Citrus Sinensis ID: 043934

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MASYKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSSPAPSPSDLQSAATARTGSVYFGMMALMVAFLIFLQ
ccHHHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHccccEEEcccccccccEEEEcHHHHccccccccccccccccEEEEEcccccEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHccEEEEccccccEccccHHHHHcccEEEEccEEEEEEEEEEEcHHHHHHcccccccccccccccEEEEcccccEEEEEcccccccccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHc
MASYKLFVILAIAAIIapsvlgkdhivgdetgwttNFDYQAWAKAKefrvgdrlkgshnviradgasfkqcmkpsnvealtsgsdvitlatpgkkwyfcgfpnhcdvgnqklTITVLAqrevsspapspsdlqsaatartgSVYFGMMALMVAFLIFLQ
MASYKLFVILAIAAiiapsvlgkDHIVGDETGWTTNFDYQAWAKAKEfrvgdrlkgSHNVIRadgasfkqcmKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSspapspsdlqsaATARTGSVYFGMMALMVAFLIFLQ
MASYKLFVilaiaaiiaPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSSPAPSPSDLQSAATARTGSVYFGMMALMVAFLIFLQ
***YKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLA*********************TGSVYFGMMALMVAFLIFL*
***YKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTI*******************************GMMALMVAFLIFLQ
MASYKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQR***************ATARTGSVYFGMMALMVAFLIFLQ
*ASYKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQ********************TGSVYFGMMALMVAFLIFLQ
iiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHi
ooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASYKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRLKGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSSPAPSPSDLQSAATARTGSVYFGMMALMVAFLIFLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.572 0.842 0.444 3e-16
Q8LG89129 Basic blue protein OS=Ara no no 0.679 0.837 0.336 7e-13
Q07488196 Blue copper protein OS=Ar no no 0.654 0.530 0.371 2e-12
Q41001189 Blue copper protein OS=Pi N/A no 0.685 0.576 0.353 2e-12
P00302107 Stellacyanin OS=Toxicoden N/A no 0.591 0.878 0.352 3e-11
O80517202 Uclacyanin-2 OS=Arabidops no no 0.540 0.425 0.395 7e-11
P0030396 Basic blue protein OS=Cuc N/A no 0.559 0.927 0.357 1e-10
P42849115 Umecyanin OS=Armoracia ru N/A no 0.591 0.817 0.359 7e-09
P60496126 Chemocyanin OS=Lilium lon N/A no 0.584 0.738 0.342 4e-08
Q39131172 Lamin-like protein OS=Ara no no 0.880 0.813 0.269 5e-08
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 55/99 (55%), Gaps = 8/99 (8%)

Query: 25  HIVGDETGWTT--NFDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKPSNV 77
           H VGD TGWTT   +DY  WA + +F VGD L        HNV++ D   FK C   S  
Sbjct: 4   HKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA 63

Query: 78  EALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITV 116
            + TSG+D I L  PG  ++ CG P HC +G QK+ I V
Sbjct: 64  ASYTSGADSIPLKRPGTFYFLCGIPGHCQLG-QKVEIKV 101

Cucurbita pepo (taxid: 3663)
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
224123286168 predicted protein [Populus trichocarpa] 0.974 0.922 0.478 3e-39
255537163174 Blue copper protein precursor, putative 0.836 0.764 0.55 9e-39
224102461168 predicted protein [Populus trichocarpa] 0.974 0.922 0.472 2e-38
359474052154 PREDICTED: blue copper protein-like [Vit 0.748 0.772 0.604 2e-37
224071627167 predicted protein [Populus trichocarpa] 0.962 0.916 0.475 1e-35
147816372151 hypothetical protein VITISV_036509 [Viti 0.893 0.940 0.473 4e-31
449523686180 PREDICTED: blue copper protein-like [Cuc 0.786 0.694 0.530 5e-31
449459740189 PREDICTED: blue copper protein-like [Cuc 0.786 0.661 0.530 5e-31
449459738170 PREDICTED: blue copper protein-like [Cuc 0.949 0.888 0.455 5e-29
255569494246 Early nodulin 55-2 precursor, putative [ 0.798 0.516 0.492 6e-29
>gi|224123286|ref|XP_002319041.1| predicted protein [Populus trichocarpa] gi|222857417|gb|EEE94964.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 106/163 (65%), Gaps = 8/163 (4%)

Query: 1   MASYKLFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRL-----K 55
           MAS ++F+I+AI A+  PS+L  +H+VGD+TGWT  F+YQ WA+ K F VGD L      
Sbjct: 1   MASCRIFMIIAIVAVFVPSILATEHMVGDKTGWTLGFNYQTWAQGKAFYVGDTLVFKYTP 60

Query: 56  GSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTIT 115
           G+HNV+  +G  F++C    ++  LT+G+DVITL+TPGKKWY C  P HC+ GNQKL IT
Sbjct: 61  GAHNVLSVNGTGFEECKAADDIVPLTTGNDVITLSTPGKKWYICSVPGHCESGNQKLFIT 120

Query: 116 VLAQ--REVSSPAPSPSDLQ-SAATARTGSVYFGMMALMVAFL 155
           VL Q     +SP P P+D   S A     S Y+G++A +V   
Sbjct: 121 VLPQLSSPATSPFPGPTDTSPSGAAGNIASTYYGLIAAIVGIF 163

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255537163|ref|XP_002509648.1| Blue copper protein precursor, putative [Ricinus communis] gi|223549547|gb|EEF51035.1| Blue copper protein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224102461|ref|XP_002334171.1| predicted protein [Populus trichocarpa] gi|224123282|ref|XP_002319040.1| predicted protein [Populus trichocarpa] gi|224123290|ref|XP_002319042.1| predicted protein [Populus trichocarpa] gi|222857416|gb|EEE94963.1| predicted protein [Populus trichocarpa] gi|222857418|gb|EEE94965.1| predicted protein [Populus trichocarpa] gi|222869910|gb|EEF07041.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359474052|ref|XP_003631393.1| PREDICTED: blue copper protein-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071627|ref|XP_002303545.1| predicted protein [Populus trichocarpa] gi|222840977|gb|EEE78524.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147816372|emb|CAN66200.1| hypothetical protein VITISV_036509 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449523686|ref|XP_004168854.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459740|ref|XP_004147604.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459738|ref|XP_004147603.1| PREDICTED: blue copper protein-like [Cucumis sativus] gi|449531269|ref|XP_004172610.1| PREDICTED: blue copper protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255569494|ref|XP_002525714.1| Early nodulin 55-2 precursor, putative [Ricinus communis] gi|223535014|gb|EEF36697.1| Early nodulin 55-2 precursor, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.691 0.55 0.386 8.1e-19
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.893 0.544 0.288 3.4e-18
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.698 0.593 0.358 3.2e-16
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.704 0.598 0.371 3.7e-16
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.773 0.597 0.371 9.8e-16
TAIR|locus:4010713753106 AT3G17675 [Arabidopsis thalian 0.591 0.886 0.38 4.2e-15
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.773 0.706 0.302 4.2e-15
TAIR|locus:2056700129 ARPN "plantacyanin" [Arabidops 0.559 0.689 0.377 6.2e-14
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.761 0.617 0.351 6.2e-14
TAIR|locus:2081957222 UCC3 "uclacyanin 3" [Arabidops 0.704 0.504 0.372 2.1e-13
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 8.1e-19, Sum P(2) = 8.1e-19
 Identities = 46/119 (38%), Positives = 62/119 (52%)

Query:    19 SVLGKDHIVGDETGWTT-NFDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCM 72
             SV G  H VGD  GWT  + +Y+ WA    F+VGD L     K  H+V       ++ C 
Sbjct:    23 SVGGTVHKVGDSDGWTIMSVNYETWASTITFQVGDSLVFKYNKDFHDVTEVTHNDYEMCE 82

Query:    73 KPSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQR--EVSSPAPSP 129
                 +    +GSD++ L  PG + + CGFP HCD+G QKL I VL      V++P P P
Sbjct:    83 PSKPLARYETGSDIVILTKPGLQHFICGFPGHCDMG-QKLQIHVLPASLGPVAAPVPGP 140
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713753 AT3G17675 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056700 ARPN "plantacyanin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081957 UCC3 "uclacyanin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 3e-21
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 2e-14
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 82.0 bits (203), Expect = 3e-21
 Identities = 33/83 (39%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 33  WTTNF--DYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKPSNVEALTSGSD 85
           WT     DY  WA  K FRVGD L     KG HNV+    A ++ C     +   T+G+D
Sbjct: 1   WTVPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGND 60

Query: 86  VITLATPGKKWYFCGFPNHCDVG 108
           +I L  PG+ ++ CG P HC  G
Sbjct: 61  IIPLTKPGQHYFICGVPGHCKGG 83

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.96
PRK02710119 plastocyanin; Provisional 98.11
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.04
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.79
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 97.41
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.35
COG3794128 PetE Plastocyanin [Energy production and conversio 97.18
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 97.13
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 96.92
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.94
TIGR0265783 amicyanin amicyanin. Members of this family are am 95.72
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.6
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 95.14
COG4454158 Uncharacterized copper-binding protein [Inorganic 94.15
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 82.92
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3e-42  Score=272.78  Aligned_cols=113  Identities=31%  Similarity=0.604  Sum_probs=100.8

Q ss_pred             HHHHHHHHHHHcccccccEEEecCCCCCCCCCChhhhhcCCceeeCcEE-----cCcccEEEeCcccccccCCCCCcccc
Q 043934            6 LFVILAIAAIIAPSVLGKDHIVGDETGWTTNFDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKPSNVEAL   80 (159)
Q Consensus         6 ~~~~~~~~~~~l~~~~a~~~~VGg~~GW~~~~~Y~~Wa~~~~F~vGD~L-----~~~h~V~~V~~~~Y~~C~~~~~~~~~   80 (159)
                      +++++++++++...+.+++|+|||+.||+.+.||++|+++++|++||+|     ++.|||+||++++|++|+.++|+..|
T Consensus         4 ~~l~~~~~~~~~~~~~a~~~~VGd~~GW~~~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~   83 (167)
T PLN03148          4 LLLFCFFALFSASATTATDHIVGANKGWNPGINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNW   83 (167)
T ss_pred             HHHHHHHHHHhhhhccceEEEeCCCCCcCCCCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCccee
Confidence            3344444444445559999999999999998999999999999999999     78999999999999999999999999


Q ss_pred             cCCCcEEEecCCCeEEEEeCCCCCCCCCCceEEEEEecCC
Q 043934           81 TSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQR  120 (159)
Q Consensus        81 ~~G~~~v~L~~~G~~YFic~~~~HC~~G~mKl~I~V~~~~  120 (159)
                      ++|++.|+|+++|+|||||+ .+||++| |||.|+|.+.+
T Consensus        84 tsG~d~v~L~~~G~~YFIcg-~ghC~~G-mKl~I~V~~~~  121 (167)
T PLN03148         84 TSGKDFIPLNKAKRYYFICG-NGQCFNG-MKVTILVHPLP  121 (167)
T ss_pred             cCCCcEEEecCCccEEEEcC-CCccccC-CEEEEEEcCCC
Confidence            99999999999999999999 6899999 99999997654

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 3e-17
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 1e-11
1f56_A91 Spinach Plantacyanin Length = 91 4e-10
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 6e-10
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 1e-08
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 55/99 (55%), Gaps = 8/99 (8%)
Query: 25  HIVGDETGWTT--NFDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKPSNV 77
           H VGD TGWTT   +DY  WA + +F VGD L        HNV++ D   FK C   S  
Sbjct: 5   HKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPA 64
Query: 78  EALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITV 116
            + TSG+D I L  PG  ++ CG P HC +G QK+ I V
Sbjct: 65  ASYTSGADSIPLKRPGTFYFLCGIPGHCQLG-QKVEIKV 102
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 8e-34
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 2e-31
2cbp_A96 Cucumber basic protein; electron transport, phytoc 1e-27
1jer_A138 Cucumber stellacyanin; electron transport, copper, 1e-26
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 4e-26
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score =  114 bits (286), Expect = 8e-34
 Identities = 38/116 (32%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 23  KDHIVGDETGWTTNFD---YQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKP 74
           +D+ VG +  W    D   Y  WA  K FRVGD L      G H+V      +F  C K 
Sbjct: 2   EDYDVGGDMEWKRPSDPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKE 61

Query: 75  SNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSSPAPSPS 130
           + +  +T+    I L T G ++Y C   +HC VG QKL+I V+     +    +P 
Sbjct: 62  NPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVG-QKLSINVVGAGG-AGGGATPG 115
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.97
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.03
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.84
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.81
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.43
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.42
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.39
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.39
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.31
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.31
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.31
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.26
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.26
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.18
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 98.17
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.05
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.04
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.04
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 97.99
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 97.68
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.6
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.58
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 97.57
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.54
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.51
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.39
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.28
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.13
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.06
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.06
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 96.97
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.85
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 96.84
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 96.78
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.71
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 96.43
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 95.67
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 95.64
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 93.73
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 91.89
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 89.38
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 85.46
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 85.08
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=1.7e-40  Score=254.69  Aligned_cols=111  Identities=37%  Similarity=0.607  Sum_probs=95.5

Q ss_pred             cccEEEecCCCCCCCC---CChhhhhcCCceeeCcEE-----cCcccEEEe-CcccccccCCCCCcccccCCCcEEEe-c
Q 043934           21 LGKDHIVGDETGWTTN---FDYQAWAKAKEFRVGDRL-----KGSHNVIRA-DGASFKQCMKPSNVEALTSGSDVITL-A   90 (159)
Q Consensus        21 ~a~~~~VGg~~GW~~~---~~Y~~Wa~~~~F~vGD~L-----~~~h~V~~V-~~~~Y~~C~~~~~~~~~~~G~~~v~L-~   90 (159)
                      +|++|+|||+.||+++   .||++||++++|++||+|     ++.|+|+|| ++++|+.|+.++++..+++|++.|+| +
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~   81 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLD   81 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEecc
Confidence            5789999999999998   789999999999999999     689999999 99999999999999999999999999 9


Q ss_pred             CCCeEEEEeCCCCCCCCCCceEEEEEecCCCCCCCCCCCCCC
Q 043934           91 TPGKKWYFCGFPNHCDVGNQKLTITVLAQREVSSPAPSPSDL  132 (159)
Q Consensus        91 ~~G~~YFic~~~~HC~~G~mKl~I~V~~~~~~p~p~psp~~~  132 (159)
                      ++|++||||++++||++| |||+|+|.+..++|+++|+|+.+
T Consensus        82 ~~G~~YFicg~~gHC~~G-mKl~I~V~~~~~~~~~~p~~~~p  122 (138)
T 1jer_A           82 ELGMHYFVCTVGTHCSNG-QKLSINVVAANATVSMPPPSSSP  122 (138)
T ss_dssp             SSEEEEEECCSTTTGGGT-CEEEEEEECCC------------
T ss_pred             CCcCEEEEcCCCCccccC-CEEEEEEcCCCCCCCCCCCCCCC
Confidence            999999999999999999 99999999887766655554443
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 2e-31
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 4e-29
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 8e-26
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 9e-25
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

 Score =  106 bits (266), Expect = 2e-31
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 21  LGKDHIVGDETGWTT--NFDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMK 73
           +   H VGD TGWTT   +DY  WA + +F VGD L        HNV++ D   FK C  
Sbjct: 1   MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 74  PSNVEALTSGSDVITLATPGKKWYFCGFPNHCDVGNQKLTITVL 117
            S   + TSG+D I L  PG  ++ CG P HC +G QK+ I V 
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLG-QKVEIKVD 103
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.96
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.57
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.42
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.41
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.26
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.24
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.19
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.17
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.16
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.11
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.05
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.02
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.01
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.01
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.91
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.73
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 97.68
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.38
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 97.33
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 97.12
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.12
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 96.72
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 96.59
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 96.54
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 95.57
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 95.5
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 93.02
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 92.46
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 92.3
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 91.56
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 84.71
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 81.88
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=1.1e-36  Score=221.33  Aligned_cols=96  Identities=46%  Similarity=0.892  Sum_probs=91.8

Q ss_pred             ccEEEecCCCCCCCC--CChhhhhcCCceeeCcEE-----cCcccEEEeCcccccccCCCCCcccccCCCcEEEecCCCe
Q 043934           22 GKDHIVGDETGWTTN--FDYQAWAKAKEFRVGDRL-----KGSHNVIRADGASFKQCMKPSNVEALTSGSDVITLATPGK   94 (159)
Q Consensus        22 a~~~~VGg~~GW~~~--~~Y~~Wa~~~~F~vGD~L-----~~~h~V~~V~~~~Y~~C~~~~~~~~~~~G~~~v~L~~~G~   94 (159)
                      |++|+|||++||+.+  .||++|+++++|++||+|     ++.|+|+||++++|++|+.++++..+++|++.|+|+++|+
T Consensus         2 at~~~VGg~~gW~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~~g~   81 (104)
T d1ws8a_           2 ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGT   81 (104)
T ss_dssp             CCEEETTGGGCSCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCSSEE
T ss_pred             CcEEEeCCcCccCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEecCcc
Confidence            789999999999974  589999999999999999     7999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCCCCCCCCceEEEEEec
Q 043934           95 KWYFCGFPNHCDVGNQKLTITVLA  118 (159)
Q Consensus        95 ~YFic~~~~HC~~G~mKl~I~V~~  118 (159)
                      +||||++++||++| |||+|+|++
T Consensus        82 ~yF~C~~~~HC~~G-mkl~I~V~P  104 (104)
T d1ws8a_          82 FYFLCGIPGHCQLG-QKVEIKVDP  104 (104)
T ss_dssp             EEEECCSTTTTTTT-CEEEEEECC
T ss_pred             EEEECCCcchhhCC-CEEEEEECC
Confidence            99999999999999 999999974
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure