Citrus Sinensis ID: 044305
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 195 | ||||||
| 296088485 | 1057 | unnamed protein product [Vitis vinifera] | 0.851 | 0.157 | 0.865 | 8e-88 | |
| 359474648 | 991 | PREDICTED: alpha-glucosidase 2-like [Vit | 0.851 | 0.167 | 0.865 | 8e-88 | |
| 297831124 | 988 | hypothetical protein ARALYDRAFT_898886 [ | 0.876 | 0.173 | 0.871 | 2e-87 | |
| 224138396 | 1001 | predicted protein [Populus trichocarpa] | 0.841 | 0.163 | 0.865 | 8e-87 | |
| 18403833 | 991 | heteroglycan glucosidase 1 [Arabidopsis | 0.876 | 0.172 | 0.871 | 9e-87 | |
| 9294522 | 959 | alpha glucosidase-like protein [Arabidop | 0.876 | 0.178 | 0.871 | 1e-86 | |
| 357484583 | 1058 | Alpha glucosidase-like protein [Medicago | 0.851 | 0.156 | 0.842 | 2e-86 | |
| 255557713 | 991 | neutral alpha-glucosidase ab precursor, | 0.851 | 0.167 | 0.865 | 8e-86 | |
| 296085512 | 373 | unnamed protein product [Vitis vinifera] | 0.876 | 0.458 | 0.853 | 2e-85 | |
| 449456921 | 1058 | PREDICTED: alpha-glucosidase 2-like [Cuc | 0.851 | 0.156 | 0.853 | 2e-85 |
| >gi|296088485|emb|CBI37476.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 328 bits (841), Expect = 8e-88, Method: Compositional matrix adjust.
Identities = 148/171 (86%), Positives = 166/171 (97%)
Query: 25 VLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMA 84
++KDFI NGVDGIWNDMNEPAVF++VTKTMPE N+HRGD E+GGCQNHS+YHNVYGMLMA
Sbjct: 396 LVKDFISNGVDGIWNDMNEPAVFKTVTKTMPEDNVHRGDAELGGCQNHSHYHNVYGMLMA 455
Query: 85 RSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVLQLGLSGQ 144
RSTYEGMKLA+++KRPFVLTRAG+IGSQRYAATWTGDN+SNW+HLHMSISMVLQLGLSGQ
Sbjct: 456 RSTYEGMKLANENKRPFVLTRAGYIGSQRYAATWTGDNLSNWDHLHMSISMVLQLGLSGQ 515
Query: 145 PLSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDSIDHEPWSFGEE 195
PLSGPDIGGF GNATPRLFGRWMG+GAMFPFCRGH+E+ ++DHEPWSFGEE
Sbjct: 516 PLSGPDIGGFAGNATPRLFGRWMGVGAMFPFCRGHSETGTVDHEPWSFGEE 566
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359474648|ref|XP_002263148.2| PREDICTED: alpha-glucosidase 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297831124|ref|XP_002883444.1| hypothetical protein ARALYDRAFT_898886 [Arabidopsis lyrata subsp. lyrata] gi|297329284|gb|EFH59703.1| hypothetical protein ARALYDRAFT_898886 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224138396|ref|XP_002326592.1| predicted protein [Populus trichocarpa] gi|222833914|gb|EEE72391.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18403833|ref|NP_566736.1| heteroglycan glucosidase 1 [Arabidopsis thaliana] gi|186510357|ref|NP_001118685.1| heteroglycan glucosidase 1 [Arabidopsis thaliana] gi|16648903|gb|AAL24303.1| alpha glucosidase-like protein [Arabidopsis thaliana] gi|27311799|gb|AAO00865.1| Unknown protein [Arabidopsis thaliana] gi|31711788|gb|AAP68250.1| At3g23640 [Arabidopsis thaliana] gi|332643272|gb|AEE76793.1| heteroglycan glucosidase 1 [Arabidopsis thaliana] gi|332643273|gb|AEE76794.1| heteroglycan glucosidase 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9294522|dbj|BAB02784.1| alpha glucosidase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357484583|ref|XP_003612579.1| Alpha glucosidase-like protein [Medicago truncatula] gi|355513914|gb|AES95537.1| Alpha glucosidase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255557713|ref|XP_002519886.1| neutral alpha-glucosidase ab precursor, putative [Ricinus communis] gi|223540932|gb|EEF42490.1| neutral alpha-glucosidase ab precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296085512|emb|CBI29244.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449456921|ref|XP_004146197.1| PREDICTED: alpha-glucosidase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 195 | ||||||
| TAIR|locus:2088035 | 991 | HGL1 "heteroglycan glucosidase | 0.876 | 0.172 | 0.795 | 5e-76 | |
| TAIR|locus:2163976 | 921 | RSW3 "RADIAL SWELLING 3" [Arab | 0.774 | 0.163 | 0.462 | 2.5e-38 | |
| UNIPROTKB|E1BKJ4 | 916 | GANC "Uncharacterized protein" | 0.784 | 0.167 | 0.45 | 4.5e-38 | |
| UNIPROTKB|Q8TET4 | 914 | GANC "Neutral alpha-glucosidas | 0.820 | 0.175 | 0.441 | 9.5e-38 | |
| CGD|CAL0003777 | 871 | ROT2 [Candida albicans (taxid: | 0.779 | 0.174 | 0.430 | 2.1e-37 | |
| UNIPROTKB|Q5A4X3 | 871 | ROT2 "Putative uncharacterized | 0.779 | 0.174 | 0.430 | 2.1e-37 | |
| MGI|MGI:1923301 | 898 | Ganc "glucosidase, alpha; neut | 0.820 | 0.178 | 0.435 | 2.4e-37 | |
| UNIPROTKB|J9NYZ4 | 738 | GANC "Uncharacterized protein" | 0.784 | 0.207 | 0.431 | 2.5e-37 | |
| UNIPROTKB|E2RAA1 | 914 | GANC "Uncharacterized protein" | 0.784 | 0.167 | 0.431 | 6.8e-37 | |
| SGD|S000000433 | 954 | ROT2 "Glucosidase II catalytic | 0.779 | 0.159 | 0.45 | 1.7e-36 |
| TAIR|locus:2088035 HGL1 "heteroglycan glucosidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 766 (274.7 bits), Expect = 5.0e-76, P = 5.0e-76
Identities = 136/171 (79%), Positives = 151/171 (88%)
Query: 25 VLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMA 84
++K+F+ NGVDGIWNDMNEPAVF+ VTKTMPE+NIH GDDE+GG QNHS+YHNVYGMLMA
Sbjct: 330 LVKEFVSNGVDGIWNDMNEPAVFKVVTKTMPENNIHHGDDELGGVQNHSHYHNVYGMLMA 389
Query: 85 RSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVXXXXXXXX 144
RSTYEGM+LADK+KRPFVLTRAGFIGSQRYAATWTGDN+SNWEHLHMSISMV
Sbjct: 390 RSTYEGMELADKNKRPFVLTRAGFIGSQRYAATWTGDNLSNWEHLHMSISMVLQLGLSGQ 449
Query: 145 XXXXXDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDSIDHEPWSFGEE 195
DIGGF GNATPRLFGRWMG+GAMFPFCRGH+E+ + DHEPWSFGEE
Sbjct: 450 PLSGPDIGGFAGNATPRLFGRWMGVGAMFPFCRGHSEAGTDDHEPWSFGEE 500
|
|
| TAIR|locus:2163976 RSW3 "RADIAL SWELLING 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BKJ4 GANC "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TET4 GANC "Neutral alpha-glucosidase C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003777 ROT2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5A4X3 ROT2 "Putative uncharacterized protein ROT2" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923301 Ganc "glucosidase, alpha; neutral C" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYZ4 GANC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RAA1 GANC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000433 ROT2 "Glucosidase II catalytic subunit involved in cell wall synthesis" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 195 | |||
| PLN02763 | 978 | PLN02763, PLN02763, hydrolase, hydrolyzing O-glyco | 1e-116 | |
| cd06604 | 339 | cd06604, GH31_glucosidase_II_MalA, Alpha-glucosida | 3e-97 | |
| pfam01055 | 436 | pfam01055, Glyco_hydro_31, Glycosyl hydrolases fam | 1e-68 | |
| cd06603 | 339 | cd06603, GH31_GANC_GANAB_alpha, This family includ | 1e-66 | |
| COG1501 | 772 | COG1501, COG1501, Alpha-glucosidases, family 31 of | 2e-52 | |
| cd06600 | 317 | cd06600, GH31_MGAM-like, This family includes the | 1e-49 | |
| cd06602 | 339 | cd06602, GH31_MGAM_SI_GAA, This family includes th | 1e-46 | |
| cd06589 | 265 | cd06589, GH31, The enzymes of glycosyl hydrolase f | 5e-45 | |
| cd06598 | 317 | cd06598, GH31_transferase_CtsZ, CtsZ (cyclic tetra | 4e-33 | |
| cd06599 | 317 | cd06599, GH31_glycosidase_Aec37, Glycosyl hydrolas | 1e-32 | |
| cd06601 | 332 | cd06601, GH31_lyase_GLase, GLases (alpha-1,4-gluca | 4e-30 | |
| cd06591 | 319 | cd06591, GH31_xylosidase_XylS, XylS is a glycosyl | 4e-30 | |
| cd06593 | 308 | cd06593, GH31_xylosidase_YicI, YicI alpha-xylosida | 1e-24 | |
| PRK10426 | 635 | PRK10426, PRK10426, alpha-glucosidase; Provisional | 2e-14 | |
| cd06596 | 261 | cd06596, GH31_CPE1046, CPE1046 is an uncharacteriz | 1e-13 | |
| cd06594 | 317 | cd06594, GH31_glucosidase_YihQ, YihQ is a bacteria | 1e-12 | |
| PLN02763 | 978 | PLN02763, PLN02763, hydrolase, hydrolyzing O-glyco | 9e-12 | |
| PRK10658 | 665 | PRK10658, PRK10658, putative alpha-glucosidase; Pr | 8e-11 | |
| cd06595 | 292 | cd06595, GH31_xylosidase_XylS-like, This family re | 1e-10 | |
| cd06597 | 340 | cd06597, GH31_transferase_CtsY, CtsY (cyclic tetra | 1e-10 | |
| cd06604 | 339 | cd06604, GH31_glucosidase_II_MalA, Alpha-glucosida | 3e-09 | |
| pfam01055 | 436 | pfam01055, Glyco_hydro_31, Glycosyl hydrolases fam | 2e-07 | |
| cd06603 | 339 | cd06603, GH31_GANC_GANAB_alpha, This family includ | 2e-06 | |
| cd06602 | 339 | cd06602, GH31_MGAM_SI_GAA, This family includes th | 7e-05 | |
| COG1501 | 772 | COG1501, COG1501, Alpha-glucosidases, family 31 of | 0.001 | |
| cd06600 | 317 | cd06600, GH31_MGAM-like, This family includes the | 0.002 |
| >gnl|CDD|215408 PLN02763, PLN02763, hydrolase, hydrolyzing O-glycosyl compounds | Back alignment and domain information |
|---|
Score = 351 bits (901), Expect = e-116
Identities = 146/171 (85%), Positives = 163/171 (95%)
Query: 25 VLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMA 84
++KDF+ NGVDGIWNDMNEPAVF++VTKTMPE+NIHRGD+E+GG QNHS+YHNVYGMLMA
Sbjct: 318 LVKDFVSNGVDGIWNDMNEPAVFKTVTKTMPETNIHRGDEELGGVQNHSHYHNVYGMLMA 377
Query: 85 RSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVLQLGLSGQ 144
RSTYEGM LA+K+KRPFVLTRAGFIGSQRYAATWTGDN+SNWEHLHMSI MVLQLGLSGQ
Sbjct: 378 RSTYEGMLLANKNKRPFVLTRAGFIGSQRYAATWTGDNLSNWEHLHMSIPMVLQLGLSGQ 437
Query: 145 PLSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDSIDHEPWSFGEE 195
PLSGPDIGGF G+ATP+LFGRWMG+GAMFPF RGH+E +IDHEPWSFGEE
Sbjct: 438 PLSGPDIGGFAGDATPKLFGRWMGVGAMFPFARGHSEQGTIDHEPWSFGEE 488
|
Length = 978 |
| >gnl|CDD|133135 cd06604, GH31_glucosidase_II_MalA, Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >gnl|CDD|216268 pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31 | Back alignment and domain information |
|---|
| >gnl|CDD|133134 cd06603, GH31_GANC_GANAB_alpha, This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) | Back alignment and domain information |
|---|
| >gnl|CDD|224418 COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133131 cd06600, GH31_MGAM-like, This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
| >gnl|CDD|133133 cd06602, GH31_MGAM_SI_GAA, This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >gnl|CDD|133121 cd06589, GH31, The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase | Back alignment and domain information |
|---|
| >gnl|CDD|133129 cd06598, GH31_transferase_CtsZ, CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY | Back alignment and domain information |
|---|
| >gnl|CDD|133130 cd06599, GH31_glycosidase_Aec37, Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >gnl|CDD|133132 cd06601, GH31_lyase_GLase, GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end | Back alignment and domain information |
|---|
| >gnl|CDD|133122 cd06591, GH31_xylosidase_XylS, XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >gnl|CDD|133124 cd06593, GH31_xylosidase_YicI, YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >gnl|CDD|236691 PRK10426, PRK10426, alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133127 cd06596, GH31_CPE1046, CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain | Back alignment and domain information |
|---|
| >gnl|CDD|133125 cd06594, GH31_glucosidase_YihQ, YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride | Back alignment and domain information |
|---|
| >gnl|CDD|215408 PLN02763, PLN02763, hydrolase, hydrolyzing O-glycosyl compounds | Back alignment and domain information |
|---|
| >gnl|CDD|236731 PRK10658, PRK10658, putative alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133126 cd06595, GH31_xylosidase_XylS-like, This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus | Back alignment and domain information |
|---|
| >gnl|CDD|133128 cd06597, GH31_transferase_CtsY, CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ | Back alignment and domain information |
|---|
| >gnl|CDD|133135 cd06604, GH31_glucosidase_II_MalA, Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >gnl|CDD|216268 pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31 | Back alignment and domain information |
|---|
| >gnl|CDD|133134 cd06603, GH31_GANC_GANAB_alpha, This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) | Back alignment and domain information |
|---|
| >gnl|CDD|133133 cd06602, GH31_MGAM_SI_GAA, This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >gnl|CDD|224418 COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133131 cd06600, GH31_MGAM-like, This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| cd06601 | 332 | GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) | 100.0 | |
| PLN02763 | 978 | hydrolase, hydrolyzing O-glycosyl compounds | 100.0 | |
| cd06604 | 339 | GH31_glucosidase_II_MalA Alpha-glucosidase II (alp | 100.0 | |
| cd06589 | 265 | GH31 The enzymes of glycosyl hydrolase family 31 ( | 100.0 | |
| cd06603 | 339 | GH31_GANC_GANAB_alpha This family includes the clo | 100.0 | |
| cd06600 | 317 | GH31_MGAM-like This family includes the following | 100.0 | |
| cd06598 | 317 | GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide | 100.0 | |
| cd06591 | 319 | GH31_xylosidase_XylS XylS is a glycosyl hydrolase | 100.0 | |
| cd06597 | 340 | GH31_transferase_CtsY CtsY (cyclic tetrasaccharide | 100.0 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 100.0 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 100.0 | |
| COG1501 | 772 | Alpha-glucosidases, family 31 of glycosyl hydrolas | 100.0 | |
| cd06594 | 317 | GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl | 100.0 | |
| cd06602 | 339 | GH31_MGAM_SI_GAA This family includes the followin | 100.0 | |
| cd06596 | 261 | GH31_CPE1046 CPE1046 is an uncharacterized Clostri | 100.0 | |
| PRK10658 | 665 | putative alpha-glucosidase; Provisional | 100.0 | |
| cd06595 | 292 | GH31_xylosidase_XylS-like This family represents a | 100.0 | |
| KOG1066 | 915 | consensus Glucosidase II catalytic (alpha) subunit | 100.0 | |
| PF01055 | 441 | Glyco_hydro_31: Glycosyl hydrolases family 31 ; In | 100.0 | |
| PRK10426 | 635 | alpha-glucosidase; Provisional | 100.0 | |
| cd06592 | 303 | GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact | 100.0 | |
| KOG1065 | 805 | consensus Maltase glucoamylase and related hydrola | 100.0 | |
| cd06601 | 332 | GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) | 97.1 | |
| cd06595 | 292 | GH31_xylosidase_XylS-like This family represents a | 97.03 | |
| cd06602 | 339 | GH31_MGAM_SI_GAA This family includes the followin | 96.79 | |
| cd06600 | 317 | GH31_MGAM-like This family includes the following | 96.78 | |
| cd06591 | 319 | GH31_xylosidase_XylS XylS is a glycosyl hydrolase | 96.7 | |
| cd06603 | 339 | GH31_GANC_GANAB_alpha This family includes the clo | 96.68 | |
| cd06597 | 340 | GH31_transferase_CtsY CtsY (cyclic tetrasaccharide | 96.64 | |
| PLN02763 | 978 | hydrolase, hydrolyzing O-glycosyl compounds | 96.61 | |
| cd06604 | 339 | GH31_glucosidase_II_MalA Alpha-glucosidase II (alp | 96.6 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 96.59 | |
| KOG1065 | 805 | consensus Maltase glucoamylase and related hydrola | 96.49 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 96.4 | |
| cd06598 | 317 | GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide | 96.34 | |
| PF01055 | 441 | Glyco_hydro_31: Glycosyl hydrolases family 31 ; In | 94.18 | |
| KOG1066 | 915 | consensus Glucosidase II catalytic (alpha) subunit | 94.14 | |
| cd06594 | 317 | GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl | 92.46 | |
| PRK10658 | 665 | putative alpha-glucosidase; Provisional | 87.28 | |
| PLN03231 | 357 | putative alpha-galactosidase; Provisional | 86.51 | |
| COG1501 | 772 | Alpha-glucosidases, family 31 of glycosyl hydrolas | 83.08 | |
| PLN02229 | 427 | alpha-galactosidase | 81.6 |
| >cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-52 Score=363.49 Aligned_cols=180 Identities=32% Similarity=0.619 Sum_probs=153.0
Q ss_pred hhhcccccccHHHHHHHHHHcCcceEEecCCccccccCC--ccCCCCCcccCCCCC--CCCcccccchhhhhHHHHHHHH
Q 044305 12 YNQCRWSYDSEKRVLKDFIYNGVDGIWNDMNEPAVFQSV--TKTMPESNIHRGDDE--IGGCQNHSYYHNVYGMLMARST 87 (195)
Q Consensus 12 ~~a~~W~~~~~~~~~~~l~~~Gvdg~w~D~~Ep~~~~~~--~~~~p~~~~~~~~~~--~g~~~~~~~~hn~Y~~~~~~a~ 87 (195)
.++++||. ++++.|+++||++||+|||||+.+... ..++|.+.++..... ......|.++||+|++++++|+
T Consensus 106 p~ar~wW~----~~~~~l~~~Gv~~~W~DmnEp~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~hN~Y~~~~~~a~ 181 (332)
T cd06601 106 PDVREWWG----NQYKYLFDIGLEFVWQDMTTPAIMPSYGDMKGFPPRLLVTDDSYENNVKRKPAIELWNLYSYNLHKAT 181 (332)
T ss_pred HHHHHHHH----HHHHHHHhCCCceeecCCCCcccccCCCccCCCCCcccccCCccccccCCchHHHHhhhhHHHHHHHH
Confidence 46778986 478899999999999999999987542 245676654432210 0112368899999999999999
Q ss_pred HHHHHhhc--CCCCcEEEeccccCCCCcccceeCCCCCCChHHHHHHHHHHHHhhccCCCccccCCCCCCCC--------
Q 044305 88 YEGMKLAD--KDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVLQLGLSGQPLSGPDIGGFDGN-------- 157 (195)
Q Consensus 88 ~e~~~~~~--~~~r~~~~sRs~~~G~qr~~~~w~GD~~s~W~~L~~~i~~~l~~~l~G~~~~g~DigGf~~~-------- 157 (195)
+|++++.. +++||||+|||+|+|+|||+++|+||+.|+|+.|+.+|+++|++||||+||||+|||||.+.
T Consensus 182 ~e~~~~~~~~~~~RpfiltRS~~aGsqrY~~~WsGDn~stW~~L~~si~~~L~~~lsGip~~g~DIGGF~g~~~~~~~~~ 261 (332)
T cd06601 182 WHGLNNLNARKNKRNFIIGRGSYAGMQRFAGLWTGDNSSSWDFLQINIAQVLNLGMSGLPIAGSDIGGFTSYDGENSIQR 261 (332)
T ss_pred HHHHHHhhcCCCCCcEEEEecCcCccCCcCceeCCCcccCHHHHHHHHHHHHHhhhcCCCccCCccCCcCCCCccccccc
Confidence 99998764 78999999999999999999999999999999999999999999999999999999999986
Q ss_pred --CCHHHHHHHHHhhhhccccccCCCCC--CCCCCCCCCCCC
Q 044305 158 --ATPRLFGRWMGIGAMFPFCRGHTESD--SIDHEPWSFGEE 195 (195)
Q Consensus 158 --~~~EL~iRW~Q~g~f~P~~r~h~~~~--~~~~ePw~f~~e 195 (195)
+++|||+||+|+|+|+|+||+|+... +..||||.|+.|
T Consensus 262 ~~~~~EL~~RW~Q~GaF~P~~R~H~~~~~~~~~~ep~~~~~~ 303 (332)
T cd06601 262 TWCNPELLIRWYQAGFLLPWFRNHYDRKIRQKFQEPAKYFQE 303 (332)
T ss_pred CCCCHHHHHHHHHHhcCCceeccCCCCccCcccCCccccccc
Confidence 57999999999999999999999764 478999766543
|
GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes. |
| >PLN02763 hydrolase, hydrolyzing O-glycosyl compounds | Back alignment and domain information |
|---|
| >cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase | Back alignment and domain information |
|---|
| >cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) | Back alignment and domain information |
|---|
| >cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
| >cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY | Back alignment and domain information |
|---|
| >cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride | Back alignment and domain information |
|---|
| >cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >cd06596 GH31_CPE1046 CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain | Back alignment and domain information |
|---|
| >PRK10658 putative alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus | Back alignment and domain information |
|---|
| >KOG1066 consensus Glucosidase II catalytic (alpha) subunit and related enzymes, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10426 alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase | Back alignment and domain information |
|---|
| >KOG1065 consensus Maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end | Back alignment and domain information |
|---|
| >cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus | Back alignment and domain information |
|---|
| >cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase | Back alignment and domain information |
|---|
| >cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II | Back alignment and domain information |
|---|
| >cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) | Back alignment and domain information |
|---|
| >cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ | Back alignment and domain information |
|---|
| >PLN02763 hydrolase, hydrolyzing O-glycosyl compounds | Back alignment and domain information |
|---|
| >cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >KOG1065 consensus Maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY | Back alignment and domain information |
|---|
| >PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG1066 consensus Glucosidase II catalytic (alpha) subunit and related enzymes, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride | Back alignment and domain information |
|---|
| >PRK10658 putative alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PLN03231 putative alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02229 alpha-galactosidase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 195 | ||||
| 2g3m_A | 693 | Crystal Structure Of The Sulfolobus Solfataricus Al | 6e-21 | ||
| 2qly_A | 870 | Crystral Structure Of The N-Terminal Subunit Of Hum | 5e-19 | ||
| 3l4t_A | 875 | Crystal Complex Of N-Terminal Human Maltase-Glucoam | 5e-19 | ||
| 3lpo_A | 898 | Crystal Structure Of The N-Terminal Domain Of Sucra | 3e-18 | ||
| 3m46_A | 666 | The Crystal Structure Of The D73a Mutant Of Glycosi | 6e-18 | ||
| 3pha_A | 667 | The Crystal Structure Of The W169y Mutant Of Alpha- | 7e-18 | ||
| 3nuk_A | 666 | The Crystal Structure Of The W169y Mutant Of Alpha- | 7e-18 | ||
| 3nsx_A | 666 | The Crystal Structure Of The The Crystal Structure | 4e-17 | ||
| 3m6d_A | 666 | The Crystal Structure Of The D307a Mutant Of Glycos | 4e-17 | ||
| 3n04_A | 666 | The Crystal Structure Of The Alpha-Glucosidase (Fam | 7e-16 | ||
| 3ton_A | 908 | Crystral Structure Of The C-Terminal Subunit Of Hum | 2e-14 | ||
| 4b9y_A | 817 | Crystal Structure Of Apo Agd31b, Alpha-transglucosy | 3e-13 | ||
| 2xvg_A | 1020 | Crystal Structure Of Alpha-Xylosidase (Gh31) From C | 7e-09 | ||
| 2x2h_A | 1027 | Crystal Structure Of The Gracilariopsis Lemaneiform | 2e-08 | ||
| 1we5_A | 772 | Crystal Structure Of Alpha-Xylosidase From Escheric | 2e-06 | ||
| 1xsi_A | 778 | Structure Of A Family 31 Alpha Glycosidase Length = | 2e-06 | ||
| 2f2h_A | 773 | Structure Of The Yici Thiosugar Michaelis Complex L | 2e-06 |
| >pdb|2G3M|A Chain A, Crystal Structure Of The Sulfolobus Solfataricus Alpha- Glucosidase Mala Length = 693 | Back alignment and structure |
|
| >pdb|2QLY|A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase Length = 870 | Back alignment and structure |
| >pdb|3L4T|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase With Bj2661 Length = 875 | Back alignment and structure |
| >pdb|3LPO|A Chain A, Crystal Structure Of The N-Terminal Domain Of Sucrase-Isomal Length = 898 | Back alignment and structure |
| >pdb|3M46|A Chain A, The Crystal Structure Of The D73a Mutant Of Glycoside Hydrolase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 | Back alignment and structure |
| >pdb|3PHA|A Chain A, The Crystal Structure Of The W169y Mutant Of Alpha-Glucosidase (Gh31 Family) From Ruminococcus Obeum Atcc 29174 In Complex With Acarbose Length = 667 | Back alignment and structure |
| >pdb|3NUK|A Chain A, The Crystal Structure Of The W169y Mutant Of Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 | Back alignment and structure |
| >pdb|3NSX|A Chain A, The Crystal Structure Of The The Crystal Structure Of The D420a Mutant Of The Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 | Back alignment and structure |
| >pdb|3M6D|A Chain A, The Crystal Structure Of The D307a Mutant Of Glycoside Hydrolase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 | Back alignment and structure |
| >pdb|3N04|A Chain A, The Crystal Structure Of The Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 | Back alignment and structure |
| >pdb|3TON|A Chain A, Crystral Structure Of The C-Terminal Subunit Of Human Maltase- Glucoamylase Length = 908 | Back alignment and structure |
| >pdb|4B9Y|A Chain A, Crystal Structure Of Apo Agd31b, Alpha-transglucosylase In Glycoside Hydrolase Family 31 Length = 817 | Back alignment and structure |
| >pdb|2XVG|A Chain A, Crystal Structure Of Alpha-Xylosidase (Gh31) From Cellvibrio Japonicus Length = 1020 | Back alignment and structure |
| >pdb|2X2H|A Chain A, Crystal Structure Of The Gracilariopsis Lemaneiformis Alpha- 1,4-Glucan Lyase Length = 1027 | Back alignment and structure |
| >pdb|1WE5|A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli Length = 772 | Back alignment and structure |
| >pdb|1XSI|A Chain A, Structure Of A Family 31 Alpha Glycosidase Length = 778 | Back alignment and structure |
| >pdb|2F2H|A Chain A, Structure Of The Yici Thiosugar Michaelis Complex Length = 773 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 195 | |||
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 4e-77 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 1e-08 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 2e-74 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 6e-09 | |
| 3nsx_A | 666 | Alpha-glucosidase; structural genomics, PSI-2, pro | 3e-73 | |
| 3nsx_A | 666 | Alpha-glucosidase; structural genomics, PSI-2, pro | 1e-08 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 1e-71 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 4e-09 | |
| 2f2h_A | 773 | Putative family 31 glucosidase YICI; BETA8alpha8 b | 8e-71 | |
| 2f2h_A | 773 | Putative family 31 glucosidase YICI; BETA8alpha8 b | 2e-04 | |
| 3top_A | 908 | Maltase-glucoamylase, intestinal; membrane, hydrol | 3e-64 | |
| 3top_A | 908 | Maltase-glucoamylase, intestinal; membrane, hydrol | 2e-08 | |
| 2xvl_A | 1020 | Alpha-xylosidase, putative, XYL31A; hydrolase, gly | 8e-64 | |
| 2xvl_A | 1020 | Alpha-xylosidase, putative, XYL31A; hydrolase, gly | 1e-07 | |
| 2x2h_A | 1027 | Alpha-1,4-glucan lyase isozyme 1; anhydrofructose | 4e-63 | |
| 2x2h_A | 1027 | Alpha-1,4-glucan lyase isozyme 1; anhydrofructose | 2e-07 |
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Length = 693 | Back alignment and structure |
|---|
Score = 243 bits (621), Expect = 4e-77
Identities = 63/195 (32%), Positives = 94/195 (48%), Gaps = 29/195 (14%)
Query: 26 LKDFIYNGVDGIWNDMNEPAVF-------------------QSVTKTMPESNIHRGDDEI 66
+ +++ GVDGIW DMNEP F + T P++ +H
Sbjct: 306 ISEWLSQGVDGIWLDMNEPTDFSRAIEIRDVLSSLPVQFRDDRLVTTFPDNVVHYLR--- 362
Query: 67 GGCQNHSYYHNVYGMLMARSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNW 126
G H N Y + A +T++G + + + F+L+RAG+ G QRYA WTGDN +W
Sbjct: 363 GKRVKHEKVRNAYPLYEAMATFKGFRTSHR-NEIFILSRAGYAGIQRYAFIWTGDNTPSW 421
Query: 127 EHLHMSISMVLQLGLSGQPLSGPDIGGFDG------NATPRLFGRWMGIGAMFPFCRGHT 180
+ L + + +VL L +SG P G DIGGF G + + L ++ + FPF R H
Sbjct: 422 DDLKLQLQLVLGLSISGVPFVGCDIGGFQGRNFAEIDNSMDLLVKYYALALFFPFYRSHK 481
Query: 181 ESDSIDHEPWSFGEE 195
+D ID EP +
Sbjct: 482 ATDGIDTEPVFLPDY 496
|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Length = 693 | Back alignment and structure |
|---|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Length = 875 | Back alignment and structure |
|---|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Length = 875 | Back alignment and structure |
|---|
| >3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Length = 666 | Back alignment and structure |
|---|
| >3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Length = 666 | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Length = 898 | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Length = 898 | Back alignment and structure |
|---|
| >2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Length = 773 | Back alignment and structure |
|---|
| >2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Length = 773 | Back alignment and structure |
|---|
| >3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Length = 908 | Back alignment and structure |
|---|
| >3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Length = 908 | Back alignment and structure |
|---|
| >2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Length = 1020 | Back alignment and structure |
|---|
| >2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Length = 1020 | Back alignment and structure |
|---|
| >2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Length = 1027 | Back alignment and structure |
|---|
| >2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Length = 1027 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| 3nsx_A | 666 | Alpha-glucosidase; structural genomics, PSI-2, pro | 100.0 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 100.0 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 100.0 | |
| 3top_A | 908 | Maltase-glucoamylase, intestinal; membrane, hydrol | 100.0 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 100.0 | |
| 4ba0_A | 817 | Alpha-glucosidase, putative, ADG31B; hydrolase; HE | 100.0 | |
| 2f2h_A | 773 | Putative family 31 glucosidase YICI; BETA8alpha8 b | 100.0 | |
| 2xvl_A | 1020 | Alpha-xylosidase, putative, XYL31A; hydrolase, gly | 100.0 | |
| 2x2h_A | 1027 | Alpha-1,4-glucan lyase isozyme 1; anhydrofructose | 100.0 | |
| 2xn2_A | 732 | Alpha-galactosidase; hydrolase, glycosidase; HET: | 98.04 | |
| 3top_A | 908 | Maltase-glucoamylase, intestinal; membrane, hydrol | 96.8 | |
| 3nsx_A | 666 | Alpha-glucosidase; structural genomics, PSI-2, pro | 96.72 | |
| 3l4y_A | 875 | Maltase-glucoamylase, intestinal; glycoside hydrol | 96.56 | |
| 3lpp_A | 898 | Sucrase-isomaltase; glycoside hydrolase family 31, | 96.46 | |
| 4ba0_A | 817 | Alpha-glucosidase, putative, ADG31B; hydrolase; HE | 96.46 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 96.41 | |
| 2g3m_A | 693 | Maltase, alpha-glucosidase; hydrolase, glycoside h | 96.16 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 96.02 | |
| 2x2h_A | 1027 | Alpha-1,4-glucan lyase isozyme 1; anhydrofructose | 95.95 | |
| 2xvl_A | 1020 | Alpha-xylosidase, putative, XYL31A; hydrolase, gly | 95.39 | |
| 3cc1_A | 433 | BH1870 protein, putative alpha-N-acetylgalactosami | 91.55 | |
| 2f2h_A | 773 | Putative family 31 glucosidase YICI; BETA8alpha8 b | 89.35 | |
| 1uas_A | 362 | Alpha-galactosidase; TIM-barrel, beta-alpha-barrel | 88.85 | |
| 1zy9_A | 564 | Alpha-galactosidase; TM1192, struc genomics, joint | 88.25 | |
| 3hg3_A | 404 | Alpha-galactosidase A; glycoprotein, carbohydrate- | 87.66 | |
| 1szn_A | 417 | Alpha-galactosidase; (beta/alpha)8 barrel,TWO doma | 82.49 |
| >3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=9.4e-50 Score=372.87 Aligned_cols=175 Identities=31% Similarity=0.604 Sum_probs=152.1
Q ss_pred hhhcccccccHHHHHHHHHHcCcceEEecCCccccccCCcc----------------CCC-------------C------
Q 044305 12 YNQCRWSYDSEKRVLKDFIYNGVDGIWNDMNEPAVFQSVTK----------------TMP-------------E------ 56 (195)
Q Consensus 12 ~~a~~W~~~~~~~~~~~l~~~Gvdg~w~D~~Ep~~~~~~~~----------------~~p-------------~------ 56 (195)
-++++||. ++++.++++||||||+|||||+.|...+. .++ .
T Consensus 286 p~a~~ww~----~~~~~~~~~Gidg~W~DmnEp~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~ 361 (666)
T 3nsx_A 286 PEARKWFG----DKYRFLIDQGIEGFWNDMNEPAIFYSSEGLAEAKEFAGEFAKDTEGKIHPWAMQAKMKDIVNSPEDYK 361 (666)
T ss_dssp HHHHHHHH----HTTHHHHTTTCCEEEEESTTTCCSEEHHHHHHHHHHHHHHHHCCSSCSCHHHHHHHHHHTTTCHHHHT
T ss_pred HHHHHHhh----hhhhHHHhccchhhhhccCCcceEecHHHHHHHHHHHHhhhccccchhhhhhHHHHHhhhcCChHHHH
Confidence 36788997 47888999999999999999987743210 010 0
Q ss_pred CcccCCCCCCCCcccccchhhhhHHHHHHHHHHHHHhhcCCCCcEEEeccccCCCCcccceeCCCCCCChHHHHHHHHHH
Q 044305 57 SNIHRGDDEIGGCQNHSYYHNVYGMLMARSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMV 136 (195)
Q Consensus 57 ~~~~~~~~~~g~~~~~~~~hn~Y~~~~~~a~~e~~~~~~~~~r~~~~sRs~~~G~qr~~~~w~GD~~s~W~~L~~~i~~~ 136 (195)
...|.. .|....|+++||+||+++++|++|++++..+++||||+|||+|+|+|||+++|+||+.++|++|+.+|+++
T Consensus 362 ~~~h~~---~g~~~~~~~~hNlYg~~~~~at~e~l~~~~~~~RpfilsRS~~aGsqry~~~W~GDn~s~W~~L~~sI~~~ 438 (666)
T 3nsx_A 362 RFYHNV---NGKKIRHDKVHNLFGYNMTRAAGEAFERIDPEKRFLMFSRSSYIGMHRYGGIWMGANKSWWSHILLNLKML 438 (666)
T ss_dssp SCEEEE---TTEEEEGGGGGGGHHHHHHHHHHHHHHHHCTTCCCEEEESSEETTGGGTCEEEECCSSCCTHHHHHHHHHH
T ss_pred HHhhhc---CCeEEehhhhhhhhccchhHHHHHHHHhhCCCceEEEEeccceeceeecCceecCCCccHHHHHHHhhhhc
Confidence 001111 12235789999999999999999999998889999999999999999999999999999999999999999
Q ss_pred HHhhccCCCccccCCCCCCCCCCHHHHHHHHHhhhhccccccCCCCCCCCCCCCCCC
Q 044305 137 LQLGLSGQPLSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDSIDHEPWSFG 193 (195)
Q Consensus 137 l~~~l~G~~~~g~DigGf~~~~~~EL~iRW~Q~g~f~P~~r~h~~~~~~~~ePw~f~ 193 (195)
|++||+|+|++|+|||||.+++++|||+||+|+|+|+|+||+|+..++.+||||.|+
T Consensus 439 L~~~l~G~p~~g~DIGGF~g~~~~EL~~RW~Q~GaF~P~~R~H~~~~~~~~ePw~~~ 495 (666)
T 3nsx_A 439 PSLNMCGFMYTGADLGGFGDDTTRDLLLRFLALGVFTPLMRDHAAEGTREQECYQFE 495 (666)
T ss_dssp HHHHHTTCCSEEECCCCCBTCSCHHHHHHHHHHHTTSSSEEEEECSSBCCCCGGGST
T ss_pred cccccceeeeeccccCcCCCCchHHHHHHHHHHhcCchhhhcccccCcccccccccC
Confidence 999999999999999999999999999999999999999999999888899999996
|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* | Back alignment and structure |
|---|
| >3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* | Back alignment and structure |
|---|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* | Back alignment and structure |
|---|
| >4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* | Back alignment and structure |
|---|
| >2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* | Back alignment and structure |
|---|
| >2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* | Back alignment and structure |
|---|
| >2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* | Back alignment and structure |
|---|
| >2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* | Back alignment and structure |
|---|
| >3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* | Back alignment and structure |
|---|
| >3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* | Back alignment and structure |
|---|
| >3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* | Back alignment and structure |
|---|
| >3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* | Back alignment and structure |
|---|
| >4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* | Back alignment and structure |
|---|
| >2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* | Back alignment and structure |
|---|
| >3cc1_A BH1870 protein, putative alpha-N-acetylgalactosaminidase; structural genomic center for structural genomics, JCSG; HET: MSE PGE PG4 P33; 2.00A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* | Back alignment and structure |
|---|
| >1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 | Back alignment and structure |
|---|
| >3hg3_A Alpha-galactosidase A; glycoprotein, carbohydrate-binding protein, glycosidase, Lys enzyme, (beta/alpha)8 barrel, disease mutation; HET: NAG BMA MAN GLA GLC 2PE; 1.90A {Homo sapiens} PDB: 3tv8_A* 3lx9_A* 3lxa_A* 3lxb_A* 3lxc_A* 3s5z_A* 1r47_A* 1r46_A* 3gxn_A* 3gxt_A* 3hg2_A* 3hg4_A* 3hg5_A* 3gxp_A* 3s5y_A* | Back alignment and structure |
|---|
| >1szn_A Alpha-galactosidase; (beta/alpha)8 barrel,TWO domains, glycoprotein, hydrolase; HET: NAG BMA MAN; 1.54A {Hypocrea jecorina} SCOP: b.71.1.1 c.1.8.1 PDB: 1t0o_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 195 | ||||
| d2f2ha4 | 338 | c.1.8.13 (A:248-585) Putative glucosidase YicI, do | 1e-37 | |
| d2f2ha4 | 338 | c.1.8.13 (A:248-585) Putative glucosidase YicI, do | 2e-04 |
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Length = 338 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: YicI catalytic domain-like domain: Putative glucosidase YicI, domain 2 species: Escherichia coli [TaxId: 562]
Score = 131 bits (329), Expect = 1e-37
Identities = 41/191 (21%), Positives = 70/191 (36%), Gaps = 17/191 (8%)
Query: 5 PPKWSLGYNQCRWSYDSEKRVLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDD 64
P ++ + LK + GVD D E D
Sbjct: 134 QPGLAIYDFTNPDACKWYADKLKGLVAMGVDCFKTDFGERIPT---------------DV 178
Query: 65 EIGGCQNHSYYHNVYGMLMARSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVS 124
+ + HN Y + + +K ++ + R+ +G+Q++ W GD +
Sbjct: 179 QWFDGSDPQKMHNHYAYIYNELVWNVLKDTVGEEEAVLFARSASVGAQKFPVHWGGDCYA 238
Query: 125 NWEHLHMSISMVLQLGLSGQPLSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDS 184
N+E + S+ L +GLSG DIGGF+ A ++ RW G + R H
Sbjct: 239 NYESMAESLRGGLSIGLSGFGFWSHDIGGFENTAPAHVYKRWCAFGLLSSHSRLH--GSK 296
Query: 185 IDHEPWSFGEE 195
PW++ +E
Sbjct: 297 SYRVPWAYDDE 307
|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Length = 338 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 195 | |||
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 100.0 | |
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 95.7 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 93.17 | |
| d1uasa2 | 273 | Melibiase {Rice (Oryza sativa) [TaxId: 4530]} | 90.12 |
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: YicI catalytic domain-like domain: Putative glucosidase YicI, domain 2 species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=5.2e-46 Score=319.59 Aligned_cols=162 Identities=25% Similarity=0.506 Sum_probs=145.1
Q ss_pred hhcccccccHHHHHHHHHHcCcceEEecCCccccccCCccCCCCCcccCCCCCCCCcccccchhhhhHHHHHHHHHHHHH
Q 044305 13 NQCRWSYDSEKRVLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMARSTYEGMK 92 (195)
Q Consensus 13 ~a~~W~~~~~~~~~~~l~~~Gvdg~w~D~~Ep~~~~~~~~~~p~~~~~~~~~~~g~~~~~~~~hn~Y~~~~~~a~~e~~~ 92 (195)
++++||. ++++.++++||||||+|++|+.. .+..+.+. ..+.++||+|+++++|+++|+++
T Consensus 146 ~a~~w~~----~~~~~~~~~Gidg~w~D~~e~~~---------~d~~~~~~------~~~~~~~n~y~~~~~~~~~~~~~ 206 (338)
T d2f2ha4 146 DACKWYA----DKLKGLVAMGVDCFKTDFGERIP---------TDVQWFDG------SDPQKMHNHYAYIYNELVWNVLK 206 (338)
T ss_dssp HHHHHHH----HHHHHHHHTTCCEEEECCCCCCC---------SSSBCTTC------CCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHH----HHhhcccccCCceEEecCCCCCC---------CccccccC------cchhhhcchhHHHHHHHHHHHHH
Confidence 6788887 47888999999999999999753 22222211 25788999999999999999999
Q ss_pred hhcCCCCcEEEeccccCCCCcccceeCCCCCCChHHHHHHHHHHHHhhccCCCccccCCCCCCCCCCHHHHHHHHHhhhh
Q 044305 93 LADKDKRPFVLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVLQLGLSGQPLSGPDIGGFDGNATPRLFGRWMGIGAM 172 (195)
Q Consensus 93 ~~~~~~r~~~~sRs~~~G~qr~~~~w~GD~~s~W~~L~~~i~~~l~~~l~G~~~~g~DigGf~~~~~~EL~iRW~Q~g~f 172 (195)
+..+++|+++++||+++|+|||+++|+||+.++|++|+.+|+.+|++|++|+|++|+|||||.+++++|||+||+|+++|
T Consensus 207 ~~~~~~r~~~~~rs~~~Gsqry~~~W~GD~~s~w~~L~~~i~~~l~~~l~G~p~~g~DigGf~~~~~~EL~~RW~q~~~f 286 (338)
T d2f2ha4 207 DTVGEEEAVLFARSASVGAQKFPVHWGGDCYANYESMAESLRGGLSIGLSGFGFWSHDIGGFENTAPAHVYKRWCAFGLL 286 (338)
T ss_dssp TTTCGGGCCEEESCBCTTGGGSCCEECCCCCSSHHHHHHHHHHHHHHHTTTCCCEEEETTCSSSCCCHHHHHHHHHHHHT
T ss_pred HhccccccceeeccccccccccceEecCCCCCChHHHHHHHHHHHHHHHcCCCccCCCcCCCCCCCCHHHHHHHHHHHhc
Confidence 88778999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccCCCCCCCCCCCCCCCCC
Q 044305 173 FPFCRGHTESDSIDHEPWSFGEE 195 (195)
Q Consensus 173 ~P~~r~h~~~~~~~~ePw~f~~e 195 (195)
+|+||+|+.. ..++||.|++|
T Consensus 287 ~P~~r~h~~~--~~~~Pw~~~~~ 307 (338)
T d2f2ha4 287 SSHSRLHGSK--SYRVPWAYDDE 307 (338)
T ss_dssp SSEEEECCSS--SCCCGGGTCHH
T ss_pred chheecCCCC--CCCCCccCChH
Confidence 9999999876 47899999864
|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|