Citrus Sinensis ID: 044064

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34

MASCTTLHLLILILATLATKATESLPTFLPGAKANYYKSSFKQARLSKPKLPYKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG

ccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEccccccccccccHHHHHccccHHHHHHHHcccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEccccccccccHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHccccHHHHHHHccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHcc

ccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccEEEEEEccccccccccccccHHHHHccccHHHHHHHHHccEEEEEEEccccccccccHcccHHHcccccHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHcccEEEEEcccccccccccccccccccEEEEEEcccccEcccccccccccHHHHHHHHHHHHHHHHHHc

MASCTTLHLLILILATLATkateslptflpgakanyykssfkqarlskpklpykthyfpqvldhftfqpksdiecfaantgflldiapkfNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKqnlssdsspfvvfggsyggrlmckiidglppgvsklSQVFAGASLYynysqtekcfmiedaadphgldgwrwQTCTEMvmpmtcsnnsmfppsgydykdfAEQCMmtygvrprihwittefgGKRIELVLKRFgsniifsngmqdpwsrggvlkNISASIIALVTKkgahhvdfrsktkddpdwLVELRRQEVEIIQKWVG

MASCTTLHLLILILATLATKATESLPTFLPGAKANYYKSSFKQARLSKPKLPYKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLkqnlssdsspfVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFsngmqdpwsrGGVLKNISASIIALVTkkgahhvdfrsktkddpdwlvELRRQEVEIIQKWVG

MASCttlhllililatlatkatESLPTFLPGAKANYYKSSFKQARLSKPKLPYKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG

***CTTLHLLILILATLATKATESLPTFLPGAKANYYKSSFKQARLSKPKLPYKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKQNL***SSPFVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKW**

**SCTTLHLLILILATLATKATESLPT*************************YKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVL*NISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG

*ASCTTLHLLILILATLATKATESLPTFLPGAKANYYKSSFKQARLSKPKLPYKTHYFPQVLDHFTFQPKSDIECFAANTGFLLDIAPKFNASLVFIEILWGINAIWEDSYKSAETLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		338	2.2.26 [Sep-21-2011]
Q5RBU7		496	Lysosomal Pro-X carboxype	yes	no	0.511	0.348	0.401	2e-33
P42785		496	Lysosomal Pro-X carboxype	yes	no	0.511	0.348	0.401	4e-33
Q2TA14		499	Lysosomal Pro-X carboxype	yes	no	0.485	0.328	0.416	5e-33
Q7TMR0		491	Lysosomal Pro-X carboxype	yes	no	0.485	0.334	0.414	3e-31
Q9EPB1		500	Dipeptidyl peptidase 2 OS	no	no	0.452	0.306	0.390	7e-27
Q9UHL4		492	Dipeptidyl peptidase 2 OS	no	no	0.5	0.343	0.378	2e-26
Q9ET22		506	Dipeptidyl peptidase 2 OS	no	no	0.452	0.302	0.384	5e-26
P34676		507	Prolyl carboxy peptidase	yes	no	0.473	0.315	0.331	5e-18
P34610		565	Putative serine protease	no	no	0.470	0.281	0.267	5e-10
P34528		510	Putative serine protease	no	no	0.363	0.241	0.251	1e-05

>sp\|Q5RBU7\|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1	Back alignment and function desciption

 Score =  142 bits (359), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 110/187 (58%), Gaps = 14/187 (7%)

Query: 157 RLMCKIIDGLPPGVSK---LSQVFAGASLYYNYSQTEKCFMI-EDAADPHGLDGWRWQTC 212
           +++C+ +    P VS    L  +F   ++YYNYS   KC  I E A    G  GW +Q C
Sbjct: 307 KVVCQYLKN--PNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWSYQAC 364

Query: 213 TEMVMPMTCSN--NSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRF 270
           TE+VMP  C+N  + MF P  ++ K+ ++ C   +GVRPR  WITT +GGK I       
Sbjct: 365 TEVVMPF-CTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISS----- 418

Query: 271 GSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEV 330
            +NI+FSNG  DPWS GGV K+I+ +++A+   +GAHH+D R+K   DP  ++  R  EV
Sbjct: 419 HTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPTSVLLARSLEV 478

Query: 331 EIIQKWV 337
             ++ W+
Sbjct: 479 RHMKNWI 485

Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
Pongo abelii (taxid: 9601)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 2

>sp\|P42785\|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1	Back alignment and function description

>sp\|Q2TA14\|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1	Back alignment and function description

>sp\|Q7TMR0\|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=2 SV=2	Back alignment and function description

>sp\|Q9EPB1\|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1	Back alignment and function description

>sp\|Q9UHL4\|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3	Back alignment and function description

>sp\|Q9ET22\|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=2 SV=2	Back alignment and function description

>sp\|P34676\|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1	Back alignment and function description

>sp\|P34610\|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2	Back alignment and function description

>sp\|P34528\|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		338
255565027		501	lysosomal pro-X carboxypeptidase, putati	0.449	0.303	0.745	2e-82
118487801		500	unknown [Populus trichocarpa]	0.440	0.298	0.756	5e-82
224142419		459	predicted protein [Populus trichocarpa]	0.455	0.335	0.756	7e-82
118487656		213	unknown [Populus trichocarpa]	0.547	0.868	0.756	3e-81
449443023		499	PREDICTED: lysosomal Pro-X carboxypeptid	0.452	0.306	0.731	4e-80
297821719		495	serine carboxypeptidase S28 family prote	0.399	0.272	0.748	7e-79
359484787		502	PREDICTED: lysosomal Pro-X carboxypeptid	0.449	0.302	0.724	8e-79
312282209		494	unnamed protein product [Thellungiella h	0.399	0.273	0.754	1e-78
357123237		536	PREDICTED: lysosomal Pro-X carboxypeptid	0.423	0.266	0.686	7e-77
30682358		494	alpha/beta-hydrolase domain-containing p	0.399	0.273	0.737	9e-77

>gi\|255565027\|ref\|XP_002523506.1\| lysosomal pro-X carboxypeptidase, putative [Ricinus communis] gi\|223537213\|gb\|EEF38845.1\| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  312 bits (799), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 138/185 (74%), Positives = 159/185 (85%)

Query: 153 SYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTC 212
           +Y  + MCKIIDG P G SK+S+VFA ASLYYNYS+ EKCF +E+  D HGL GW WQ C
Sbjct: 303 AYPVKEMCKIIDGFPAGASKVSRVFAAASLYYNYSRGEKCFQLENVPDAHGLHGWNWQAC 362

Query: 213 TEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGS 272
           TEMVMPMTCS  SMFPPSGYDYK+FAE+C   +GV PR HWITTEFGGKRI+ VLKRFGS
Sbjct: 363 TEMVMPMTCSKESMFPPSGYDYKEFAEECKKKFGVMPRQHWITTEFGGKRIDKVLKRFGS 422

Query: 273 NIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEI 332
           NIIFSNGM+DPWSRGGVLKNIS+SIIA+VTKKGAHHVDFRS TKDDP+WL E+R+QE++I
Sbjct: 423 NIIFSNGMEDPWSRGGVLKNISSSIIAIVTKKGAHHVDFRSATKDDPNWLKEMRKQEIQI 482

Query: 333 IQKWV 337
           I +W+
Sbjct: 483 IGRWI 487

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|118487801\|gb\|ABK95724.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224142419\|ref\|XP_002324555.1\| predicted protein [Populus trichocarpa] gi\|222865989\|gb\|EEF03120.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118487656\|gb\|ABK95653.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449443023\|ref\|XP_004139280.1\| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus] gi\|449493651\|ref\|XP_004159394.1\| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297821719\|ref\|XP_002878742.1\| serine carboxypeptidase S28 family protein [Arabidopsis lyrata subsp. lyrata] gi\|297324581\|gb\|EFH55001.1\| serine carboxypeptidase S28 family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|359484787\|ref\|XP_003633162.1\| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera] gi\|297735899\|emb\|CBI18675.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|312282209\|dbj\|BAJ33970.1\| unnamed protein product [Thellungiella halophila]	Back alignment and taxonomy information

>gi\|357123237\|ref\|XP_003563318.1\| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|30682358\|ref\|NP_850050.1\| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] gi\|16648801\|gb\|AAL25591.1\| At2g24280/F27D4.19 [Arabidopsis thaliana] gi\|22655366\|gb\|AAM98275.1\| At2g24280/F27D4.19 [Arabidopsis thaliana] gi\|330252462\|gb\|AEC07556.1\| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		338
TAIR\|locus:2169945		515	AT5G65760 [Arabidopsis thalian	0.529	0.347	0.554	2.2e-82
TAIR\|locus:2047495		494	AT2G24280 "AT2G24280" [Arabido	0.686	0.469	0.610	3.6e-80
TAIR\|locus:2172671		502	AT5G22860 [Arabidopsis thalian	0.520	0.350	0.404	3.2e-59
UNIPROTKB\|F1STV0		493	PRCP "Uncharacterized protein"	0.511	0.350	0.427	3.4e-56
RGD\|1307842		493	Prcp "prolylcarboxypeptidase (	0.485	0.332	0.420	1.1e-53
UNIPROTKB\|F1PWK3		497	PRCP "Uncharacterized protein"	0.485	0.329	0.398	1.6e-52
UNIPROTKB\|P42785		496	PRCP "Lysosomal Pro-X carboxyp	0.511	0.348	0.401	5.2e-52
UNIPROTKB\|F1MAU4		499	PRCP "Lysosomal Pro-X carboxyp	0.485	0.328	0.416	3.6e-51
ZFIN\|ZDB-GENE-040718-447		490	prcp "prolylcarboxypeptidase (	0.511	0.353	0.388	4.5e-51
MGI\|MGI:1919711		491	Prcp "prolylcarboxypeptidase (	0.485	0.334	0.414	1.2e-50

TAIR\|locus:2169945 AT5G65760 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 567 (204.7 bits), Expect = 2.2e-82, Sum P(3) = 2.2e-82
 Identities = 101/182 (55%), Positives = 129/182 (70%)

Query:   157 RLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTCTEMV 216
             R +C+ IDG     S L +++AG S+YYNY+    CF ++D  DPHGLDGW WQ CTEMV
Sbjct:   318 REVCRKIDGAGSNASILDRIYAGISVYYNYTGNVDCFKLDD--DPHGLDGWNWQACTEMV 375

Query:   217 MPMTCSN-NSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNII 275
             MPM+ +  NSMFP  G++Y  + E+C  T+ V PR  W+TTEFGG  I   LK FGSNII
Sbjct:   376 MPMSSNQENSMFPGYGFNYSSYKEECWNTFRVNPRPKWVTTEFGGHDIATTLKSFGSNII 435

Query:   276 FSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQK 335
             FSNG+ DPWS G VLKN+S +I+ALVTK+GAHH+D R  T +DP WLV+ R  E+ +IQ 
Sbjct:   436 FSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHLDLRPSTPEDPKWLVDQREAEIRLIQG 495

Query:   336 WV 337
             W+
Sbjct:   496 WI 497

GO:0006508 "proteolysis" evidence=IEA;ISS

GO:0008236 "serine-type peptidase activity" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0005773 "vacuole" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA

GO:0009086 "methionine biosynthetic process" evidence=RCA

TAIR\|locus:2047495 AT2G24280 "AT2G24280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172671 AT5G22860 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1STV0 PRCP "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1307842 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK3 PRCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P42785 PRCP "Lysosomal Pro-X carboxypeptidase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MAU4 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040718-447 prcp "prolylcarboxypeptidase (angiotensinase C)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1919711 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.XVIII.3311.1	SubName- Full=Putative uncharacterized protein; (459 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		338
pfam05577		433	pfam05577, Peptidase_S28, Serine carboxypeptidase	2e-18
pfam05577		433	pfam05577, Peptidase_S28, Serine carboxypeptidase	4e-12

>gnl\|CDD\|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28	Back alignment and domain information

 Score = 85.1 bits (211), Expect = 2e-18
 Identities = 42/199 (21%), Positives = 61/199 (30%), Gaps = 38/199 (19%)

Query: 154 YGGRLMCKIID-------GLPPGVSKLSQVFAGASLYYNYSQ--------TEKCFMIEDA 198
           Y    +CKI+         L   V      +       N +                   
Sbjct: 244 YSIPDLCKIMLNATTTDLILRVEVLIQLFNYLNQKSGNNSTMDISYQLANASYGDSSGSY 303

Query: 199 ADPHGLDGWRWQTCTEMVMPMTCSN-NSMF---PPSGYDYKDFAEQCMMTYG-------V 247
           AD      W WQTCTE     T  + N  F    P+      F + CM  +G       +
Sbjct: 304 ADDRQ---WTWQTCTEFGWYQTTDSGNGPFGSPVPASL----FIDMCMDVFGADYNSTKI 356

Query: 248 RPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAH 307
             R+      +GG           +N++F NG  DPW   G   +  +S++  +    AH
Sbjct: 357 SLRVSATNYYYGGA-----DNPNATNVVFVNGDLDPWHALGKTDSTDSSVVPYLIPGAAH 411

Query: 308 HVDFRSKTKDDPDWLVELR 326
             D       D   L   R
Sbjct: 412 CADMYPARPSDSPELKAAR 430

These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433

>gnl\|CDD\|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		338
KOG2183		492	consensus Prolylcarboxypeptidase (angiotensinase C	100.0
KOG2182		514	consensus Hydrolytic enzymes of the alpha/beta hyd	100.0
PF05577		434	Peptidase_S28: Serine carboxypeptidase S28; InterP	100.0
PF05576		448	Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0	99.96
PLN02298		330	hydrolase, alpha/beta fold family protein	96.46
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	95.88
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	95.37
PLN02385		349	hydrolase; alpha/beta fold family protein	95.1
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	95.02
PRK10749		330	lysophospholipase L2; Provisional	94.99
PHA02857		276	monoglyceride lipase; Provisional	94.97
PLN02652		395	hydrolase; alpha/beta fold family protein	94.77
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	94.73
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	94.66
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	94.59
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	94.54
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	94.52
PRK10566		249	esterase; Provisional	94.46
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	94.18
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	94.14
PLN02824		294	hydrolase, alpha/beta fold family protein	93.71
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	93.43
TIGR03502		792	lipase_Pla1_cef extracellular lipase, Pla-1/cef fa	93.3
PLN02211		273	methyl indole-3-acetate methyltransferase	93.14
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	93.07
PRK00870		302	haloalkane dehalogenase; Provisional	93.0
PRK10673		255	acyl-CoA esterase; Provisional	92.82
PTZ00472		462	serine carboxypeptidase (CBP1); Provisional	92.51
PLN02511		388	hydrolase	92.17
PLN02965		255	Probable pheophorbidase	92.06
PRK05855		582	short chain dehydrogenase; Validated	91.89
KOG2564		343	consensus Predicted acetyltransferases and hydrola	91.87
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	91.79
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	90.95
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	90.83
PRK10985		324	putative hydrolase; Provisional	90.74
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	90.61
PF11144		403	DUF2920: Protein of unknown function (DUF2920); In	90.28
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	90.11
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	90.01
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	89.99
PRK03592		295	haloalkane dehalogenase; Provisional	89.53
KOG1838		409	consensus Alpha/beta hydrolase [General function p	88.69
TIGR00976		550	/NonD putative hydrolase, CocE/NonD family. This m	88.35
PRK08775		343	homoserine O-acetyltransferase; Provisional	87.66
PLN02679		360	hydrolase, alpha/beta fold family protein	87.57
PRK03204		286	haloalkane dehalogenase; Provisional	86.89
PF01738		218	DLH: Dienelactone hydrolase family; InterPro: IPR0	86.74
PLN02894		402	hydrolase, alpha/beta fold family protein	85.74
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	85.58
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	85.32
COG4757		281	Predicted alpha/beta hydrolase [General function p	85.16
PLN02578		354	hydrolase	84.99
PF05677		365	DUF818: Chlamydia CHLPS protein (DUF818); InterPro	84.75
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	84.51
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	84.18
KOG2382		315	consensus Predicted alpha/beta hydrolase [General	84.17
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	83.86
PF00450		415	Peptidase_S10: Serine carboxypeptidase; InterPro:	83.82
KOG4391		300	consensus Predicted alpha/beta hydrolase BEM46 [Ge	83.77
PRK07581		339	hypothetical protein; Validated	82.54
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	82.29
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	81.77
PRK10162		318	acetyl esterase; Provisional	81.5
PLN02872		395	triacylglycerol lipase	81.3

>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=5.2e-79  Score=583.61  Aligned_cols=287  Identities=51%  Similarity=0.904  Sum_probs=261.0

Q ss_pred             cCCCCCcceeeEEeecCCCCCCCC------------------CC----------ccccccccchHHHhhhhcCCcEEEEE
Q 044064           47 SKPKLPYKTHYFPQVLDHFTFQPK------------------SD----------IECFAANTGFLLDIAPKFNASLVFIE   98 (338)
Q Consensus        47 ~~~~~~~~~~~f~Q~lDHF~~~~~------------------gp----------i~~~~~~~g~~~~lA~~~~Alvv~lE   98 (338)
                      +..+..++++||+|+||||.+.+.                  ||          |+++..++|||.++|+++||++|++|
T Consensus        39 s~~~~~ye~~yf~q~LDHFsF~~~~tF~qRylin~~fw~~g~gPIffYtGNEGdie~Fa~ntGFm~D~Ap~~~AllVFaE  118 (492)
T KOG2183|consen   39 SIGEYNYETRYFQQPLDHFSFTDNKTFDQRYLINDDFWKKGEGPIFFYTGNEGDIEWFANNTGFMWDLAPELKALLVFAE  118 (492)
T ss_pred             ccccccceeEEeecccccccccCccceeeEEEEecccccCCCCceEEEeCCcccHHHHHhccchHHhhhHhhCceEEEee
Confidence            444678999999999999998763                  45          46778899999999999999999999


Q ss_pred             ee-eccCccCcc-ccCCccccCCCChhhhhhhHHHHHHHHhhhcCCCCCCEEEEcccchhhc------------------
Q 044064           99 IL-WGINAIWED-SYKSAETLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRL------------------  158 (338)
Q Consensus        99 HR-YG~S~P~~~-~~~s~~nL~yLt~~QALaD~a~Fi~~~k~~~~~~~~pwI~~GGSY~GaL------------------  158 (338)
                      || ||||+||.+ .+++.++|.|||+||||||+|.+++++|++++++.+|||+|||||||||                  
T Consensus       119 HRyYGeS~PFG~~s~k~~~hlgyLtseQALADfA~ll~~lK~~~~a~~~pvIafGGSYGGMLaAWfRlKYPHiv~GAlAa  198 (492)
T KOG2183|consen  119 HRYYGESLPFGSQSYKDARHLGYLTSEQALADFAELLTFLKRDLSAEASPVIAFGGSYGGMLAAWFRLKYPHIVLGALAA  198 (492)
T ss_pred             hhccccCCCCcchhccChhhhccccHHHHHHHHHHHHHHHhhccccccCcEEEecCchhhHHHHHHHhcChhhhhhhhhc
Confidence            99 999999944 4788899999999999999999999999999999999999999999999                  


Q ss_pred             --------------------------------------------------------------------------------
Q 044064          159 --------------------------------------------------------------------------------  158 (338)
Q Consensus       159 --------------------------------------------------------------------------------  158 (338)
                                                                                                      
T Consensus       199 SAPvl~f~d~vp~~~f~~ivT~~F~~as~~C~~~I~~sW~ai~~l~~~~nG~q~Ls~~f~lc~~ln~d~~~l~d~l~ea~  278 (492)
T KOG2183|consen  199 SAPVLYFEDTVPKDVFYRIVTRDFKDASPNCRNTIRKSWDAIDRLAAKDNGLQILSKAFKLCKPLNDDIGDLKDYLREAY  278 (492)
T ss_pred             cCceEeecCCCCcchhhhHHHHHHHhhcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHhhhcccccccHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             -------------------------ccccccCCCCC-hhHHHHHHHHHHHHhccCCCcccccccCCCCC--CCCCceeee
Q 044064          159 -------------------------MCKIIDGLPPG-VSKLSQVFAGASLYYNYSQTEKCFMIEDAADP--HGLDGWRWQ  210 (338)
Q Consensus       159 -------------------------~C~~i~~~~~~-~~~l~~~~~~~~~~~~~~~~~~C~~~~~~~~~--~~~r~W~yQ  210 (338)
                                               .|..|+..... .+.+++++++++.||||+|+..|+++++.+..  .+.|+|.||
T Consensus       279 ~ylAMVdYPy~t~Fl~pLPa~PV~~~C~~i~~~~~~~~~ll~~i~a~~~~yyNytg~~~C~d~sd~t~~~~~d~~gW~~Q  358 (492)
T KOG2183|consen  279 EYLAMVDYPYPTSFLAPLPAWPVKVVCKYINAPGPNDSDLLDRIFAAVNLYYNYTGSEKCYDISDPTYGSGLDDLGWPWQ  358 (492)
T ss_pred             HHHHHhcCCCCccccCcCCCCcHHHHHHHhccCCCChHHHHHHHHHHhhheeccCCCcchhccccccCCCCCCcCCCchh
Confidence                                     56655543322 56789999999999999999999999865443  356899999


Q ss_pred             ecccccccccCCC-CCCCCCCCCChHHHHHHHHhhcCCCCchhhHHhhhcCCchhhHhhhccceEEEeCCCCCCCccccc
Q 044064          211 TCTEMVMPMTCSN-NSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGSNIIFSNGMQDPWSRGGV  289 (338)
Q Consensus       211 ~CtE~g~~~t~~~-~~~f~~~~~~~~~~~~~C~~~FGv~p~~~~~n~~yGG~~~~~~l~~~asnIiFtNG~~DPW~~~gv  289 (338)
                      +|||+.+++++++ ++||++-+++.+.+++.|.+.||+.|+|+|++..|||.++..     .|||||+||.+|||+.+||
T Consensus       359 aCtEmVMp~~~ng~~~mf~~~~fn~~~y~e~C~~~~~v~prP~wi~t~fgg~~l~~-----~SNiIFSNG~LDPWSGGGV  433 (492)
T KOG2183|consen  359 ACTEMVMPMCSNGVDDMFPDCPFNSESYQEGCMQTFGVTPRPKWITTEFGGADLSA-----FSNIIFSNGLLDPWSGGGV  433 (492)
T ss_pred             hhhhhhhccccCCCcccCCCCCCCHHHHHHHHHHhcCCCCCCcceehhhccccchh-----hcceeeeCCCcCCccCcCe
Confidence            9999999999987 899988899999999999999999999999999999988875     6999999999999999999


Q ss_pred             cccCCCCceEEEcCCCcccccCCCCCCCCcHHHHHHHHHHHHHHHHhhC
Q 044064          290 LKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG  338 (338)
Q Consensus       290 ~~~~s~~~~~i~i~g~aHc~Dl~~~~~~Dp~~l~~aR~~~~~~i~~Wl~  338 (338)
                      .+++++++++++|++|+||.|||.+++.||++|+++|++|+++|++||+
T Consensus       434 ~~nis~svvav~~k~GAHHlDLR~~~~~DP~~v~~aR~~Ei~iI~~WI~  482 (492)
T KOG2183|consen  434 LKNISDSVVAVTIKEGAHHLDLRASHPEDPESVVEARELEIQIIKKWIK  482 (492)
T ss_pred             eccccCcEEEEEecCCccceeccCCCCCCcHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999984

>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>PTZ00472 serine carboxypeptidase (CBP1); Provisional	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>KOG1838 consensus Alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>TIGR00976 /NonD putative hydrolase, CocE/NonD family	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>COG4757 Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only]	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only]	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>PLN02872 triacylglycerol lipase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		338
3n2z_B		446	The Structure Of Human Prolylcarboxypeptidase At 2.		4e-34
3jyh_A		469	Human Dipeptidyl Peptidase Dpp7 Length = 469		9e-28
4ebb_A		472	Structure Of Dpp2 Length = 472		5e-27

>pdb|3N2Z|B Chain B, The Structure Of Human Prolylcarboxypeptidase At 2.80 Angstroms Resolution Length = 446

Back alignment and structure

Iteration: 1

Score = 141 bits (356), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 75/187 (40%), Positives = 110/187 (58%), Gaps = 14/187 (7%) Query: 157 RLMCKIIDGLPPGVSK---LSQVFAGASLYYNYSQTEKCFMI-EDAADPHGLDGWRWQTC 212 +++C+ + P VS L +F ++YYNYS KC I E A G GW +Q C Sbjct: 262 KVVCQYLKN--PNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWSYQAC 319 Query: 213 TEMVMPMTCSN--NSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRF 270 TE+VMP C+N + MF P ++ K+ ++ C +GVRPR WITT +GGK I Sbjct: 320 TEVVMPF-CTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISS----- 373 Query: 271 GSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEV 330 +NI+FSNG DPWS GGV K+I+ +++A+ +GAHH+D R+K DP ++ R EV Sbjct: 374 HTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEV 433 Query: 331 EIIQKWV 337 ++ W+ Sbjct: 434 RHMKNWI 440

PyMOL of 3n2z

>pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469

Back alignment and structure

>pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		338
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	2e-41
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	1e-15
3jyh_A		469	Dipeptidyl-peptidase 2; structural genomics, struc	4e-40
3jyh_A		469	Dipeptidyl-peptidase 2; structural genomics, struc	5e-19
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446	Back alignment and structure

 Score =  148 bits (375), Expect = 2e-41
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 8/197 (4%)

Query: 144 SSPFVVFGGSYGGRLMCKIIDGLPPGVSKL-SQVFAGASLYYNYSQTEKCFMIEDAADPH 202
           +S F+    ++  +++C+ +       S L   +F   ++YYNYS   KC  I + A   
Sbjct: 249 ASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSS 308

Query: 203 -GLDGWRWQTCTEMVMPMTC-SNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGG 260
            G  GW +Q CTE+VMP      + MF P  ++ K+ ++ C   +GVRPR  WITT +GG
Sbjct: 309 LGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGG 368

Query: 261 KRIELVLKRFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPD 320
           K I        +NI+FSNG  DPWS GGV K+I+ +++A+   +GAHH+D R+K   DP 
Sbjct: 369 KNI-----SSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPM 423

Query: 321 WLVELRRQEVEIIQKWV 337
            ++  R  EV  ++ W+
Sbjct: 424 SVLLARSLEVRHMKNWI 440

PyMOL of 3n2z

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446	Back alignment and structure

>3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469	Back alignment and structure

>3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		338
4ebb_A		472	Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2	100.0
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	100.0
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	97.19
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	97.02
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	96.54
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	96.38
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	96.36
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	96.32
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	96.27
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	96.26
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	96.15
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	96.02
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	95.96
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	95.94
3llc_A		270	Putative hydrolase; structural genomics, joint cen	95.85
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	95.83
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	95.82
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	95.71
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	95.69
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	95.68
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	95.66
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	95.63
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	95.63
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	95.61
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	95.61
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	95.56
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	95.55
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	95.45
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	95.44
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	95.44
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	95.41
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	95.4
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	95.33
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	95.32
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	95.32
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	95.31
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	95.3
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	95.25
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	95.16
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	95.16
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	95.12
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	95.12
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	95.12
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	95.09
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	95.07
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	95.06
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	95.02
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	95.01
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	95.01
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	94.94
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	94.89
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	94.89
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	94.86
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	94.85
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	94.81
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	94.78
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	94.77
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	94.77
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	94.7
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	94.69
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	94.68
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	94.66
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	94.55
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	94.47
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	94.44
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	94.38
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	94.37
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	94.35
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	94.34
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	94.33
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	94.2
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	94.15
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	94.14
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	94.12
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	94.08
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	94.02
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	93.91
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	93.89
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	93.89
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	93.88
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	93.83
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	93.79
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	93.76
1iup_A		282	META-cleavage product hydrolase; aromatic compound	93.65
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	93.63
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	93.56
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	93.54
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	93.48
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	93.45
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	93.36
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	93.27
1r3d_A		264	Conserved hypothetical protein VC1974; structural	93.22
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	93.15
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	93.1
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	93.09
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	93.06
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	93.04
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	92.99
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	92.91
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	92.86
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	92.85
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	91.99
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	92.79
1whs_A		255	Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T	92.69
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	92.66
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	92.62
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	92.61
3h04_A		275	Uncharacterized protein; protein with unknown func	92.41
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	92.39
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	92.29
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	92.28
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	92.22
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	92.18
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	92.13
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	92.03
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	92.0
3g02_A		408	Epoxide hydrolase; alpha/beta hydrolase fold, enan	91.97
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	91.94
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	91.84
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	91.48
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	91.42
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	91.41
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	91.4
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	91.36
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	91.31
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	91.28
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	91.17
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	91.16
3d59_A		383	Platelet-activating factor acetylhydrolase; secret	91.11
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	91.08
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	91.06
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	90.96
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	90.83
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	90.39
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	90.25
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	90.24
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	90.21
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	89.75
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	89.53
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	89.48
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	89.28
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	89.2
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	89.2
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	89.16
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	89.03
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	88.96
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	88.95
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	88.79
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	88.73
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	88.71
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	88.6
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	88.1
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	88.02
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	87.58
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	87.37
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	87.09
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	86.54
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	86.26
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	86.06
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	86.03
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	86.03
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	85.88
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	85.72
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	85.17
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	84.88
3vis_A		306	Esterase; alpha/beta-hydrolase fold, polyethylene	84.85
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	84.76
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	84.69
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	84.1
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	83.91
1ivy_A		452	Human protective protein; carboxypeptidase, serine	83.67
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	83.6
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	83.52
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	83.09
3iii_A		560	COCE/NOND family hydrolase; structural genomics, c	82.83
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	82.78
2b9v_A		652	Alpha-amino acid ester hydrolase; catalytic triad,	82.6
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	82.54
3i2k_A		587	Cocaine esterase; alpha/beta hydrolase, hydrolase;	82.45
1mpx_A		615	Alpha-amino acid ester hydrolase; alpha/beta hydro	82.09
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	80.93
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	80.56
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	80.53
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	80.08

>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A*	Back alignment and structure

Probab=100.00  E-value=5.3e-76  Score=591.98  Aligned_cols=280  Identities=38%  Similarity=0.675  Sum_probs=233.5

Q ss_pred             CCcceeeEEeecCCCCCCC---C-----------------CCcc----------ccccccchHHHhhhhcCCcEEEEEee
Q 044064           51 LPYKTHYFPQVLDHFTFQP---K-----------------SDIE----------CFAANTGFLLDIAPKFNASLVFIEIL  100 (338)
Q Consensus        51 ~~~~~~~f~Q~lDHF~~~~---~-----------------gpi~----------~~~~~~g~~~~lA~~~~Alvv~lEHR  100 (338)
                      ++++++||+|+|||||+++   +                 |||.          .+..++|++.+||+++||++|+||||
T Consensus         3 P~~~~~~f~Q~lDHFn~~~~~~~TF~QRY~~n~~~~~~~~gPIfl~~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~lEHR   82 (472)
T 4ebb_A            3 PGFQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVRGEGPIFFYTGNEGDVWAFANNSAFVAELAAERGALLVFAEHR   82 (472)
T ss_dssp             CCCEEEEEEEESCSSCSSTTTTCEEEEEEEEECTTCCTTTCCEEEEECCSSCHHHHHHHCHHHHHHHHHHTCEEEEECCT
T ss_pred             CCCceeeEEeecCCCCCCCCCCCEEEEEEEEecceeCCCCCcEEEEECCCccccccccCccHHHHHHHHhCCeEEEEecc
Confidence            4799999999999999753   1                 5653          34456789999999999999999999


Q ss_pred             -eccCccCccccCCcc--ccCCCChhhhhhhHHHHHHHHhhhcCCCCCCEEEEcccchhhc-------------------
Q 044064          101 -WGINAIWEDSYKSAE--TLGYLNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGGRL-------------------  158 (338)
Q Consensus       101 -YG~S~P~~~~~~s~~--nL~yLt~~QALaD~a~Fi~~~k~~~~~~~~pwI~~GGSY~GaL-------------------  158 (338)
                       ||+|+||+++  +++  ||||||+||||||+|+||+++|++++++++|||+|||||||||                   
T Consensus        83 yYG~S~P~~~~--st~~~nL~yLt~eQALaD~a~fi~~~k~~~~~~~~pwI~~GGSY~G~LaAW~R~kYP~lv~ga~ASS  160 (472)
T 4ebb_A           83 YYGKSLPFGAQ--STQRGHTELLTVEQALADFAELLRALRRDLGAQDAPAIAFGGSYGGMLSAYLRMKYPHLVAGALAAS  160 (472)
T ss_dssp             TSTTCCTTGGG--GGSTTSCTTCSHHHHHHHHHHHHHHHHHHTTCTTCCEEEEEETHHHHHHHHHHHHCTTTCSEEEEET
T ss_pred             cccCCcCCCCC--CccccccccCCHHHHHHHHHHHHHHHHhhcCCCCCCEEEEccCccchhhHHHHhhCCCeEEEEEecc
Confidence             9999999988  776  9999999999999999999999999999999999999999999                   


Q ss_pred             ----------------------------------------------------------ccccccCCC-------------
Q 044064          159 ----------------------------------------------------------MCKIIDGLP-------------  167 (338)
Q Consensus       159 ----------------------------------------------------------~C~~i~~~~-------------  167 (338)
                                                                                .|..+....             
T Consensus       161 Apv~a~~df~~y~~~~~~v~~~~~~~~~~C~~~i~~a~~~i~~~~~~~~~~~~~~~f~~c~~~~~~~d~~~~~~~~~~~~  240 (472)
T 4ebb_A          161 APVLAVAGLGDSNQFFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAF  240 (472)
T ss_dssp             CCTTGGGTCSCTTHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHTBSSCCCSHHHHHHHHHHHHHHH
T ss_pred             cceEEeccccccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhcchHHHHHHHhcCCCCCCChHHHHHHHHHHHHHH
Confidence                                                                      343321100             


Q ss_pred             -------------------------------CChhHHHHHHHHHHHHhccCCCcccccccCC----CC------CCCCCc
Q 044064          168 -------------------------------PGVSKLSQVFAGASLYYNYSQTEKCFMIEDA----AD------PHGLDG  206 (338)
Q Consensus       168 -------------------------------~~~~~l~~~~~~~~~~~~~~~~~~C~~~~~~----~~------~~~~r~  206 (338)
                                                     +..+.+..+...+..++++.+...|++....    .+      ..+.|+
T Consensus       241 ~~~~~~~y~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~r~  320 (472)
T 4ebb_A          241 TVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPTGCGTGPDARA  320 (472)
T ss_dssp             HHHHHTCCSSCEESSSEECSSHHHHHHHHHHTCSSHHHHHHHHHHHHHCTTSCCSSBCHHHHCCCCSSTTCCCSSHHHHH
T ss_pred             HHHhhhccccchhhcccCccchHHHHHHHhcccchHHHHHHHHHHHHhhccCCcchhhhhhhhhhccCCcccCCCCCccc
Confidence                                           0001123333444455677777788875321    11      113599


Q ss_pred             eeeeecccccccccCCC-CCCCCCCCCChHHHHHHHHhhcCCCCchhh-HHhhhcCCchhhHhhhccceEEEeCCCCCCC
Q 044064          207 WRWQTCTEMVMPMTCSN-NSMFPPSGYDYKDFAEQCMMTYGVRPRIHW-ITTEFGGKRIELVLKRFGSNIIFSNGMQDPW  284 (338)
Q Consensus       207 W~yQ~CtE~g~~~t~~~-~~~f~~~~~~~~~~~~~C~~~FGv~p~~~~-~n~~yGG~~~~~~l~~~asnIiFtNG~~DPW  284 (338)
                      |.||+|||||||+++++ .++|++++++++++.++|+++||+.+++++ +|++|||.+++      ++||||+||++|||
T Consensus       321 W~yQ~CtE~g~~~~~~~~~~~f~~~~~~~~~~~~~C~~~fg~~~~~~~~~~~~~Gg~~~~------~sniiF~nG~~DPW  394 (472)
T 4ebb_A          321 WDYQACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFWGGDLRA------ASNIIFSNGNLDPW  394 (472)
T ss_dssp             HHHHHTTTCCCCCCBCSSSSSSCCBCCCHHHHHHHHHHHHSCCCCTTHHHHHHCTTCCTT------CCSEEEEEETTCTT
T ss_pred             ccccccccccccccCCCCCCcCCCCCCcHHHHHHHHHHHhCCCCChhHHHHHhcCCcCCC------CCeEEEECCCcCCC
Confidence            99999999999999875 789987889999999999999999888876 45667777877      89999999999999


Q ss_pred             ccccccccCCCCceEEEcCCCcccccCCCCCCCCcHHHHHHHHHHHHHHHHhhC
Q 044064          285 SRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEIIQKWVG  338 (338)
Q Consensus       285 ~~~gv~~~~s~~~~~i~i~g~aHc~Dl~~~~~~Dp~~l~~aR~~~~~~i~~Wl~  338 (338)
                      |.+||+++.++++++++||||+||.||+++++.||++|++||++|+++|++||+
T Consensus       395 ~~~gv~~~~s~~~~~~~I~g~~Hc~Dl~~~~~~Dp~~l~~ar~~~~~~i~~Wl~  448 (472)
T 4ebb_A          395 AGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVK  448 (472)
T ss_dssp             GGGSCCSCCSSSEEEEEETTCCTTGGGSCCCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             cCccCCCCCCCCceEEEeCcCeeeccccCCCCCCCHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999984

PyMOL of 4ebb

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A*	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A*	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis}	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans}	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba}	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A*	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A	Back alignment and structure

>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		338
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	96.48
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	96.05
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	95.65
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	95.49
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	95.47
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	95.24
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	94.92
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	94.81
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	94.76
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	94.74
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	94.69
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	94.41
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	94.28
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	94.13
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	93.58
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	93.55
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	93.42
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	93.19
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	92.5
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	92.27
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	92.23
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	91.61
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	91.61
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	91.24
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	91.12
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	90.75
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	90.31
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	90.16
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	89.83
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	89.78
d2dsta1		122	Hypothetical protein TTHA1544 {Thermus thermophilu	89.53
d1mpxa2		381	Alpha-amino acid ester hydrolase {Xanthomonas citr	89.36
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	88.48
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	87.9
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	84.99
d1jjia_		311	Carboxylesterase {Archaeon Archaeoglobus fulgidus	84.59
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	84.39
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	83.07
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	81.34
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	80.82

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Gastric lipase
domain: Gastric lipase
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=96.48  E-value=0.0014  Score=57.89  Aligned_cols=73  Identities=11%  Similarity=-0.009  Sum_probs=53.6

Q ss_pred             chHHHhhhhcCCcEEEEEee-eccCccCccccCCccccCC---CChhhhhhhHHHHHHHHhhhcCCCCCCEEEEcccchh
Q 044064           81 GFLLDIAPKFNASLVFIEIL-WGINAIWEDSYKSAETLGY---LNSQQALADDAVLIRSLKQNLSSDSSPFVVFGGSYGG  156 (338)
Q Consensus        81 g~~~~lA~~~~Alvv~lEHR-YG~S~P~~~~~~s~~nL~y---Lt~~QALaD~a~Fi~~~k~~~~~~~~pwI~~GGSY~G  156 (338)
                      +++..||++ |=-|+++.+| +|.|..-.+.  .....++   .=-+.+..|++..|+.+.+..+.  .|++++|+|.||
T Consensus        82 sla~~L~~~-Gy~V~~~D~rG~G~S~~~~~~--~~~~~~~~~~~~~~~~~~Dl~~~i~~i~~~~g~--~~v~lvGhS~GG  156 (377)
T d1k8qa_          82 SLAFILADA-GYDVWLGNSRGNTWARRNLYY--SPDSVEFWAFSFDEMAKYDLPATIDFILKKTGQ--DKLHYVGHSQGT  156 (377)
T ss_dssp             CHHHHHHHT-TCEEEECCCTTSTTSCEESSS--CTTSTTTTCCCHHHHHHTHHHHHHHHHHHHHCC--SCEEEEEETHHH
T ss_pred             hHHHHHHHC-CCEEEEEcCCCCCCCCCCCCC--CCcchhhccCCHHHHhhhhHHHHHHHHHHHcCC--CCEEEEEecchH
Confidence            455566655 7789999999 9999754222  2223332   22367889999999999887653  689999999999


Q ss_pred             hc
Q 044064          157 RL  158 (338)
Q Consensus       157 aL  158 (338)
                      ++
T Consensus       157 ~i  158 (377)
T d1k8qa_         157 TI  158 (377)
T ss_dssp             HH
T ss_pred             HH
Confidence            88

PyMOL of d1k8qa_

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure