Citrus Sinensis ID: 044161

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGRNNAKRDSLFSNLDFNVQKHETDDEHKPGENPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDTWGWSGSIWDMN
ccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHcHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccHHHHHHHHHHHHHcccccccHccHHcccHccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcc
mqeeklskgpwheeeDELLVTFVTLFGERRWDYIAKASglkrsgkscglrwlnylcpnikhgyistEEEQIIIQLHKKWGNKWSRIArnlpgrtdneIKNYWRTRIRKKIQAQEQENFqfgrnnakrdslfsnldfnvqkhetddehkpgenpfgtdnsfdvlgfpnsafasspykiRIRDWMSelsddqskitqqggsnivescfGCQASIAEytdtwgwsgsiwdmn
mqeeklskgpwheeedELLVTFVTLFGERRWDYIAKasglkrsgkscgLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKwsriarnlpgrtdneiknYWRTRIRKKIQAQEQEnfqfgrnnakrdsLFSNLDFNVQKHetddehkpgenPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEytdtwgwsgsiwdmn
MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGRNNAKRDSLFSNLDFNVQKHETDDEHKPGENPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDTWGWSGSIWDMN
****************ELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKI*************************************************FDVLGFPNSAFASSPYKIRIRDWM**************GSNIVESCFGCQASIAEYTDTWGWSGSIW***
****KLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIR*******************************************************************************************************SIAEYTDTWGWSGSIWDMN
***********HEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGRNNAKRDSLFSNLDFNVQK*********GENPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDTWGWSGSIWDMN
********GPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGR************************************************************************************************WGWSGS*W***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFGRNNAKRDSLFSNLDFNVQKHETDDEHKPGENPFGTDNSFDVLGFPNSAFASSPYKIRIRDWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDTWGWSGSIWDMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q9LX82256 Transcription factor MYB4 no no 0.502 0.449 0.652 4e-41
Q4JL84235 Transcription factor MYB5 no no 0.502 0.489 0.617 6e-40
Q53NK6237 Myb-related protein MYBAS yes no 0.471 0.455 0.675 6e-40
Q4JL76242 Myb-related protein MYBAS no no 0.484 0.458 0.657 8e-39
P81391205 Myb-related protein 305 O N/A no 0.497 0.556 0.552 4e-35
Q9LK95226 Transcription factor MYB2 no no 0.475 0.482 0.577 9e-35
P81396198 Myb-related protein 340 O N/A no 0.480 0.555 0.585 6e-34
A2WW87 553 Transcription factor GAMY N/A no 0.449 0.186 0.592 7e-32
Q0JIC2 553 Transcription factor GAMY no no 0.449 0.186 0.592 8e-32
Q38850249 Transcription repressor M no no 0.471 0.433 0.555 7e-31
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 95/115 (82%)

Query: 1   MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIK 60
           MQEE   KGPW E+ED LLV FV LFG+RRWD+IAK SGL R+GKSC LRW+NYL P +K
Sbjct: 2   MQEEGNRKGPWTEQEDILLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLK 61

Query: 61  HGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQ 115
            G ++ +EE+++++LH KWGN+WS+IAR LPGRTDNEIKNYWRT +RKK Q +++
Sbjct: 62  RGKMTPQEERLVLELHAKWGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKR 116
Transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
359481933230 PREDICTED: myb-related protein 305 [Viti 0.995 0.991 0.567 8e-62
147860817230 hypothetical protein VITISV_042419 [Viti 0.995 0.991 0.567 1e-61
224068825234 predicted protein [Populus trichocarpa] 0.973 0.952 0.5 5e-53
356546018229 PREDICTED: myb-related protein Zm38-like 0.965 0.965 0.443 6e-47
449440415240 PREDICTED: myb-related protein MYBAS1-li 0.982 0.937 0.478 9e-47
18409792238 myb domain protein 27 [Arabidopsis thali 0.834 0.802 0.517 6e-44
255556856227 r2r3-myb transcription factor, putative 0.930 0.938 0.457 2e-43
356536975232 PREDICTED: transcription factor MYB48-li 0.969 0.956 0.451 3e-43
297820046237 AtMYB27 [Arabidopsis lyrata subsp. lyrat 0.834 0.805 0.507 4e-42
297739977123 unnamed protein product [Vitis vinifera] 0.524 0.975 0.716 1e-41
>gi|359481933|ref|XP_002265893.2| PREDICTED: myb-related protein 305 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  242 bits (618), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 159/231 (68%), Gaps = 3/231 (1%)

Query: 1   MQEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIK 60
           MQ E L KG W EEEDE L  FV L GERRWD IA+ASGLKRSGKSC LRWLNYL P++K
Sbjct: 1   MQGENLRKGSWLEEEDERLTAFVGLLGERRWDSIARASGLKRSGKSCRLRWLNYLRPDLK 60

Query: 61  HGYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQF 120
              IS EEEQII+QLHK+WGNKWS IAR+LPGRTDNEIKNYWRT +RK+ + +EQ++FQ 
Sbjct: 61  RCQISAEEEQIILQLHKRWGNKWSWIARSLPGRTDNEIKNYWRTHLRKRTEIEEQDSFQS 120

Query: 121 GRNNAKRDSLFSNLDFNVQKHETDDEHKPGENPFGTDNSFDVLGFPNSAFASSPYKIRIR 180
             +NAK+D L  + + + QK   +D     +    TD+SFD L   N AF SSPY+ R  
Sbjct: 121 EIDNAKQDFLIQS-NASTQKSNYEDCGSVEDVLGATDDSFDALALSNFAFTSSPYENRFS 179

Query: 181 DWMSELSDDQSKITQQGGSNIVESCFGCQASIAEYTDT--WGWSGSIWDMN 229
           DWMS LS D +++   G  N ++S FG  A I E  DT  W  SGS+W M+
Sbjct: 180 DWMSGLSSDLNEMKYHGEWNSLDSSFGYPAGIFEDRDTSVWDGSGSLWVMD 230

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147860817|emb|CAN81060.1| hypothetical protein VITISV_042419 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224068825|ref|XP_002326209.1| predicted protein [Populus trichocarpa] gi|222833402|gb|EEE71879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356546018|ref|XP_003541429.1| PREDICTED: myb-related protein Zm38-like [Glycine max] Back     alignment and taxonomy information
>gi|449440415|ref|XP_004137980.1| PREDICTED: myb-related protein MYBAS1-like [Cucumis sativus] gi|449533682|ref|XP_004173801.1| PREDICTED: myb-related protein MYBAS1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18409792|ref|NP_566980.1| myb domain protein 27 [Arabidopsis thaliana] gi|6630740|emb|CAB64223.1| MYB27 protein [Arabidopsis thaliana] gi|26449611|dbj|BAC41931.1| putative transcription factor MYB27 [Arabidopsis thaliana] gi|28950795|gb|AAO63321.1| At3g53200 [Arabidopsis thaliana] gi|41619294|gb|AAS10069.1| MYB transcription factor [Arabidopsis thaliana] gi|332645526|gb|AEE79047.1| myb domain protein 27 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255556856|ref|XP_002519461.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223541324|gb|EEF42875.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356536975|ref|XP_003537007.1| PREDICTED: transcription factor MYB48-like [Glycine max] Back     alignment and taxonomy information
>gi|297820046|ref|XP_002877906.1| AtMYB27 [Arabidopsis lyrata subsp. lyrata] gi|297323744|gb|EFH54165.1| AtMYB27 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297739977|emb|CBI30159.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2102013238 MYB27 "myb domain protein 27" 0.868 0.836 0.502 1.8e-46
TAIR|locus:2075236256 MYB48 "myb domain protein 48" 0.502 0.449 0.652 5.9e-41
TAIR|locus:2174324235 MYB59 "myb domain protein 59" 0.493 0.480 0.628 5.3e-40
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.694 0.591 0.474 1.9e-37
TAIR|locus:2202633243 MYB112 "myb domain protein 112 0.462 0.436 0.584 1e-36
TAIR|locus:2065226273 MYB2 "AT2G47190" [Arabidopsis 0.471 0.395 0.601 1.7e-36
TAIR|locus:2140847261 MYB79 "myb domain protein 79" 0.620 0.544 0.5 2.1e-36
TAIR|locus:2089812276 MYB121 "myb domain protein 121 0.816 0.677 0.405 3.5e-36
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.471 0.377 0.583 1.9e-35
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.868 0.880 0.393 1.3e-34
TAIR|locus:2102013 MYB27 "myb domain protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 1.8e-46, P = 1.8e-46
 Identities = 103/205 (50%), Positives = 129/205 (62%)

Query:     2 QEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKH 61
             +EE L +GPW EEEDE LV  ++L GERRWD +A  SGLKRSGKSC LRW+NYL P +K 
Sbjct:     5 KEETLRRGPWLEEEDERLVKVISLLGERRWDSLAIVSGLKRSGKSCRLRWMNYLNPTLKR 64

Query:    62 GYISTEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQEQENFQFG 121
             G +S EEE+II QLH  WGNKWS+IAR LPGRTDNEIKNYWRT  RKK +AQ        
Sbjct:    65 GPMSQEEERIIFQLHALWGNKWSKIARRLPGRTDNEIKNYWRTHYRKKQEAQNYGKLFEW 124

Query:   122 RNNAKRDSLFSNLDFNVQKHET-DDEHKPGE---NPFGTDNSFDVLGFPNSAFASSPYKI 177
             R N   + L    +  + + +T   EH   E      G + +  V G  +     SPY+ 
Sbjct:   125 RGNTGEELLHKYKETEITRTKTTSQEHGFVEVVSMESGKEANGGVGGRESFGVMKSPYEN 184

Query:   178 RIRDWMSELSDDQSK--ITQQGGSN 200
             RI DW+SE+S DQS+  +++   SN
Sbjct:   185 RISDWISEISTDQSEANLSEDHSSN 209
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0010200 "response to chitin" evidence=IEP
TAIR|locus:2075236 MYB48 "myb domain protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174324 MYB59 "myb domain protein 59" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140847 MYB79 "myb domain protein 79" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089812 MYB121 "myb domain protein 121" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AtMYB27
AtMYB27 (myb domain protein 27); DNA binding / transcription factor; Member of the R2R3 factor gene family. (238 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AN3
AN3 (ANGUSTIFOLIA 3); protein binding / transcription coactivator; Encodes a protein with simil [...] (210 aa)
      • 0.675
ATAN11
ATAN11 (ANTHOCYANIN11); nucleotide binding; Encodes a protein with similarity to the petunia WD [...] (346 aa)
      • 0.675
NTL
nuclear transport factor 2 (NTF2), putative; NTF2-like (NTL); FUNCTIONS IN- protein transporter [...] (132 aa)
      • 0.538
DFR
DFR (DIHYDROFLAVONOL 4-REDUCTASE); dihydrokaempferol 4-reductase; dihydroflavonol reductase. Ca [...] (382 aa)
      • 0.435

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 4e-38
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 3e-35
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 5e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 8e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-07
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-06
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  132 bits (333), Expect = 4e-38
 Identities = 60/108 (55%), Positives = 81/108 (75%)

Query: 6   LSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYIS 65
           + +GPW  EEDE+LV+F+   GE RW  + K +GL R GKSC LRW+NYL P++K G I+
Sbjct: 23  MKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGIT 82

Query: 66  TEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQ 113
           ++EE +I++LH+  GN+WS IA  +PGRTDNEIKNYW T +RKK+  Q
Sbjct: 83  SDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQ 130

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.75
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.73
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.71
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.66
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.65
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.54
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.54
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.4
PLN03212249 Transcription repressor MYB5; Provisional 99.27
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.26
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.25
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.21
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.2
PLN03091 459 hypothetical protein; Provisional 99.2
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.14
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.08
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.89
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.62
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.13
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.98
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.46
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.41
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.38
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.23
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.23
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.14
KOG1279506 consensus Chromatin remodeling factor subunit and 97.08
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.04
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.01
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.99
KOG1279506 consensus Chromatin remodeling factor subunit and 96.97
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.88
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.83
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.7
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.46
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.23
PRK13923170 putative spore coat protein regulator protein YlbO 96.09
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.89
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.75
PRK13923170 putative spore coat protein regulator protein YlbO 95.55
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 94.75
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.1
KOG4282 345 consensus Transcription factor GT-2 and related pr 92.23
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.18
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.11
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 91.26
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.15
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.35
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.18
KOG4282345 consensus Transcription factor GT-2 and related pr 87.04
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 86.14
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 85.39
KOG4167907 consensus Predicted DNA-binding protein, contains 84.72
KOG1194 534 consensus Predicted DNA-binding protein, contains 82.6
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-35  Score=257.31  Aligned_cols=113  Identities=49%  Similarity=0.885  Sum_probs=107.9

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHhCCCChhHHHHhhCCCCCcccccccccccccCCCCCCCCCHHHHHHHHHHHHHhCC
Q 044161            2 QEEKLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGN   81 (229)
Q Consensus         2 ~~~~~kkg~WT~eEDe~L~~lv~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~~~L~p~~~~~~WT~eEd~~L~~~v~~~G~   81 (229)
                      .++.+.||+||+|||++|+.+|.+||.++|..||+.+|++|++++||.||+|||+|.+++|.||+|||.+|++++..+|+
T Consensus         3 kk~~~~kGpWt~EED~~L~~~V~~~G~~~W~~i~k~~gl~R~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GN   82 (238)
T KOG0048|consen    3 RNPELVKGPWTQEEDLTQIRSIKSFGKHNGTALPKLAGLRRCGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGN   82 (238)
T ss_pred             CCccccCCCCChHHHHHHHHHHHHhCCCCcchhhhhcCCCccchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCc
Confidence            34556789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHhhCCCCCHHHHHHHHHHhhhHHHHHHh
Q 044161           82 KWSRIARNLPGRTDNEIKNYWRTRIRKKIQAQE  114 (229)
Q Consensus        82 ~W~~Ia~~l~gRt~~qiknrw~~~l~~~~~~~~  114 (229)
                      +|+.||++|||||++.|||+|++.+++++....
T Consensus        83 rWs~IA~~LPGRTDNeIKN~Wnt~lkkkl~~~~  115 (238)
T KOG0048|consen   83 RWSLIAGRLPGRTDNEVKNHWNTHLKKKLLKMG  115 (238)
T ss_pred             HHHHHHhhCCCcCHHHHHHHHHHHHHHHHHHcC
Confidence            999999999999999999999999999887765

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-22
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-22
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-22
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-22
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 3e-21
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 6e-15
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 1e-12
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 8e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-09
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-06
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 3e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 4e-06
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (67%), Gaps = 3/106 (2%)
Query: 6   LSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLK-RSGKSCGLRWLNYLCPNIKHGYI 64
           L KGPW +EED+ ++  V  +G +RW  IAK   LK R GK C  RW N+L P +K    
Sbjct: 56  LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKH--LKGRIGKQCRERWHNHLNPEVKKTSW 113
Query: 65  STEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKI 110
           + EE++II Q HK+ GN+W+ IA+ LPGRTDN IKN+W + +R+K+
Sbjct: 114 TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 159
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-53
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-52
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-52
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-49
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-48
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 9e-46
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-18
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 7e-05
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-17
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-15
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-04
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 7e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-04
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-04
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 2e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 7e-04
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 7e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  165 bits (421), Expect = 4e-53
 Identities = 50/106 (47%), Positives = 71/106 (66%), Gaps = 1/106 (0%)

Query: 5   KLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYI 64
           +L KGPW +EED+ ++  V  +G +RW  IAK     R GK C  RW N+L P +K    
Sbjct: 1   ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59

Query: 65  STEEEQIIIQLHKKWGNKWSRIARNLPGRTDNEIKNYWRTRIRKKI 110
           + EE++II Q HK+ GN+W+ IA+ LPGRTDN IKN+W + +R+K+
Sbjct: 60  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.98
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.88
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.84
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.83
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.78
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.77
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.76
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.75
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.75
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.74
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.74
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.73
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.71
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.68
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.67
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.66
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.65
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.65
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.65
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.64
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.62
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.6
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.59
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.59
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.59
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.58
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.55
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.54
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.53
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.53
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.53
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.52
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.24
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.22
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.48
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.47
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.44
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.44
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.42
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.39
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.38
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.35
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.32
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.29
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.28
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.27
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.25
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.22
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.2
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.11
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.01
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.0
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.82
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.82
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.77
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.69
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.64
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.63
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.57
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.56
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.42
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.27
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.23
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.19
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.18
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.13
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.42
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.05
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.01
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.94
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.87
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.67
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.66
2crg_A70 Metastasis associated protein MTA3; transcription 97.64
2crg_A70 Metastasis associated protein MTA3; transcription 97.63
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.6
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.42
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.34
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.19
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.09
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.97
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.49
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.14
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.85
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.91
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 91.96
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 90.4
2rq5_A121 Protein jumonji; developmental protein, nucleus, r 81.55
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=8.8e-36  Score=227.15  Aligned_cols=104  Identities=48%  Similarity=0.908  Sum_probs=99.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCChhHHHHhhCCCCCcccccccccccccCCCCCCCCCHHHHHHHHHHHHHhCCCHH
Q 044161            5 KLSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPNIKHGYISTEEEQIIIQLHKKWGNKWS   84 (229)
Q Consensus         5 ~~kkg~WT~eEDe~L~~lv~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~~~L~p~~~~~~WT~eEd~~L~~~v~~~G~~W~   84 (229)
                      .+++|+||+|||++|+++|.+||.++|..||+.|| ||++.||++||.++|+|.+++++||+|||.+|+++|.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            47899999999999999999999889999999998 99999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCCHHHHHHHHHHhhhHH
Q 044161           85 RIARNLPGRTDNEIKNYWRTRIRKK  109 (229)
Q Consensus        85 ~Ia~~l~gRt~~qiknrw~~~l~~~  109 (229)
                      .||+.|||||+++|++||+.+++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~  104 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRK  104 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC--
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999875
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2rq5_A Protein jumonji; developmental protein, nucleus, repressor, transcription, transcription regulation; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-14
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 8e-09
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-13
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-08
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 4e-13
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-13
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-07
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-10
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-10
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-04
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 0.002
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-09
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 5e-08
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 7e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 6e-06
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-05
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 0.003
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 63.8 bits (155), Expect = 3e-14
 Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 6/79 (7%)

Query: 8  KGPWHEEEDELLVTFVTLFGERR-----WDYIAKASGLKRSGKSCGLRWLNYLCPNIKHG 62
          K  + +EEDE ++  V     RR     +D I+       +G S   R+  YL   +++ 
Sbjct: 1  KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYV 59

Query: 63 YISTEEEQIIIQLHKKWGN 81
          Y   +  +++         
Sbjct: 60 YEVDKFGKLVRDDDGNLIK 78
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.8
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.79
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.68
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.67
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.66
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.64
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.61
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.6
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.5
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.49
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.48
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.47
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.46
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.41
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.39
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.38
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.38
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.34
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.2
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.18
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.18
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.15
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.97
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.18
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.17
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.16
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.15
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.53
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.87
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.22
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.18
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.58
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.49
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.28
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 88.83
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 87.62
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 83.63
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.80  E-value=8.6e-21  Score=125.55  Aligned_cols=52  Identities=48%  Similarity=0.917  Sum_probs=50.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCChhHHHHhhCCCCCcccccccccccccCC
Q 044161            6 LSKGPWHEEEDELLVTFVTLFGERRWDYIAKASGLKRSGKSCGLRWLNYLCPN   58 (229)
Q Consensus         6 ~kkg~WT~eEDe~L~~lv~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~~~L~p~   58 (229)
                      ++||+||+|||++|+++|.+||.++|..||+.|| +||+.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            5899999999999999999999889999999999 999999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure