Citrus Sinensis ID: 044120
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 255571155 | 249 | metal ion binding protein, putative [Ric | 0.982 | 0.915 | 0.596 | 5e-65 | |
| 359489108 | 236 | PREDICTED: uncharacterized protein LOC10 | 0.948 | 0.932 | 0.568 | 2e-58 | |
| 297845810 | 279 | hypothetical protein ARALYDRAFT_336004 [ | 0.956 | 0.795 | 0.494 | 6e-55 | |
| 356560659 | 278 | PREDICTED: uncharacterized protein LOC10 | 0.952 | 0.794 | 0.485 | 3e-53 | |
| 224132062 | 260 | predicted protein [Populus trichocarpa] | 0.948 | 0.846 | 0.496 | 1e-50 | |
| 358344246 | 251 | hypothetical protein MTR_033s0019 [Medic | 0.969 | 0.896 | 0.512 | 1e-48 | |
| 358344852 | 265 | hypothetical protein MTR_043s0006 [Medic | 0.969 | 0.849 | 0.487 | 4e-48 | |
| 147822230 | 330 | hypothetical protein VITISV_013619 [Viti | 0.875 | 0.615 | 0.545 | 1e-47 | |
| 297744827 | 222 | unnamed protein product [Vitis vinifera] | 0.831 | 0.869 | 0.542 | 9e-45 | |
| 449433137 | 261 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.881 | 0.444 | 2e-44 |
| >gi|255571155|ref|XP_002526528.1| metal ion binding protein, putative [Ricinus communis] gi|223534203|gb|EEF35919.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 253 bits (645), Expect = 5e-65, Method: Compositional matrix adjust.
Identities = 145/243 (59%), Positives = 182/243 (74%), Gaps = 15/243 (6%)
Query: 3 AKNKDIGVITGVYNVNLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEIKVKGVIDVIKI 62
AK K VIT VY VNLHC QCAR I+K L+ ++ G+ +VD DF+KAEIKVKGVIDVIKI
Sbjct: 9 AKEKVDEVITAVYKVNLHCQQCARDIKKPLMNMQ-GVHNVDVDFQKAEIKVKGVIDVIKI 67
Query: 63 HKLIQKTSQKKVELISPPLIKIKEIGAI-KEIKE--KEVILRTTTLKVHIHCAQCEHDLR 119
HK I+K S+KKVE++SP IKIK GA K++ E K+ ILRTT++KVH+HC +CE+DL+
Sbjct: 68 HKQIEKWSKKKVEMVSPE-IKIKNTGATEKKVVEQTKKAILRTTSIKVHMHCDKCENDLQ 126
Query: 120 KKLLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKKVHKHAEIVTSKQEKKEEIKKD 179
+LLKH+GIYSV + K QT+ VQG IESD+LL+Y+RKKVHK+AEI+TSK EK EE K+
Sbjct: 127 NRLLKHEGIYSVKTNMKTQTLLVQGIIESDKLLAYIRKKVHKNAEIITSKPEKMEEKKEV 186
Query: 180 NEKFEVKSTEL------STKFVEFKED----VKSKESNVPYFIHYVYAPQLFSDENPNAC 229
E + ++ STK VEFK + ++ E N PYFIHYVYAPQLFSDENPNAC
Sbjct: 187 KEAEIKEKQQVEAISINSTKLVEFKTEKKVAAQTTEGNAPYFIHYVYAPQLFSDENPNAC 246
Query: 230 SIL 232
I+
Sbjct: 247 IIM 249
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359489108|ref|XP_002265240.2| PREDICTED: uncharacterized protein LOC100249861 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297845810|ref|XP_002890786.1| hypothetical protein ARALYDRAFT_336004 [Arabidopsis lyrata subsp. lyrata] gi|297336628|gb|EFH67045.1| hypothetical protein ARALYDRAFT_336004 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356560659|ref|XP_003548607.1| PREDICTED: uncharacterized protein LOC100783418 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224132062|ref|XP_002321246.1| predicted protein [Populus trichocarpa] gi|222862019|gb|EEE99561.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|358344246|ref|XP_003636202.1| hypothetical protein MTR_033s0019 [Medicago truncatula] gi|355502137|gb|AES83340.1| hypothetical protein MTR_033s0019 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|358344852|ref|XP_003636500.1| hypothetical protein MTR_043s0006 [Medicago truncatula] gi|355502435|gb|AES83638.1| hypothetical protein MTR_043s0006 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147822230|emb|CAN61960.1| hypothetical protein VITISV_013619 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744827|emb|CBI38095.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449433137|ref|XP_004134354.1| PREDICTED: uncharacterized protein LOC101219056 [Cucumis sativus] gi|449480310|ref|XP_004155858.1| PREDICTED: uncharacterized protein LOC101226867 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| TAIR|locus:2018768 | 287 | AT1G29000 [Arabidopsis thalian | 0.706 | 0.571 | 0.494 | 4.4e-36 | |
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.655 | 0.524 | 0.285 | 1.1e-21 | |
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.655 | 0.428 | 0.290 | 1.4e-21 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.642 | 0.467 | 0.28 | 1.4e-20 | |
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.258 | 0.155 | 0.383 | 4.1e-16 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.280 | 0.165 | 0.369 | 4.2e-16 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.698 | 0.661 | 0.275 | 2.8e-15 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.879 | 0.829 | 0.246 | 1.1e-14 | |
| TAIR|locus:2096204 | 577 | AT3G05220 [Arabidopsis thalian | 0.284 | 0.114 | 0.462 | 5.2e-13 | |
| TAIR|locus:2026336 | 152 | HIPP20 "heavy metal associated | 0.284 | 0.434 | 0.313 | 1.8e-08 |
| TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 389 (142.0 bits), Expect = 4.4e-36, P = 4.4e-36
Identities = 86/174 (49%), Positives = 108/174 (62%)
Query: 4 KNKDIGVITGVYNVNLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEXXXXXXXXXXXXX 63
K K +IT VY V+LHC +CA I+K LL+ + G+Q+VD D EK E
Sbjct: 8 KEKGDEIITAVYKVHLHCRKCACDIKKPLLRFQ-GVQNVDFDLEKNEIKVKGKIEVVKIH 66
Query: 64 XLIQKTSQKKVELISP-PLXXXXXXXXXXXXXXXXV--------ILRTTTLKVHIHCAQC 114
I+K S+KKVELISP P ++RTT LKVHIHCAQC
Sbjct: 67 KQIEKWSKKKVELISPKPSEVKKTTTTTTTTSVVEKKTTEIKKDVIRTTVLKVHIHCAQC 126
Query: 115 EHDLRKKLLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKKVHKHAEIVTS 168
+ DL+ KLLKHK I+ V DTKAQT+TVQGTIES +LL+Y++KKVHKHAEI++S
Sbjct: 127 DKDLQHKLLKHKAIHIVKTDTKAQTLTVQGTIESAKLLAYIKKKVHKHAEIISS 180
|
|
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036710001 | SubName- Full=Chromosome chr15 scaffold_82, whole genome shotgun sequence; (228 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 6e-06 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 3e-05 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-04 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 2e-04 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
Score = 42.2 bits (100), Expect = 6e-06
Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)
Query: 17 VNLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEIKVKGVIDVIKIHKLIQKTSQKKVE 75
+ C CA+K+EK L K+ G+ SV D E ++ V G D +K+ KL + + E
Sbjct: 5 PGMTCAGCAKKVEKALSKLP-GVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKAGYE 62
|
Length = 62 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.37 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.36 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.36 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.34 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.25 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.17 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.09 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.97 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.87 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.76 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.45 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.3 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.89 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.74 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.64 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.45 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.36 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 96.98 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 95.71 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 94.87 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 90.5 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 82.22 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 81.61 |
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
Probab=99.37 E-value=1.3e-11 Score=120.44 Aligned_cols=150 Identities=18% Similarity=0.282 Sum_probs=113.7
Q ss_pred eEEEEEE-eccChhHHHHHHHHHhhccCCeeEEEEEcCCCEEEEeecCCHHHHHHHHHHhcCCceeecCCCcccc-cccc
Q 044120 11 ITGVYNV-NLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEIKVKGVIDVIKIHKLIQKTSQKKVELISPPLIKI-KEIG 88 (232)
Q Consensus 11 ~~~~~~v-gm~C~~Ca~~Ie~~L~~~~~gV~~v~v~~~~~~v~V~~~~d~~~i~~~i~~~~g~~~~~i~~~~~~~-~~~~ 88 (232)
++..+.| ||+|.+|+.+|+++|.+++ ||.++.+++. +..+.+..+...+...+++ +||.+.+.++ ...+ ....
T Consensus 3 ~~~~l~V~gmtC~~C~~~i~~al~~~~-gv~~v~v~~~--~~~v~~~~~~~~i~~~i~~-~Gy~~~~~~~-~~~~~~~~~ 77 (834)
T PRK10671 3 QTIDLTLDGLSCGHCVKRVKESLEQRP-DVEQADVSIT--EAHVTGTASAEALIETIKQ-AGYDASVSHP-KAKPLTESS 77 (834)
T ss_pred eEEEEEECCcccHHHHHHHHHHHhcCC-CcceEEEeee--EEEEEecCCHHHHHHHHHh-cCCccccccc-ccccccccc
Confidence 4678999 9999999999999999999 9999999994 4555555688899999998 9998887643 1110 0000
Q ss_pred hh-h---hhcc-----cccceEEEEEEe-eccCcchHHHHHHHHhccCCeeEEEEecCCCEEEEEeeCCHHHHHHHHHHh
Q 044120 89 AI-K---EIKE-----KEVILRTTTLKV-HIHCAQCEHDLRKKLLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKK 158 (232)
Q Consensus 89 ~~-~---~~~~-----~~~~~~~~~l~v-~m~C~~C~~ki~~~l~~~~GV~sv~vd~~~~~v~V~g~~d~~~l~~~l~k~ 158 (232)
.. + .... ......++.+.+ ||+|..|+..+++.+..++||.++.+++.++++.+.+..++..+...++ .
T Consensus 78 ~~~~~~~~~~~~~~~~~~~~~~~~~l~V~Gm~Ca~Ca~~Ie~~L~~~~GV~~a~vnl~t~~~~V~~~~s~~~I~~~I~-~ 156 (834)
T PRK10671 78 IPSEALTAASEELPAATADDDDSQQLLLSGMSCASCVSRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVE-K 156 (834)
T ss_pred cCchhhhhhhhhccccccCcCceEEEEeCCcCcHHHHHHHHHHHhcCCCceeeeeecCCCeEEEEccCCHHHHHHHHH-h
Confidence 00 0 0000 000112456767 9999999999999999999999999999999988876678888888888 7
Q ss_pred cCCcEEEe
Q 044120 159 VHKHAEIV 166 (232)
Q Consensus 159 ~g~~a~i~ 166 (232)
+||.+.++
T Consensus 157 ~Gy~a~~~ 164 (834)
T PRK10671 157 AGYGAEAI 164 (834)
T ss_pred cCCCcccc
Confidence 99887654
|
|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 4e-12 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 3e-10 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 1e-09 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 1e-08 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 7e-09 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 5e-07 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 8e-09 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 3e-07 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-07 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-05 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 5e-07 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 2e-06 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 3e-06 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 59.5 bits (144), Expect = 4e-12
Identities = 17/89 (19%), Positives = 31/89 (34%), Gaps = 1/89 (1%)
Query: 89 AIKEIKEKEVILRTTTLKVHIHCAQCEHDLRKKLLKHKGIYSVNADTKAQTVTVQGTIES 148
+ + L T V + C C +RK L G+ V + Q V V T+ S
Sbjct: 7 GMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPS 66
Query: 149 DRLLSYLRKKVHKHAEIVTSKQEKKEEIK 177
+ + L + + A + + +
Sbjct: 67 QEVQALL-EGTGRQAVLKGMGSGQLQNSG 94
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.83 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.79 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.77 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.5 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.34 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.32 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.32 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.32 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.27 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.21 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.2 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.17 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.15 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.12 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.11 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.09 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.06 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.05 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.05 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.04 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.03 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.03 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.02 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.02 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.01 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.01 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.0 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.98 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.98 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.98 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.96 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.96 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.94 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.94 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.93 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.92 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.92 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.91 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.91 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.91 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.89 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.89 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.89 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.89 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.88 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.88 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.88 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.87 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.86 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.85 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.84 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.84 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.83 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.83 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.82 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.8 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.79 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.79 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.79 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.78 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.78 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.78 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.77 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.76 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.7 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.69 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.68 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.65 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.63 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.61 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.52 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.52 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.51 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.37 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.13 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.01 |
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.83 E-value=2.9e-19 Score=136.92 Aligned_cols=138 Identities=20% Similarity=0.355 Sum_probs=115.9
Q ss_pred eeEEEEEE-eccChhHHHHHHHHHhhccCCeeEEEEEcCCCEEEEee---cCCHHHHHHHHHHhcCCceeecCCCccccc
Q 044120 10 VITGVYNV-NLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEIKVKG---VIDVIKIHKLIQKTSQKKVELISPPLIKIK 85 (232)
Q Consensus 10 ~~~~~~~v-gm~C~~Ca~~Ie~~L~~~~~gV~~v~v~~~~~~v~V~~---~~d~~~i~~~i~~~~g~~~~~i~~~~~~~~ 85 (232)
+.+..|.| ||+|.+|+..|++.|..++ ||..+.+++..+++.+.+ ..++..+...++. .||.+.++.. ...
T Consensus 3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~-gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~-~G~~~~~~~~-~~~-- 77 (149)
T 2ew9_A 3 PQKCFLQIKGMTCASCVSNIERNLQKEA-GVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQD-LGFEAAVMED-YAG-- 77 (149)
T ss_dssp CEEEEEEEECCCSSSHHHHHHHHHHTTS-SCCCEEEETTTTEEEEEECTTTCCHHHHHHHHHH-HTCEEEECSC-SCC--
T ss_pred cEEEEEEECCeecHHHHHHHHHHHhcCC-CcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHhc-CCCceEeecc-ccc--
Confidence 46788999 9999999999999999999 999999999999999865 2456788888888 8997665432 100
Q ss_pred ccchhhhhcccccceEEEEEEe-eccCcchHHHHHHHHhccCCeeEEEEecCCCEEEEEee---CCHHHHHHHHHHhcCC
Q 044120 86 EIGAIKEIKEKEVILRTTTLKV-HIHCAQCEHDLRKKLLKHKGIYSVNADTKAQTVTVQGT---IESDRLLSYLRKKVHK 161 (232)
Q Consensus 86 ~~~~~~~~~~~~~~~~~~~l~v-~m~C~~C~~ki~~~l~~~~GV~sv~vd~~~~~v~V~g~---~d~~~l~~~l~k~~g~ 161 (232)
...++.|.+ ||+|++|+.+|+++|.+++||.++.+|+.+++++|.++ +++..|++.|. .+||
T Consensus 78 -------------~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~Gy 143 (149)
T 2ew9_A 78 -------------SDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIE-EIGF 143 (149)
T ss_dssp -------------SSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHHHHH-HHTC
T ss_pred -------------ccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHHHHH-hCCC
Confidence 012456777 99999999999999999999999999999999999864 67899999999 8999
Q ss_pred cEEEe
Q 044120 162 HAEIV 166 (232)
Q Consensus 162 ~a~i~ 166 (232)
.+.++
T Consensus 144 ~~~~~ 148 (149)
T 2ew9_A 144 HASLA 148 (149)
T ss_dssp EEECC
T ss_pred ceEec
Confidence 87653
|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 232 | ||||
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-08 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-06 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 1e-07 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 1e-06 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 7e-06 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-05 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 7e-05 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 1e-04 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 6e-04 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 5e-04 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 8e-04 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 5e-04 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 5e-04 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 5e-04 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.001 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 0.001 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 0.003 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 0.001 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 0.001 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 0.002 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 0.002 |
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 47.5 bits (113), Expect = 2e-08
Identities = 16/60 (26%), Positives = 28/60 (46%)
Query: 10 VITGVYNVNLHCPQCARKIEKRLLKIEAGIQSVDADFEKAEIKVKGVIDVIKIHKLIQKT 69
+ +NV + C C+ + K L K+E + +D EK + V + I + I+KT
Sbjct: 3 IKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKT 62
|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.63 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.61 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.6 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.52 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.49 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.49 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.48 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.46 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.46 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.44 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.43 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.43 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.42 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.42 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.42 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.38 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.37 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.36 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.34 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.33 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.33 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.33 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.32 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.31 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.28 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.25 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.23 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.22 |
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Human (Homo sapiens), HAH1 [TaxId: 9606]
Probab=99.63 E-value=8.9e-16 Score=100.89 Aligned_cols=63 Identities=22% Similarity=0.405 Sum_probs=60.0
Q ss_pred EEEEeeccCcchHHHHHHHHhccCCeeEEEEecCCCEEEEEeeCCHHHHHHHHHHhcCCcEEEec
Q 044120 103 TTLKVHIHCAQCEHDLRKKLLKHKGIYSVNADTKAQTVTVQGTIESDRLLSYLRKKVHKHAEIVT 167 (232)
Q Consensus 103 ~~l~v~m~C~~C~~ki~~~l~~~~GV~sv~vd~~~~~v~V~g~~d~~~l~~~l~k~~g~~a~i~~ 167 (232)
..|+|+|+|++|+.+|+++|.+++|+ ++.+|+.+++++|.|+++++.|+++|+ ++||.|+++.
T Consensus 3 ~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~-~~Gy~a~lig 65 (66)
T d1fe0a_ 3 HEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLG 65 (66)
T ss_dssp EEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTTSCEEEEE
T ss_pred EEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHH-HhCCeEEEee
Confidence 57889999999999999999999998 699999999999999999999999999 8999999985
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|