Citrus Sinensis ID: 044180
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| 147843077 | 1366 | hypothetical protein VITISV_044100 [Viti | 0.584 | 0.055 | 0.473 | 8e-12 | |
| 147774273 | 1469 | hypothetical protein VITISV_026680 [Viti | 0.584 | 0.051 | 0.473 | 1e-11 | |
| 147772855 | 1308 | hypothetical protein VITISV_003711 [Viti | 0.776 | 0.077 | 0.394 | 3e-11 | |
| 170660047 | 953 | polyprotein [Ananas comosus] | 0.792 | 0.108 | 0.368 | 4e-11 | |
| 147773289 | 1575 | hypothetical protein VITISV_003835 [Viti | 0.607 | 0.050 | 0.430 | 1e-10 | |
| 89887334 | 1359 | polyprotein [Primula vulgaris] | 0.607 | 0.058 | 0.443 | 1e-10 | |
| 147789424 | 2822 | hypothetical protein VITISV_017554 [Viti | 0.653 | 0.030 | 0.426 | 1e-10 | |
| 225016150 | 1261 | retrotransposon protein [Glycine max] gi | 0.607 | 0.062 | 0.430 | 1e-10 | |
| 359479937 | 787 | PREDICTED: uncharacterized protein LOC10 | 0.7 | 0.115 | 0.397 | 3e-10 | |
| 147842329 | 522 | hypothetical protein VITISV_041623 [Viti | 0.692 | 0.172 | 0.380 | 8e-10 |
| >gi|147843077|emb|CAN83300.1| hypothetical protein VITISV_044100 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 75.1 bits (183), Expect = 8e-12, Method: Compositional matrix adjust.
Identities = 36/76 (47%), Positives = 47/76 (61%)
Query: 33 VDVSNGEQIRSEGHCSKVKFEMQGVEFEADFHILDFFGANAVLAVQWLEKLGKIVTDHKA 92
V V+NG+ +RSEG C+ V MQG + DF+IL G + VL VQWL+ LG I+ D
Sbjct: 373 VKVANGQAVRSEGSCAAVPLHMQGNLYTIDFYILTLGGCDIVLGVQWLQTLGPILWDFSR 432
Query: 93 LTMEFTYRGQPIKLVG 108
L MEF+ +P KL G
Sbjct: 433 LQMEFSVWDKPRKLQG 448
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147774273|emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147772855|emb|CAN73669.1| hypothetical protein VITISV_003711 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|170660047|gb|ACB28472.1| polyprotein [Ananas comosus] | Back alignment and taxonomy information |
|---|
| >gi|147773289|emb|CAN64782.1| hypothetical protein VITISV_003835 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|89887334|gb|ABD78322.1| polyprotein [Primula vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|147789424|emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225016150|gb|ACN78974.1| retrotransposon protein [Glycine max] gi|225016158|gb|ACN78981.1| retrotransposon protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359479937|ref|XP_002269588.2| PREDICTED: uncharacterized protein LOC100257206 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147842329|emb|CAN76208.1| hypothetical protein VITISV_041623 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029562001 | SubName- Full=Chromosome chr9 scaffold_49, whole genome shotgun sequence; (219 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| cd00303 | 92 | cd00303, retropepsin_like, Retropepsins; pepsin-li | 4e-07 |
| >gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
Score = 44.6 bits (106), Expect = 4e-07
Identities = 14/45 (31%), Positives = 22/45 (48%)
Query: 37 NGEQIRSEGHCSKVKFEMQGVEFEADFHILDFFGANAVLAVQWLE 81
NG +++ G V + G F DF++LD + +L WLE
Sbjct: 48 NGSSVKTLGVILPVTIGIGGKTFTVDFYVLDLLSYDVILGRPWLE 92
|
The family includes pepsin-like aspartate proteases from retroviruses, retrotransposons and retroelements, as well as eukaryotic dna-damage-inducible proteins (DDIs), and bacterial aspartate peptidases. While fungal and mammalian pepsins are bilobal proteins with structurally related N and C-terminals, retropepsins are half as long as their fungal and mammalian counterparts. The monomers are structurally related to one lobe of the pepsin molecule and retropepsins function as homodimers. The active site aspartate occurs within a motif (Asp-Thr/Ser-Gly), as it does in pepsin. Retroviral aspartyl protease is synthesized as part of the POL polyprotein that contains an aspartyl protease, a reverse transcriptase, RNase H, and an integrase. The POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. In aspartate peptidases, Asp residues are ligands of an activated water molecule in all examples where catalytic residues have been identified. This group of aspartate peptidases is classified by MEROPS as the peptidase family A2 (retropepsin family, clan AA), subfamily A2A. Length = 92 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 99.83 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 99.53 | |
| cd05484 | 91 | retropepsin_like_LTR_2 Retropepsins_like_LTR, peps | 98.93 | |
| PF02160 | 201 | Peptidase_A3: Cauliflower mosaic virus peptidase ( | 98.2 | |
| cd00303 | 92 | retropepsin_like Retropepsins; pepsin-like asparta | 98.16 | |
| TIGR03698 | 107 | clan_AA_DTGF clan AA aspartic protease, AF_0612 fa | 97.84 | |
| PF09668 | 124 | Asp_protease: Aspartyl protease; InterPro: IPR0191 | 97.59 | |
| PF00077 | 100 | RVP: Retroviral aspartyl protease The Prosite entr | 97.4 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 97.29 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 97.28 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 96.97 | |
| cd05480 | 103 | NRIP_C NRIP_C; putative nuclear receptor interacti | 96.32 | |
| cd06094 | 89 | RP_Saci_like RP_Saci_like, retropepsin family. Ret | 96.03 | |
| cd06095 | 86 | RP_RTVL_H_like Retropepsin of the RTVL_H family of | 95.43 | |
| COG5550 | 125 | Predicted aspartyl protease [Posttranslational mod | 94.51 | |
| cd05481 | 93 | retropepsin_like_LTR_1 Retropepsins_like_LTR; peps | 91.9 | |
| KOG0012 | 380 | consensus DNA damage inducible protein [Replicatio | 91.13 | |
| PF12384 | 177 | Peptidase_A2B: Ty3 transposon peptidase; InterPro: | 89.07 |
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
Probab=99.83 E-value=5.9e-21 Score=139.86 Aligned_cols=70 Identities=33% Similarity=0.593 Sum_probs=64.2
Q ss_pred CceeEEeeCCCeEeecceeeccEEeecCEEEEceeEEeecCCcceeecccchhccCceEEeccccEEEEEeC
Q 044180 29 MSFLVDVSNGEQIRSEGHCSKVKFEMQGVEFEADFHILDFFGANAVLAVQWLEKLGKIVTDHKALTMEFTYR 100 (130)
Q Consensus 29 ~~~~V~vanG~~l~~~~~c~~~~~~iqg~~f~~dl~vL~l~g~DvILGmdWL~~~g~i~iD~~~~tl~f~~~ 100 (130)
.++.|. ++|+.+.|.+.|++++|.+||++|..||++|++++||||||||||++|+| .|||.+++++|+..
T Consensus 63 ~~~~V~-~~g~~~~~~~~~~~~~~~i~g~~~~~dl~vl~l~~~DvILGm~WL~~~~~-~IDw~~k~v~f~~p 132 (135)
T PF08284_consen 63 RPIVVS-APGGSINCEGVCPDVPLSIQGHEFVVDLLVLDLGGYDVILGMDWLKKHNP-VIDWATKTVTFNSP 132 (135)
T ss_pred CeeEEe-cccccccccceeeeEEEEECCeEEEeeeEEecccceeeEeccchHHhCCC-EEEccCCEEEEeCC
Confidence 345555 67888999999999999999999999999999999999999999999999 89999999999843
|
These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases. |
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family | Back alignment and domain information |
|---|
| >PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein | Back alignment and domain information |
|---|
| >cd06094 RP_Saci_like RP_Saci_like, retropepsin family | Back alignment and domain information |
|---|
| >cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements | Back alignment and domain information |
|---|
| >COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats | Back alignment and domain information |
|---|
| >KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| 3s8i_A | 148 | Protein DDI1 homolog 1; protease, structural genom | 99.34 | |
| 2i1a_A | 148 | DNA damage-inducible protein DDI1; acid protease f | 98.93 | |
| 3slz_A | 132 | GAG-Pro-POL polyprotein; beta sheet and dimer, pro | 95.15 | |
| 1fmb_A | 104 | EIAV protease; hydrolase (acid proteinase), RNA-di | 91.89 | |
| 3ec0_A | 99 | Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 | 90.98 | |
| 2hs1_A | 99 | HIV-1 protease; ultra-high resolution active site | 89.58 |
| >3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.34 E-value=8.9e-13 Score=96.80 Aligned_cols=80 Identities=14% Similarity=0.138 Sum_probs=65.9
Q ss_pred eEEeeCCCeEeecceeeccEEeecCEEEEceeEEeecCCcceeecccchhccCceEEeccccEEEEEeCCeEEEEEeccC
Q 044180 32 LVDVSNGEQIRSEGHCSKVKFEMQGVEFEADFHILDFFGANAVLAVQWLEKLGKIVTDHKALTMEFTYRGQPIKLVGAQN 111 (130)
Q Consensus 32 ~V~vanG~~l~~~~~c~~~~~~iqg~~f~~dl~vL~l~g~DvILGmdWL~~~g~i~iD~~~~tl~f~~~g~~I~l~G~~~ 111 (130)
.+.++..+...+.+.++.++++|++..|..++.|+|...+|+|||||||.+++. .|||++++|+|...++.|.+-+..+
T Consensus 68 ~~~a~g~G~~~~~g~v~~~~I~Ig~~~~~~~~~Vle~~~~d~LLGmD~L~~~~~-~ID~~~~~L~l~~~~~~~pfl~~~~ 146 (148)
T 3s8i_A 68 AGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQC-SIDLKKNVLVIGTTGTQTYFLPEGE 146 (148)
T ss_dssp CEECCC---CEEEEEEEEEEEEETTEEEEEEEEEETTCSSSEEECHHHHHHTTC-EEETTTTEEECTTTCCEEECCCGGG
T ss_pred eEEEEcCCccEEEEEEEEEEEEECCEEEEEEEEEeCCCCcCeeccHHHHHhCCE-EEEcCCCEEEEccCCeEEeecCccc
Confidence 344444345567778999999999999999999999999999999999999986 9999999999987778888766544
Q ss_pred C
Q 044180 112 I 112 (130)
Q Consensus 112 ~ 112 (130)
+
T Consensus 147 ~ 147 (148)
T 3s8i_A 147 L 147 (148)
T ss_dssp C
T ss_pred C
Confidence 3
|
| >2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* | Back alignment and structure |
|---|
| >1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* | Back alignment and structure |
|---|
| >3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... | Back alignment and structure |
|---|
| >2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00