHh-cCcc-ccccCcccccccccccCcchhheeecccchhhhcCccc
Confidence            9999999999986320   00134679999999999 8765 4444   5679999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHhcCCcEEEEEeecCCCCCCceEeeCCcccccchHHHHHHHHhhcccccCCCCeEEEeCCCCCHHHHHH
Q 043888          168 SDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAK  247 (372)
Q Consensus       168 g~SS~e~Yi~AL~~GCRcIELD~Wdg~~~~~p~V~HG~TlTs~i~f~~vl~aIk~~AF~~S~YPVILSLE~Hcs~~qQ~~  247 (372)
                      |+||+++|++||++||||||||||||++ ++|+|||||||||+|+|++||+||++|||++|+||||||||||||++||++
T Consensus       190 ~~ss~e~y~~aL~~GcRcvElD~wdg~~-~ep~v~HG~tlts~i~f~~v~~~I~~~AF~~s~yPvilslE~Hc~~~qQ~~  268 (624)
T 1djx_A          190 GPSSTEAYIRALCKGCRCLELDCWDGPN-QEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRV  268 (624)
T ss_dssp             CCBCHHHHHHHHHTTCCEEEEEEECCGG-GCCEECCTTSCCCCEEHHHHHHHHHHHTTTSCSSCEEEEEEEECCHHHHHH
T ss_pred             CCcCHHHHHHHHHhCCcEEEEEeecCCC-CCeEEecCCcccccccHHHHHHHHHHhcccCCCCCEEEEecccCCHHHHHH
Confidence            9999999999999999999999999986 578999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcccCCCCCC-CCCCCCChhhhcCCeEeecCCCCccccccccccccccccccccccCCCCCCCCCCCCCCC
Q 043888          248 AAEMITQIFGKMLYFPESN-KLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQD  326 (372)
Q Consensus       248 mA~~l~~ifGd~L~~p~~~-~~~~lPSPe~Lk~KILIk~K~pke~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  326 (372)
                      ||+||++||||+||+++.+ ....||||++||||||||+|+++++.++...+..   +   .+ ++++   ++ +..+.+
T Consensus       269 ma~~~~~~~gd~L~~~~~~~~~~~lpsp~~Lk~kilik~k~~~~~~~~~~~~~~---~---~~-~~~~---~~-~~~~~~  337 (624)
T 1djx_A          269 MARHLRAILGPILLDQPLDGVTTSLPSPEQLKGKILLKGKKLGGLLPAGGENGS---E---AT-DVSD---EV-EAAEME  337 (624)
T ss_dssp             HHHHHHHHHGGGBCCSCCTTCCSSCCCTTTTTTCEEEEECCC--------------------------------------
T ss_pred             HHHHHHHHHhhhhcCCCccCCcCCCCCHHHHCCCEEEEecCCCcccccccccCc---c---cc-cCCc---cc-cccccc
Confidence            9999999999999998744 4689999999999999999999988765321110   0   00 0000   00 000000


Q ss_pred             CCc-cc-CCCCCCCCCCCCCcCCceeeEeecCCCCCchhccccc
Q 043888          327 LDD-FE-ISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKV  368 (372)
Q Consensus       327 ~~~-~~-~~~~~~~~~~~~~~~y~~li~i~a~k~kg~l~~~l~~  368 (372)
                      +++ .. ....+.......+|||.+||.+..|.+.+++..+.+.
T Consensus       338 ~~~~~~~~~~~~~~~~~~i~~~ls~l~~y~~~~~f~~~~~~~~~  381 (624)
T 1djx_A          338 DEAVRSQVQHKPKEDKLKLVPELSDMIIYCKSVHFGGFSSPGTS  381 (624)
T ss_dssp             -----------------CCCHHHHTTEEEEEEECCCCCCSSSSS
T ss_pred             ccccccccccccccccccccHHHhhhhhhhcCccCCCcchhhhc
Confidence            000 00 0000001356789999999999999998888776654
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3h4x_A Phosphatidylinositol-specific phospholipase C1; PI-PLC, Ca2+-dependent, catalytic TIM barrel, disulfide-LINK loop, hydrolase; 1.23A {Streptomyces antibioticus} PDB: 3h4w_A Back     alignment and structure
>2plc_A PI-PLC, phosphatidylinositol-specific phospholipase C; hydrolase, phospholipid degradation, virulence factor of human pathogen; 2.00A {Listeria monocytogenes} SCOP: c.1.18.2 PDB: 1aod_A* Back     alignment and structure
>3v1h_A 1-phosphatidylinositol phosphodiesterase; PI-cation, TIM barrel, phospholipase, lyase; HET: INS; 1.90A {Staphylococcus aureus subsp} PDB: 4f2b_A* 4f2u_A* 4f2t_A 3v18_A 3v16_A* Back     alignment and structure
>3ea1_A 1-phosphatidylinositol phosphodiesterase; phosphatidylinositol-specific phospholipase C, PI-PLC, dimer, interfacially impaired; 1.75A {Bacillus thuringiensis} SCOP: c.1.18.2 PDB: 3ea2_A* 3ea3_A 1t6m_A 2or2_A 1gym_A* 1ptd_A 1ptg_A* 7ptd_A 2ptd_A 4ptd_A 3ptd_A 6ptd_A 5ptd_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3no3_A Glycerophosphodiester phosphodiesterase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.89A {Parabacteroides distasonis} SCOP: c.1.18.0 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3qvq_A Phosphodiesterase OLEI02445; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase, hydrolase; HET: MSE G3P; 1.60A {Oleispira antarctica} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1vd6_A Glycerophosphoryl diester phosphodiesterase; glycerophosphod phosphodiesterase, HB8; 1.30A {Thermus thermophilus} SCOP: c.1.18.3 PDB: 1v8e_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2o55_A Putative glycerophosphodiester phosphodiesterase; beta barrel, structural genomics, protein structure initiati 2; 2.81A {Galdieria sulphuraria} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2otd_A Glycerophosphodiester phosphodiesterase; structural genomics PSI-2, protein structure initiative, midwest center for STR genomics, hydrolase; 2.60A {Shigella flexneri} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3ks6_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Agrobacterium tumefaciens str} PDB: 3ks5_A* Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1o1z_A GDPD, glycerophosphodiester phosphodiesterase; TM1621, glycerophosphodiester phosphodiesterase (GDPD), STRU genomics, JCSG, PSI; 1.60A {Thermotoga maritima} SCOP: c.1.18.3 Back     alignment and structure
>3i10_A Putative glycerophosphoryl diester phosphodiester; NP_812074.1; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ch0_A Glycerophosphodiester phosphodiesterase; YP_677622.1, glycerophosphoryl diester phosphodiesterase, ST genomics; HET: MSE CIT GOL; 1.50A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2pz0_A Glycerophosphoryl diester phosphodiesterase; glycerophosphodiester phosphodiesterase, T. tengcongensis; 1.91A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3mz2_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics; HET: MSE PE4; 1.55A {Parabacteroides distasonis} Back     alignment and structure
>3l12_A Putative glycerophosphoryl diester phosphodiester; struct genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1zcc_A Glycerophosphodiester phosphodiesterase; NYSGXRC, agrobacterium tumefaciens STR. C58, structural genomics; 2.50A {Agrobacterium tumefaciens str} SCOP: c.1.18.3 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1xx1_A Smase I, sphingomyelinase I; structure, quick cryo-soaking, activity, smase D, hydrolase; HET: EPE; 1.75A {Loxosceles laeta} PDB: 2f9r_A* Back     alignment and structure
>1ydy_A Glycerophosphoryl diester phosphodiesterase; structural genomics, PSI, protein structu initiative; 1.70A {Escherichia coli} SCOP: c.1.18.3 PDB: 1t8q_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2oog_A Glycerophosphoryl diester phosphodiesterase; phosphatase, ST genomics, protein structure initiative, PSI; 2.20A {Staphylococcus aureus subsp} PDB: 2p76_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3rlg_A Sphingomyelin phosphodiesterase D lisictox-alphai; TIM beta/alpha-barrel, PLC-like phosphodiesterase, inactive H12A phospholipase D; HET: PGE; 1.60A {Loxosceles intermedia} PDB: 3rlh_A* Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 372
d1qasa3 327 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (P 3e-66
d2zkmx4 349 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human 1e-62
d1qasa194 a.39.1.7 (A:205-298) Phosphoinositide-specific pho 5e-16
d2plca_274 c.1.18.2 (A:) Phosphatidylinositol-specific phosph 4e-12
d2ptda_296 c.1.18.2 (A:) Phosphatidylinositol-specific phosph 6e-11
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 3e-05
>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLC-like phosphodiesterases
family: Mammalian PLC
domain: Phospholipase C isozyme D1 (PLC-D1)
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  211 bits (537), Expect = 3e-66
 Identities = 63/227 (27%), Positives = 103/227 (45%), Gaps = 11/227 (4%)

Query: 147 PLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRT 206
           PLS+Y + + HN+YL  +QL+   S     +AL +G R +ELD W    +E I + HG T
Sbjct: 3   PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPI-IYHGYT 61

Query: 207 LTTPVSLINCLKSIRDNAFVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLY-FPES 265
            T+ +   + L++IRD AF +SPYPVI++LE+H + + Q   A  +  I G +L   P  
Sbjct: 62  FTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLD 121

Query: 266 NKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKLRDASFDDASTNSSDLEGYDSDQ 325
                 PSPE LK +I++  K     L              +  +A+  S ++E  + + 
Sbjct: 122 GVTTSLPSPEQLKGKILLKGKKLGGLLPAG---------GENGSEATDVSDEVEAAEMED 172

Query: 326 DLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDGLKVAADK 372
           +    ++        L++ PE   +I        G            
Sbjct: 173 EAVRSQVQHKPKEDKLKLVPELSDMIIYCKSVHFGGFSSPGTSGQAF 219
>d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 349 Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 94 Back     information, alignment and structure
>d2plca_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]} Length = 274 Back     information, alignment and structure
>d2ptda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]} Length = 296 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query372
d1qasa3 327 Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus n 100.0
d2zkmx4 349 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 100.0
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 99.74
d2ptda_296 Phosphatidylinositol-specific phospholipase C {Bac 99.28
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.13
d2plca_274 Phosphatidylinositol-specific phospholipase C {Lis 99.03
d1vd6a1217 Putative glycerophosphodiester phosphodiesterase T 96.71
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 96.28
d1zcca1240 Glycerophosphodiester phosphodiesterase UgpQ {Agro 96.18
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 95.97
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.97
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 95.87
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.72
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 95.58
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 95.55
d1o1za_226 Hypothetical protein TM1621 {Thermotoga maritima [ 95.54
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.53
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 95.5
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.4
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 95.31
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1ydya1 328 Glycerophosphodiester phosphodiesterase GlpQ {Esch 95.09
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.0
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 94.97
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 94.93
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 94.91
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 94.78
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 94.32
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 94.25
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.09
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.08
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 94.07
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 94.03
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 94.03
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 93.72
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.62
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 93.5
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 93.33
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 93.28
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 93.23
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 93.2
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.08
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.01
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 92.87
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 92.67
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 92.6
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 92.58
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 92.47
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 92.45
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 92.43
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 92.3
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 92.11
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 91.65
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.52
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 91.39
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 91.24
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 91.05
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 90.98
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 90.95
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 90.75
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 90.64
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 90.63
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 90.58
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 90.57
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 90.47
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 90.24
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 89.83
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.61
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 89.54
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 89.49
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 89.46
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 89.41
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 89.4
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 89.39
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 89.18
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 89.17
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 88.79
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 88.74
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 88.72
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 88.35
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 87.95
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 87.72
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 87.28
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 87.28
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 87.13
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 86.89
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 86.84
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 86.39
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 85.95
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 84.77
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 84.65
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 84.34
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 84.28
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 83.9
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 83.41
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 83.18
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 83.07
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 82.78
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 82.78
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 81.74
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 81.59
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 81.56
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 80.82
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 80.8
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 80.2
>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLC-like phosphodiesterases
family: Mammalian PLC
domain: Phospholipase C isozyme D1 (PLC-D1)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=3.6e-63  Score=481.36  Aligned_cols=211  Identities=27%  Similarity=0.462  Sum_probs=159.2

Q ss_pred             CCCccccccccCCcccccCCCCCCCCCHHHHHHHHhcCCcEEEEEeecCCCCCCceEeeCCcccccchHHHHHHHHhhcc
Q 043888          145 TAPLSNYFIYTGHNSYLTGNQLSSDCSEVPIAKALQRGVRVIELDIWPNSTREDINVLHGRTLTTPVSLINCLKSIRDNA  224 (372)
Q Consensus       145 t~PLShYFIsSSHNTYLtG~QL~g~SS~e~Yi~AL~~GCRcIELD~Wdg~~~~~p~V~HG~TlTs~i~f~~vl~aIk~~A  224 (372)
                      ++|||||||+|||||||+|+||.|.||+++|++||++||||||||||||++ ++|+|+||+|+|++|+|++||++|++||
T Consensus         1 ~~PLs~YfI~SShNtyl~g~Ql~~~ss~~~~~~~l~~G~R~ielD~w~g~d-~ePvV~HG~t~ts~I~F~dvl~~Ik~~A   79 (327)
T d1qasa3           1 DQPLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPN-QEPIIYHGYTFTSKILFCDVLRAIRDYA   79 (327)
T ss_dssp             CSCGGGEEEEEESSTTBSSCSSSCCBCHHHHHHHHHTTCCEEEEEEECCGG-GCCEESCTTSCCCCEEHHHHHHHHHHHT
T ss_pred             CCCcccceeeccccccccCCcccCcccHHHHHHHHHhCCcEEEEEeecCCC-CCeEEeeCCccccceeHHHHHHHHHHhc
Confidence            689999999999999999999999999999999999999999999999976 4789999999999999999999999999


Q ss_pred             cccCCCCeEEEeCCCCCHHHHHHHHHHHHHHhhcccCCCCC-CCCCCCCChhhhcCCeEeecCCCCcccccccccccccc
Q 043888          225 FVSSPYPVIITLEDHLTPDLQAKAAEMITQIFGKMLYFPES-NKLAEFPSPESLKQRIIISTKPPKEYLEKDHVSASTKL  303 (372)
Q Consensus       225 F~~S~YPVILSLE~Hcs~~qQ~~mA~~l~~ifGd~L~~p~~-~~~~~lPSPe~Lk~KILIk~K~pke~l~~~~~~~~~~~  303 (372)
                      |.+|+||||||||+||+.+||.+||++|+++||++||.++. +....+|||++||||||||+|++....+......    
T Consensus        80 F~~S~yPlILsLe~H~~~~qq~~ma~~l~~~fGd~L~~~~~~~~~~~~psp~~Lk~KIlik~K~~~~~~~~~~~~~----  155 (327)
T d1qasa3          80 FKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDGVTTSLPSPEQLKGKILLKGKKLGGLLPAGGENG----  155 (327)
T ss_dssp             TTSCSSCEEEEEEECCCHHHHHHHHHHHHHHTGGGBCCSCCTTCCSSCCCTGGGTTCEEEEECCCCC-------------
T ss_pred             CCCCCCCEEEEEEecCCHHHHHHHHHHHHHHHHhhccCCCcccccccCCCHHHHhhhhhhcccccccccccccccC----
Confidence            99999999999999999999999999999999999999764 4467899999999999999999987776653221    


Q ss_pred             ccccccccCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCcCCceeeEeecCCCCCchhcc
Q 043888          304 RDASFDDASTNSSDLEGYDSDQDLDDFEISDPKSGSGLRVAPEYKHLITIHAGKPKGTLKDG  365 (372)
Q Consensus       304 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~li~i~a~k~kg~l~~~  365 (372)
                         .++.+..+.......++............+  .....+|+..+||.++.+++.+++..+
T Consensus       156 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~eLs~li~~~~~~~~~~~~~~  212 (327)
T d1qasa3         156 ---SEATDVSDEVEAAEMEDEAVRSQVQHKPKE--DKLKLVPELSDMIIYCKSVHFGGFSSP  212 (327)
T ss_dssp             --------------------------------------CCCHHHHTTCSSEEECCCCCCCTT
T ss_pred             ---ccCCCccccccccccccchhhhhhhcccch--hhhHhhHHHHhHHHHhcCccCCCccch
Confidence               111111111000000000000011111111  245678999999999999888877654
>d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ptda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2plca_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1vd6a1 c.1.18.3 (A:8-224) Putative glycerophosphodiester phosphodiesterase TTHB141 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1zcca1 c.1.18.3 (A:1-240) Glycerophosphodiester phosphodiesterase UgpQ {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1o1za_ c.1.18.3 (A:) Hypothetical protein TM1621 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydya1 c.1.18.3 (A:29-356) Glycerophosphodiester phosphodiesterase GlpQ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure