Citrus Sinensis ID: 044274

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MVAKMGKRTPTKTFKHQRRHHHRKKSPAKTASAATIISSINKSLHTCKRRLARIFSKLVRITTPSRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGERYEKLEEM
ccccccccccccHHHHHHHccccccccccccccHHHcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEcccccccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccccEEccccccccccccEEEccccccccccccccEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
cccHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEcccccccccccEEEEEEEccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEHccEEccccHHHcHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccHcHHHHHHHcccHHHHHHHHcc
mvakmgkrtptktfkhqrrhhhrkkspaktaSAATIISSINKSLHTCKRRLARIFSKLVrittpsrcktkgykilrsqdkdsnsngedqllvpqvlffgnehllpplispdkktiFLDLDetlihskpdppperfdfivrpridgevlNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRldrngvishrlyrdsckqIDGKFVKDLSEMGrnlkqpenaipvkpftgdpsdiELWKLVNFFEACDCFVDMRDAVKAFDLGERYEKLEEM
mvakmgkrtptktfkhqrrhhhrkkspaktasaaTIISSINKSLHTCKRRLARIfsklvrittpsrcktkgykilrsqdkdsnsngEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETlihskpdppperFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVIShrlyrdsckqiDGKFVKDLSEMGRnlkqpenaipvkpFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDlgeryekleem
MVAKMGKRTPTKTFkhqrrhhhrkkspaktasaatiissinksLHTCKRRLARIFSKLVRITTPSRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGERYEKLEEM
**********************************TIISSINKSLHTCKRRLARIFSKLVRITTPSRCKTKGYKIL**************LLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIH********RFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDL***************VKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLG*********
******************************************************************************************************LLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGER*E*L***
*********************************ATIISSINKSLHTCKRRLARIFSKLVRITTPSRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGERYEKLEEM
******************************************SLHTCKRRLARIFSKLVRITT*********KI********NSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGERYEK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAKMGKRTPTKTFKHQRRHHHRKKSPAKTASAATIISSINKSLHTCKRRLARIFSKLVRITTPSRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLKQPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAFDLGERYEKLEEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query278 2.2.26 [Sep-21-2011]
Q07949397 Probable phosphatase PSR2 yes no 0.546 0.382 0.414 9e-29
Q9PTJ6275 CTD small phosphatase-lik yes no 0.758 0.767 0.382 1e-28
Q09695325 Uncharacterized protein C yes no 0.571 0.489 0.423 4e-28
O15194276 CTD small phosphatase-lik yes no 0.543 0.547 0.434 5e-27
P58465276 CTD small phosphatase-lik yes no 0.543 0.547 0.434 8e-27
Q07800427 Phosphatase PSR1 OS=Sacch no no 0.546 0.355 0.396 5e-26
Q9XYL0306 Probable C-terminal domai no no 0.489 0.444 0.451 1e-25
O14595271 Carboxy-terminal domain R no no 0.532 0.546 0.418 3e-25
Q8BX07270 Carboxy-terminal domain R no no 0.532 0.548 0.412 5e-25
Q9GZU7261 Carboxy-terminal domain R no no 0.503 0.536 0.425 2e-24
>sp|Q07949|PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSR2 PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 101/169 (59%), Gaps = 17/169 (10%)

Query: 99  GNEHLLPPLISP--DKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRP 156
           G + LLPP +     KK + LDLDETL+HS         DF++   ID +V N YV+KRP
Sbjct: 212 GYDTLLPPKLQEFQQKKCLILDLDETLVHSSFKYM-HSADFVLPVEIDDQVHNVYVIKRP 270

Query: 157 GVDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLS 216
           GVD FL+ +S+ YEVVVFTA +  YA+ LL+ LD NG I HRL+R++C   +G ++K+LS
Sbjct: 271 GVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREACYNYEGNYIKNLS 330

Query: 217 EMGRNLKQ--------------PENAIPVKPFTGDPSDIELWKLVNFFE 251
           ++GR L +              P++A+P+  +  D  D EL  ++   E
Sbjct: 331 QIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLE 379
Probable phosphatase. Involved in the response to sodium and lithium ion stress (but not to potassium or sorbitol stress) by inducing transcription of the sodium pump ENA1/PMR2. Acts through a calcineurin-independent pathway and is functionally redundant with PSR1. Also involved in the general stress response; acts together with WHI2 to activate stress response element (STRE)-mediated gene expression, possibly through dephosphorylation of MSN2.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -
>sp|Q9PTJ6|CTDSL_CHICK CTD small phosphatase-like protein OS=Gallus gallus GN=NFI1 PE=2 SV=2 Back     alignment and function description
>sp|Q09695|YA22_SCHPO Uncharacterized protein C2F7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.02c PE=1 SV=1 Back     alignment and function description
>sp|O15194|CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens GN=CTDSPL PE=1 SV=2 Back     alignment and function description
>sp|P58465|CTDSL_MOUSE CTD small phosphatase-like protein OS=Mus musculus GN=Ctdspl PE=2 SV=3 Back     alignment and function description
>sp|Q07800|PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9XYL0|CTDS_DICDI Probable C-terminal domain small phosphatase OS=Dictyostelium discoideum GN=fcpA PE=3 SV=1 Back     alignment and function description
>sp|O14595|CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens GN=CTDSP2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BX07|CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus GN=Ctdsp2 PE=2 SV=1 Back     alignment and function description
>sp|Q9GZU7|CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens GN=CTDSP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
449433684274 PREDICTED: CTD small phosphatase-like pr 0.913 0.927 0.607 2e-88
449508573273 PREDICTED: CTD small phosphatase-like pr 0.913 0.930 0.607 3e-88
255562534300 Carboxy-terminal domain RNA polymerase I 0.960 0.89 0.600 2e-87
307136185275 carboxy-terminal domain RNA polymerase I 0.917 0.927 0.607 6e-87
225443704285 PREDICTED: CTD small phosphatase-like pr 0.949 0.926 0.558 2e-80
147765860 880 hypothetical protein VITISV_026605 [Viti 0.895 0.282 0.566 1e-76
357447063294 CTD small phosphatase-like protein [Medi 0.920 0.870 0.522 1e-66
356546546344 PREDICTED: carboxy-terminal domain RNA p 0.949 0.767 0.482 3e-64
224114601168 predicted protein [Populus trichocarpa] 0.550 0.910 0.706 7e-62
224076920168 predicted protein [Populus trichocarpa] 0.550 0.910 0.706 8e-62
>gi|449433684|ref|XP_004134627.1| PREDICTED: CTD small phosphatase-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 170/280 (60%), Positives = 212/280 (75%), Gaps = 26/280 (9%)

Query: 1   MVAKMGKRTPTKTFKHQRRHHHRKKSPAKTASAATIISSINKSLHTCKRRLARIFSKLVR 60
           MV+K+ KR+PT  F+      HR+KSP K A +A ++++IN+SL+TC RRL +IFSKL R
Sbjct: 1   MVSKIIKRSPTNPFRR-----HRRKSPIKNAPSA-VVATINRSLYTCHRRLLKIFSKLAR 54

Query: 61  ITTPSRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLD 120
           I+TP+R   KGYK LR   K ++S+ E +  + + L F N  LLPPLI P K+T+ LDLD
Sbjct: 55  ISTPNR--HKGYKSLR---KTNSSSSESEPDIVRTLVFDN-RLLPPLIYPAKRTVLLDLD 108

Query: 121 ETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKE 180
           ETL+HSK DPPP +FDF+VRPRIDGEVLNFYVLKRPGVD FL+A++ KYE+VVFTAGLKE
Sbjct: 109 ETLVHSKLDPPPAKFDFVVRPRIDGEVLNFYVLKRPGVDQFLEALADKYEIVVFTAGLKE 168

Query: 181 YASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLK--------------QPE 226
           YASL+LN LD+  VISHRLYRDSCK++DGK+VKDLSE+GR+L+              QPE
Sbjct: 169 YASLVLNHLDKKSVISHRLYRDSCKEVDGKYVKDLSEIGRDLRRVVIVDDNPNAYVYQPE 228

Query: 227 NAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVKAF 266
           NAIP+  F  DP+D EL KLV FFE CDC+ DMRDAVK +
Sbjct: 229 NAIPITSFVDDPADTELRKLVRFFEVCDCYDDMRDAVKQY 268

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449508573|ref|XP_004163350.1| PREDICTED: CTD small phosphatase-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255562534|ref|XP_002522273.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase, putative [Ricinus communis] gi|223538526|gb|EEF40131.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|307136185|gb|ADN34024.1| carboxy-terminal domain RNA polymerase II polypeptide a small phosphatase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|225443704|ref|XP_002264996.1| PREDICTED: CTD small phosphatase-like protein-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147765860|emb|CAN66698.1| hypothetical protein VITISV_026605 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447063|ref|XP_003593807.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355482855|gb|AES64058.1| CTD small phosphatase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356546546|ref|XP_003541686.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224114601|ref|XP_002316807.1| predicted protein [Populus trichocarpa] gi|222859872|gb|EEE97419.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224076920|ref|XP_002305050.1| predicted protein [Populus trichocarpa] gi|222848014|gb|EEE85561.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
TAIR|locus:2171978272 AT5G45700 [Arabidopsis thalian 0.683 0.698 0.474 1.1e-41
TAIR|locus:2019332278 AT1G29770 [Arabidopsis thalian 0.579 0.579 0.502 6.1e-39
TAIR|locus:2019352221 AT1G29780 [Arabidopsis thalian 0.546 0.687 0.497 5.5e-38
WB|WBGene00007054491 scpl-1 [Caenorhabditis elegans 0.579 0.327 0.413 2.3e-28
POMBASE|SPAC2F7.02c325 SPAC2F7.02c "NLI interacting f 0.571 0.489 0.423 3.9e-28
SGD|S000004009397 PSR2 "Functionally redundant P 0.546 0.382 0.414 3.9e-28
CGD|CAL0005162441 orf19.5406 [Candida albicans ( 0.503 0.317 0.412 4.4e-28
UNIPROTKB|Q5A7R0441 PSR1 "Putative uncharacterized 0.503 0.317 0.412 4.4e-28
UNIPROTKB|Q9PTJ6275 NFI1 "CTD small phosphatase-li 0.723 0.730 0.389 1.3e-27
DICTYBASE|DDB_G0294376306 fcpA "putative CTD phosphatase 0.564 0.513 0.434 5.7e-27
TAIR|locus:2171978 AT5G45700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 442 (160.7 bits), Expect = 1.1e-41, P = 1.1e-41
 Identities = 104/219 (47%), Positives = 134/219 (61%)

Query:    65 SRCKTKGYKILRSQDKDSNSNGEDQLLVPQVLFFGNEHLLPPLISPDKKTIFLDLDETLI 124
             SR  TKG+KIL+ ++   NS        P  LF              KKTI LDLDETL+
Sbjct:    61 SRHATKGFKILKPREDFQNS--------PYSLFHERSG---KSFDETKKTIVLDLDETLV 109

Query:   125 HSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASL 184
             HS  + P   +DF+V P+IDG++L F+V+KRPGVD FL  I +KY++VVFTAGL+EYASL
Sbjct:   110 HSSMEKPEVPYDFVVNPKIDGQILTFFVIKRPGVDEFLKKIGEKYQIVVFTAGLREYASL 169

Query:   185 LLNRLD-RNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLK--------------QPENAI 229
             +L++LD    VIS   YRD+C +IDG+ VKDL  + R+L+              QPENA 
Sbjct:   170 VLDKLDPERRVISRSFYRDACSEIDGRLVKDLGFVMRDLRRVVIVDDNPNSYALQPENAF 229

Query:   230 PVKPFTGDPSDIELWKLVNFFEACDC--FVDMRDAVKAF 266
             P+KPF+ D  D+EL KL  F    DC  F DMR A+K F
Sbjct:   230 PIKPFSDDLEDVELKKLGEFLYG-DCVKFEDMRVALKEF 267
GO:0005739 "mitochondrion" evidence=ISM
GO:0016791 "phosphatase activity" evidence=IEA
GO:0001708 "cell fate specification" evidence=RCA
TAIR|locus:2019332 AT1G29770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019352 AT1G29780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00007054 scpl-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC2F7.02c SPAC2F7.02c "NLI interacting factor family phosphatase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000004009 PSR2 "Functionally redundant Psr1p homolog" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0005162 orf19.5406 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A7R0 PSR1 "Putative uncharacterized protein PSR1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PTJ6 NFI1 "CTD small phosphatase-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0294376 fcpA "putative CTD phosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 2e-52
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 2e-44
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 3e-44
COG5190390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 5e-25
TIGR02250156 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph 1e-10
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information 
 Score =  168 bits (427), Expect = 2e-52
 Identities = 78/157 (49%), Positives = 101/157 (64%), Gaps = 15/157 (9%)

Query: 112 KKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEV 171
           KKT+ LDLDETL+HS    P    DF V   IDG+++  YV KRP VD FL+ +SK YE+
Sbjct: 1   KKTLVLDLDETLVHSTFKMPKVDADFKVPVLIDGKIIPVYVFKRPHVDEFLERVSKWYEL 60

Query: 172 VVFTAGLKEYASLLLNRLDR-NGVISHRLYRDSCKQIDGKFVKDLSEMGRNLK------- 223
           V+FTA L+EYA  +L+ LDR   VIS RLYR+SC   +GK+VKDLS +G++L        
Sbjct: 61  VIFTASLEEYADPVLDILDRGGKVISRRLYRESCVFTNGKYVKDLSLVGKDLSKVIIIDN 120

Query: 224 -------QPENAIPVKPFTGDPSDIELWKLVNFFEAC 253
                  QP+NAIP+K + GDP+D EL  L+ F E  
Sbjct: 121 SPYSYSLQPDNAIPIKSWFGDPNDTELLNLIPFLEGL 157

This model represents the putative phosphatase domain of a family of eukaryotic proteins including "Dullard" , and the NLI interacting factor (NIF)-like phosphatases. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDNxPxxa) and aparrently lacking the last aspartate. This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the pfam03031. Length = 162
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 278
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 100.0
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 100.0
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 99.97
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.92
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.9
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.9
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.36
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.03
PHA03398303 viral phosphatase superfamily protein; Provisional 97.95
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 97.61
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.46
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 97.34
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.34
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 97.2
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 96.91
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 96.86
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 96.85
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.69
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 96.27
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.27
COG4996164 Predicted phosphatase [General function prediction 96.24
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 96.15
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 96.07
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 96.06
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 95.83
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 95.82
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 95.68
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 95.67
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 95.67
PRK08238 479 hypothetical protein; Validated 95.62
PRK13225273 phosphoglycolate phosphatase; Provisional 95.48
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 95.48
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 95.06
PHA02530300 pseT polynucleotide kinase; Provisional 94.79
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 94.63
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 94.5
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 93.86
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 93.85
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 93.75
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 93.7
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 93.51
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 92.87
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 92.67
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 92.63
COG0241181 HisB Histidinol phosphatase and related phosphatas 92.58
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 92.33
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 92.32
PRK10513 270 sugar phosphate phosphatase; Provisional 92.3
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 91.78
PRK01158230 phosphoglycolate phosphatase; Provisional 91.75
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 91.54
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 91.53
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 91.49
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 91.1
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 91.01
PRK10444 248 UMP phosphatase; Provisional 90.82
TIGR01486 256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 90.58
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 90.39
PLN02645 311 phosphoglycolate phosphatase 90.3
PRK10976266 putative hydrolase; Provisional 90.04
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 89.85
PTZ00174247 phosphomannomutase; Provisional 89.63
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 89.54
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 89.39
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 89.31
TIGR01458 257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 89.24
TIGR01675229 plant-AP plant acid phosphatase. This model explic 88.84
COG2503274 Predicted secreted acid phosphatase [General funct 88.66
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 88.27
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 88.13
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 87.8
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 87.34
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 87.27
PRK09449224 dUMP phosphatase; Provisional 87.06
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 86.89
PRK06769173 hypothetical protein; Validated 86.48
TIGR01485 249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 86.47
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 86.43
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 86.17
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 85.54
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 85.41
PRK13288214 pyrophosphatase PpaX; Provisional 85.32
PLN02770248 haloacid dehalogenase-like hydrolase family protei 85.23
PLN02423245 phosphomannomutase 84.96
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 84.83
PLN02887 580 hydrolase family protein 84.54
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 84.38
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 84.38
COG4359220 Uncharacterized conserved protein [Function unknow 84.34
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 84.26
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 84.12
PRK13582205 thrH phosphoserine phosphatase; Provisional 84.07
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 83.89
TIGR01457 249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 83.89
PRK13222226 phosphoglycolate phosphatase; Provisional 83.26
PHA02597197 30.2 hypothetical protein; Provisional 83.1
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 82.57
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 82.33
PLN02151 354 trehalose-phosphatase 82.1
PRK11587218 putative phosphatase; Provisional 81.81
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 81.45
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 81.4
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 81.39
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 81.0
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 80.78
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 80.27
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 80.15
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-41  Score=308.63  Aligned_cols=158  Identities=51%  Similarity=0.781  Sum_probs=149.3

Q ss_pred             CCCCeEEEEeCCCceeeccC-CCCCCCCceEEeeccCCceeeEEEEeCcCHHHHHHHHhhcceEEEEcCCchHHHHHHHH
Q 044274          109 SPDKKTIFLDLDETLIHSKP-DPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKEYASLLLN  187 (278)
Q Consensus       109 ~~~KktLVLDLDeTLIhs~~-~~~~~~~Df~v~~~~~~~~~~~~v~~RP~l~eFL~~l~~~fEIvI~Taa~~~YA~~vl~  187 (278)
                      ..+|+||||||||||||++. .++....||++++++++....+||.+|||+++||+.++++||+|||||+.+.||++|++
T Consensus        86 ~~~kk~lVLDLDeTLvHss~~~~~~~~~d~~~~v~~~~~~~~~yV~kRP~vdeFL~~~s~~~e~v~FTAs~~~Ya~~v~D  165 (262)
T KOG1605|consen   86 TVGRKTLVLDLDETLVHSSLNLKPIVNADFTVPVEIDGHIHQVYVRKRPHVDEFLSRVSKWYELVLFTASLEVYADPLLD  165 (262)
T ss_pred             cCCCceEEEeCCCcccccccccCCCCCcceeeeeeeCCcceEEEEEcCCCHHHHHHHhHHHHHHHHHHhhhHHHHHHHHH
Confidence            46899999999999999995 44335789999999999999999999999999999999999999999999999999999


Q ss_pred             HhCC-CCcccEEEecCCccccCCceecccccccCCCC--------------CCCCeeecCCCCCCCCchHHHHHHHHHHh
Q 044274          188 RLDR-NGVISHRLYRDSCKQIDGKFVKDLSEMGRNLK--------------QPENAIPVKPFTGDPSDIELWKLVNFFEA  252 (278)
Q Consensus       188 ~LDp-~~~f~~~l~R~~c~~~~g~~~KDL~~l~rdl~--------------qp~N~I~I~~F~gd~~D~eLl~L~~~L~~  252 (278)
                      .||+ .++|.+|+||++|+..+|.|+|||+.+|+|+.              ||+|||||++|.+++.|+||++|+|||++
T Consensus       166 ~LD~~~~i~~~RlyR~~C~~~~g~yvKdls~~~~dL~~viIiDNsP~sy~~~p~NgIpI~sw~~d~~D~eLL~LlpfLe~  245 (262)
T KOG1605|consen  166 ILDPDRKIISHRLYRDSCTLKDGNYVKDLSVLGRDLSKVIIVDNSPQSYRLQPENGIPIKSWFDDPTDTELLKLLPFLEA  245 (262)
T ss_pred             HccCCCCeeeeeecccceEeECCcEEEEcceeccCcccEEEEcCChHHhccCccCCCcccccccCCChHHHHHHHHHHHH
Confidence            9999 55999999999999999999999999999996              99999999999999999999999999999


Q ss_pred             cCCCCcHHHHHHhc
Q 044274          253 CDCFVDMRDAVKAF  266 (278)
Q Consensus       253 L~~~~DVR~~lk~~  266 (278)
                      |+.++|||++++..
T Consensus       246 L~~~~Dvr~~l~~~  259 (262)
T KOG1605|consen  246 LAFVDDVRPILARR  259 (262)
T ss_pred             hcccccHHHHHHHh
Confidence            99999999999863

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
2hhl_A195 Crystal Structure Of The Human Small Ctd Phosphatas 1e-27
2q5e_A187 Crystal Structure Of Human Carboxy-Terminal Domain 1e-25
3l0c_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 1e-25
3pgl_A180 Crystal Structure Of Human Small C-Terminal Domain 2e-25
1t9z_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 3e-25
2ghq_A181 Ctd-Specific Phosphatase Scp1 In Complex With Pepti 4e-25
3l0b_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 9e-25
3l0y_A184 Crystal Structure Of Scp1 Phosphatase D98a Mutant L 1e-24
1ta0_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 1e-24
3qle_A204 Structural Basis For The Function Of Tim50 In The M 6e-14
3ef0_A 372 The Structure Of Fcp1, An Essential Rna Polymerase 4e-05
3ef1_A 442 The Structure Of Fcp1, An Essential Rna Polymerase 3e-04
>pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 96/168 (57%), Gaps = 17/168 (10%)
Query: 101 EHLLPPLISPD--KKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGV 158
           ++LLP +   D  KK + +DLDETL+HS   P     DFIV   IDG +   YVLKRP V
Sbjct: 15  KYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNA-DFIVPVEIDGTIHQVYVLKRPHV 73
Query: 159 DAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEM 218
           D FL  + + +E V+FTA L +YA  + + LDR GV   RL+R+SC    G +VKDLS +
Sbjct: 74  DEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 133
Query: 219 GRNLK--------------QPENAIPVKPFTGDPSDIELWKLVNFFEA 252
           GR L                PENA+PV+ +  D +D EL  L+ FFE 
Sbjct: 134 GRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEG 181
>pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 Back     alignment and structure
>pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 Back     alignment and structure
>pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 Back     alignment and structure
>pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 Back     alignment and structure
>pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 Back     alignment and structure
>pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 Back     alignment and structure
>pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 Back     alignment and structure
>pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 Back     alignment and structure
>pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 Back     alignment and structure
>pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 Back     alignment and structure
>pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 1e-60
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 2e-59
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 2e-50
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 1e-32
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 1e-27
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 3e-24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
 Score =  189 bits (481), Expect = 1e-60
 Identities = 69/181 (38%), Positives = 100/181 (55%), Gaps = 17/181 (9%)

Query: 100 NEHLLPPLISPD--KKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPG 157
           +++LLP   + D  K  + ++LDETL+HS   P     DFI+   IDG V   YVLKRP 
Sbjct: 1   HQYLLPEAKAQDSDKICVVINLDETLVHSSFKPVN-NADFIIPVEIDGVVHQVYVLKRPH 59

Query: 158 VDAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSE 217
           VD FL  + + +E V+FTA L +YA  + + LD+ G    RL+R+SC    G +VKDLS 
Sbjct: 60  VDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSR 119

Query: 218 MGRNLK--------------QPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAV 263
           +GR+L+               P+NA+PV  +  + SD EL  L+ FFE      D+   +
Sbjct: 120 LGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVL 179

Query: 264 K 264
           +
Sbjct: 180 R 180
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 100.0
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.95
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.93
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 97.3
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.24
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.2
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.18
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 96.91
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 96.84
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 96.7
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.67
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 96.61
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 96.55
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 96.49
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 96.43
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 96.41
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 96.34
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 96.32
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.22
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 96.2
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 96.16
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 96.14
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.12
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 96.02
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 96.0
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 95.94
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 95.83
3mn1_A189 Probable YRBI family phosphatase; structural genom 95.72
3mmz_A176 Putative HAD family hydrolase; structural genomics 95.23
2o2x_A218 Hypothetical protein; structural genomics, joint c 95.18
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 95.08
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 94.93
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 94.71
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 94.53
1l6r_A227 Hypothetical protein TA0175; structural genomics, 94.49
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 94.14
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 93.92
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 93.91
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 93.87
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 93.49
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 93.45
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 93.45
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 93.21
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 93.12
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 92.68
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 92.59
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 92.58
2zos_A 249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 92.46
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 92.41
3dao_A283 Putative phosphatse; structural genomics, joint ce 92.37
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 92.37
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 92.17
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 91.88
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 91.66
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 91.42
1zjj_A 263 Hypothetical protein PH1952; alpha/beta hydrolase 91.3
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 91.21
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 90.8
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 90.47
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 90.34
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 90.26
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 90.0
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 89.97
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 89.71
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 89.48
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 89.32
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 89.21
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 88.98
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 88.92
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 88.62
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 88.2
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 88.14
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 88.04
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 88.03
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 87.76
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 87.64
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 87.6
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 87.6
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 86.85
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 86.77
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 86.59
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 86.45
2hsz_A243 Novel predicted phosphatase; structural genomics, 86.08
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 85.76
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 85.75
3sd7_A240 Putative phosphatase; structural genomics, haloaci 85.71
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 85.6
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 85.43
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 85.14
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 85.04
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 85.02
2hsz_A243 Novel predicted phosphatase; structural genomics, 84.73
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 84.39
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 84.29
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 83.97
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 83.83
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 83.79
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 83.67
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 83.35
2zg6_A220 Putative uncharacterized protein ST2620, probable 83.09
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 83.03
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 83.01
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 82.75
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 82.7
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 82.69
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 82.57
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 82.47
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 82.25
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 82.23
2p11_A231 Hypothetical protein; putative haloacid dehalogena 82.17
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 82.06
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 81.76
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 81.76
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 81.62
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 81.56
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 81.47
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 81.42
1te2_A226 Putative phosphatase; structural genomics, phospha 81.35
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 81.35
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 81.3
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 81.23
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 81.22
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 81.1
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 80.99
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 80.96
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 80.93
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 80.79
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 80.76
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 80.76
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 80.29
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 80.19
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 80.13
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 80.03
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=100.00  E-value=1.8e-40  Score=293.17  Aligned_cols=158  Identities=34%  Similarity=0.589  Sum_probs=140.7

Q ss_pred             CCCCCCCCC---CCCeEEEEeCCCceeeccCCCCCCCCceEEeeccCCceeeEEEEeCcCHHHHHHHHhhcceEEEEcCC
Q 044274          101 EHLLPPLIS---PDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAG  177 (278)
Q Consensus       101 ~~lLPp~~~---~~KktLVLDLDeTLIhs~~~~~~~~~Df~v~~~~~~~~~~~~v~~RP~l~eFL~~l~~~fEIvI~Taa  177 (278)
                      +.+|||+..   ++++||||||||||||+.+.+.                .++++.+|||+++||++|+++|||+||||+
T Consensus        20 ~~lLp~~~~~~~~~~~tLVLDLDeTLvh~~~~~~----------------~~~~v~~RPgl~eFL~~l~~~yeivI~Tas   83 (204)
T 3qle_A           20 PDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQK----------------HGWRTAKRPGADYFLGYLSQYYEIVLFSSN   83 (204)
T ss_dssp             CCCSCCCC----CCSEEEEEECBTTTEEEEEETT----------------TEEEEEECTTHHHHHHHHTTTEEEEEECSS
T ss_pred             ccCCCCCCccccCCCeEEEEeccccEEeeecccc----------------CceeEEeCCCHHHHHHHHHhCCEEEEEcCC
Confidence            357776542   5799999999999999987542                368899999999999999999999999999


Q ss_pred             chHHHHHHHHHhCCCC-cccEEEecCCccccCCceecccccccCCCC--------------CCCCeeecCCCCCCCCchH
Q 044274          178 LKEYASLLLNRLDRNG-VISHRLYRDSCKQIDGKFVKDLSEMGRNLK--------------QPENAIPVKPFTGDPSDIE  242 (278)
Q Consensus       178 ~~~YA~~vl~~LDp~~-~f~~~l~R~~c~~~~g~~~KDL~~l~rdl~--------------qp~N~I~I~~F~gd~~D~e  242 (278)
                      .+.||++|++.|||.+ +|.++|+|++|....|.|+|||+.+|++++              ||+|||+|.+|.|+. |+|
T Consensus        84 ~~~ya~~vl~~LDp~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~e  162 (204)
T 3qle_A           84 YMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDK  162 (204)
T ss_dssp             CHHHHHHHHHHTSTTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCH
T ss_pred             cHHHHHHHHHHhCCCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-Chh
Confidence            9999999999999986 999999999999999999999999999886              999999999999876 669


Q ss_pred             HHHHHHHHHhcC--CCCcHHHHHHhcCCC-chhhhh
Q 044274          243 LWKLVNFFEACD--CFVDMRDAVKAFDLG-ERYEKL  275 (278)
Q Consensus       243 Ll~L~~~L~~L~--~~~DVR~~lk~~~~~-~~~~~~  275 (278)
                      |++|++||+.|+  .++|||++|++|+++ +..+.+
T Consensus       163 L~~L~~~L~~L~~~~~~DVR~~L~~~~~~~~~~~~f  198 (204)
T 3qle_A          163 LVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEF  198 (204)
T ss_dssp             HHHHHHHHHHHHHTCCSCSHHHHTTSSCGGGHHHHH
T ss_pred             HHHHHHHHHHHhhcChHHHHHHHHHhcCCCCHHHHH
Confidence            999999999997  689999999999885 444443
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 278
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 1e-42
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  142 bits (358), Expect = 1e-42
 Identities = 70/180 (38%), Positives = 99/180 (55%), Gaps = 17/180 (9%)

Query: 101 EHLLPPLISPD--KKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGV 158
           ++LLP   + D  K  + +DLDETL+HS   P     DFI+   IDG V   YVLKRP V
Sbjct: 2   QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNA-DFIIPVEIDGVVHQVYVLKRPHV 60

Query: 159 DAFLDAISKKYEVVVFTAGLKEYASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEM 218
           D FL  + + +E V+FTA L +YA  + + LD+ G    RL+R+SC    G +VKDLS +
Sbjct: 61  DEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 120

Query: 219 GRNLK--------------QPENAIPVKPFTGDPSDIELWKLVNFFEACDCFVDMRDAVK 264
           GR+L+               P+NA+PV  +  + SD EL  L+ FFE      D+   ++
Sbjct: 121 GRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR 180

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.71
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.49
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.36
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.28
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.8
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 96.44
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 96.37
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 95.81
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 95.74
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 95.5
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 95.26
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.09
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 94.57
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 94.43
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 94.42
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 94.17
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 94.13
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 94.06
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 93.65
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 93.24
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 93.18
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 92.51
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 92.49
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 92.47
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 92.44
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 92.4
d1yv9a1 253 Putative hydrolase EF1188 {Enterococcus faecalis [ 92.0
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 91.64
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 90.54
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 88.22
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 87.37
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 86.92
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 86.08
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 85.45
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 85.31
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 84.51
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 83.3
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 83.02
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 82.61
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 82.19
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 81.38
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 80.04
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.8e-43  Score=303.80  Aligned_cols=162  Identities=43%  Similarity=0.724  Sum_probs=149.9

Q ss_pred             CCCCCC--CCCCeEEEEeCCCceeeccCCCCCCCCceEEeeccCCceeeEEEEeCcCHHHHHHHHhhcceEEEEcCCchH
Q 044274          103 LLPPLI--SPDKKTIFLDLDETLIHSKPDPPPERFDFIVRPRIDGEVLNFYVLKRPGVDAFLDAISKKYEVVVFTAGLKE  180 (278)
Q Consensus       103 lLPp~~--~~~KktLVLDLDeTLIhs~~~~~~~~~Df~v~~~~~~~~~~~~v~~RP~l~eFL~~l~~~fEIvI~Taa~~~  180 (278)
                      ++||..  ..+|+||||||||||||+...+. ...|+.+....++....+||++|||+++||++++++|||+|||||+++
T Consensus         4 llp~~~~~~~~k~~LVLDLDeTLihs~~~~~-~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~   82 (181)
T d1ta0a_           4 LLPEAKAQDSDKICVVIDLDETLVHSSFKPV-NNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAK   82 (181)
T ss_dssp             SSCCCCGGGTTSCEEEECCBTTTEEEESSCC-TTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHH
T ss_pred             cCCCCCcccCCCeEEEEeCCCCEEccccCCC-CCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHH
Confidence            566543  35899999999999999988764 467888877788888899999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCcccEEEecCCccccCCceecccccccCCCC--------------CCCCeeecCCCCCCCCchHHHHH
Q 044274          181 YASLLLNRLDRNGVISHRLYRDSCKQIDGKFVKDLSEMGRNLK--------------QPENAIPVKPFTGDPSDIELWKL  246 (278)
Q Consensus       181 YA~~vl~~LDp~~~f~~~l~R~~c~~~~g~~~KDL~~l~rdl~--------------qp~N~I~I~~F~gd~~D~eLl~L  246 (278)
                      ||++|++.|||++.+.+++||++|....+.++|||+.+|+++.              ||+|||+|++|.|+++|+||..|
T Consensus        83 YA~~il~~ldp~~~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~l  162 (181)
T d1ta0a_          83 YADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDL  162 (181)
T ss_dssp             HHHHHHHHHCSSCCEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHHH
T ss_pred             HHHHHHHHhccCCceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHHH
Confidence            9999999999999999999999999999999999999999887              89999999999999999999999


Q ss_pred             HHHHHhcCCCCcHHHHHHh
Q 044274          247 VNFFEACDCFVDMRDAVKA  265 (278)
Q Consensus       247 ~~~L~~L~~~~DVR~~lk~  265 (278)
                      ++||+.|+.++|||++|++
T Consensus       163 ~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         163 LPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             HHHHHHHTTCSCHHHHHCC
T ss_pred             HHHHHHHccCCcHHHHhcC
Confidence            9999999999999999974
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure