Citrus Sinensis ID: 044349

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MRIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET
cEEEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccc
ccEEEEEEcccHHHHHHHHHHHHHHHHHccccHccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccc
mriiagkrytsqessdfQEQATNIFAFFgklgasdalpflrwmdiggnerlMRKTAKEFDIVLQEWLDEHtmkrvsgqvkgdEDFMYVMLSLLddnaellpdrdsdsVIKATCLALILAAAET
mriiagkrytsqessdfQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET
MRIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET
********************ATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILA****
MRIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLD*****************MYVMLSLLDD****LPDRDSDSVIKATCLALILAAAE*
*****************QEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET
MRIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRV******DEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAE*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q43068 544 Cytochrome P450 82A1 (Fra N/A no 0.983 0.222 0.383 2e-20
O49396 512 Cytochrome P450 82C3 OS=A yes no 1.0 0.240 0.402 2e-20
O49859 525 Cytochrome P450 82A4 OS=G no no 0.975 0.228 0.398 3e-20
O49394 523 Cytochrome P450 82C2 OS=A no no 1.0 0.235 0.375 2e-19
O49858 527 Cytochrome P450 82A3 OS=G no no 0.983 0.229 0.389 1e-17
O81972 522 Cytochrome P450 82A2 OS=G no no 0.959 0.226 0.406 9e-17
Q9SZ46 524 Cytochrome P450 82C4 OS=A no no 1.0 0.234 0.335 1e-16
P48418 506 Flavonoid 3',5'-hydroxyla N/A no 0.861 0.209 0.333 3e-08
P48419 508 Flavonoid 3',5'-hydroxyla N/A no 0.861 0.208 0.333 2e-07
P93147 499 Isoflavone 2'-hydroxylase N/A no 0.926 0.228 0.267 2e-07
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function desciption
 Score = 97.8 bits (242), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/133 (38%), Positives = 77/133 (57%), Gaps = 12/133 (9%)

Query: 1   MRIIAGKR-------YTSQESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMR 53
           +R++ GKR          +E+  F E   +     G     D +PFL+W+D+GG+E+ M+
Sbjct: 214 LRMVVGKRCFGDVDVENKEEAKRFLENIRDFMRLIGTFTVGDGVPFLKWLDLGGHEKEMK 273

Query: 54  KTAKEFDIVLQEWLDEHTMKRVSG---QVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIK 110
           K AK+FD++L EWL+EH  K+  G   +V G+ DFM  ML +L D    +   D D++IK
Sbjct: 274 KCAKKFDVMLNEWLEEHREKKGLGSEDKVVGERDFMDAMLLVLKDKP--IEGFDVDTIIK 331

Query: 111 ATCLALILAAAET 123
           AT L LIL  ++T
Sbjct: 332 ATTLELILGGSDT 344

Pisum sativum (taxid: 3888)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function description
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description
>sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 Back     alignment and function description
>sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 Back     alignment and function description
>sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
255538494 522 cytochrome P450, putative [Ricinus commu 0.983 0.231 0.564 1e-30
302142408 929 unnamed protein product [Vitis vinifera] 1.0 0.132 0.492 8e-27
225458444 554 PREDICTED: cytochrome P450 82A3-like [Vi 1.0 0.222 0.492 1e-26
255538496 528 cytochrome P450, putative [Ricinus commu 0.991 0.231 0.477 4e-26
255538466 523 cytochrome P450, putative [Ricinus commu 1.0 0.235 0.488 6e-26
224112939 528 cytochrome P450 [Populus trichocarpa] gi 0.991 0.231 0.476 8e-25
224137298 342 cytochrome P450 [Populus trichocarpa] gi 0.991 0.356 0.469 1e-24
224137286 465 cytochrome P450 [Populus trichocarpa] gi 1.0 0.264 0.476 4e-24
359492641 555 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.983 0.218 0.446 8e-24
224137290 538 cytochrome P450 [Populus trichocarpa] gi 0.731 0.167 0.6 9e-24
>gi|255538494|ref|XP_002510312.1| cytochrome P450, putative [Ricinus communis] gi|223551013|gb|EEF52499.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (70%), Gaps = 10/131 (7%)

Query: 2   RIIAGKRY----TSQESSD---FQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRK 54
           RII GKRY    T+QE  D   ++E   N F   GK   SDA+PFLRW+D+GG E+ M+K
Sbjct: 193 RIIFGKRYINYTTTQEDGDSDQWREAVRNFFVLSGKFVVSDAVPFLRWLDLGGYEKSMKK 252

Query: 55  TAKEFDIVLQEWLDEHTMKRV--SGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKAT 112
           TA+E D+V+Q WLDEH  KR+    +VKG+EDFM VMLS+LDD AE LP  D+D++ KAT
Sbjct: 253 TARELDVVVQGWLDEHKRKRLMSGNRVKGEEDFMDVMLSILDD-AEELPSLDADTINKAT 311

Query: 113 CLALILAAAET 123
           CLAL LAA+ T
Sbjct: 312 CLALTLAASGT 322

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302142408|emb|CBI19611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458444|ref|XP_002282014.1| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255538496|ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis] gi|223551014|gb|EEF52500.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255538466|ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis] gi|223550999|gb|EEF52485.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112939|ref|XP_002332682.1| cytochrome P450 [Populus trichocarpa] gi|222838808|gb|EEE77159.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224137298|ref|XP_002327091.1| cytochrome P450 [Populus trichocarpa] gi|222835406|gb|EEE73841.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224137286|ref|XP_002327088.1| cytochrome P450 [Populus trichocarpa] gi|222835403|gb|EEE73838.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492641|ref|XP_003634448.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224137290|ref|XP_002327089.1| cytochrome P450 [Populus trichocarpa] gi|222835404|gb|EEE73839.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
TAIR|locus:2116622 512 CYP82C3 ""cytochrome P450, fam 1.0 0.240 0.417 2.5e-19
TAIR|locus:2116652 523 CYP82C2 ""cytochrome P450, fam 1.0 0.235 0.375 8.9e-18
TAIR|locus:2116607 524 CYP82C4 ""cytochrome P450, fam 1.0 0.234 0.380 3e-16
TAIR|locus:2035267 510 CYP703A2 ""cytochrome P450, fa 0.934 0.225 0.327 6.3e-09
TAIR|locus:2040174 527 CYP82F1 ""cytochrome P450, fam 0.967 0.225 0.290 1.4e-08
TAIR|locus:2158222 507 CYP81G1 ""cytochrome P450, fam 0.951 0.230 0.276 2.2e-08
TAIR|locus:2090275 515 CYP82G1 "cytochrome P450, fami 0.707 0.168 0.314 1.3e-07
TAIR|locus:2114965 518 CYP81H1 ""cytochrome P450, fam 0.951 0.225 0.292 1.6e-07
TAIR|locus:2115075 492 CYP81D4 ""cytochrome P450, fam 0.910 0.227 0.285 2.3e-06
TAIR|locus:2142878 513 TT7 "TRANSPARENT TESTA 7" [Ara 0.861 0.206 0.300 2.4e-06
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 2.5e-19, P = 2.5e-19
 Identities = 56/134 (41%), Positives = 80/134 (59%)

Query:     1 MRIIAGKRYTS---QESSDFQEQATN----IFAFFGKLG---ASDALPFLRWMDIGGNER 50
             MR++AGKRY      ESS+  E+A      I  FF  +G    SDA P L W+D+ G+E+
Sbjct:   180 MRMVAGKRYFGGGGAESSEHTEEARQWRKGIAKFFHLVGIFTVSDAFPKLGWLDLQGHEK 239

Query:    51 LMRKTAKEFDIVLQEWLDEHTMKR-VSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVI 109
              M++T +E D++L+ W++ H  +R VSG    D DF+ VMLSL +         D+++ I
Sbjct:   240 EMKQTRRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKLSHLQYDANTCI 299

Query:   110 KATCLALILAAAET 123
             K TCLALIL  +ET
Sbjct:   300 KTTCLALILGGSET 313
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035267 CYP703A2 ""cytochrome P450, family 703, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158222 CYP81G1 ""cytochrome P450, family 81, subfamily G, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114965 CYP81H1 ""cytochrome P450, family 81, subfamily H, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115075 CYP81D4 ""cytochrome P450, family 81, subfamily D, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014717001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (494 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-15
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 8e-12
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-07
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 9e-06
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score = 71.4 bits (175), Expect = 1e-15
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 10/129 (7%)

Query: 2   RIIAGKRYTS------QESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKT 55
           R++ GK+Y        +E+ +F      +F   G +   D LP  RW+D  G E+ MR+ 
Sbjct: 186 RMLLGKQYFGAESAGPKEAMEFMHITHELFRLLGVIYLGDYLPAWRWLDPYGCEKKMREV 245

Query: 56  AKEFDIVLQEWLDEH-TMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCL 114
            K  D    + +DEH   +        D DF+ V+LSL  +N +     D D  IKA   
Sbjct: 246 EKRVDEFHDKIIDEHRRARSGKLPGGKDMDFVDVLLSLPGENGK--EHMD-DVEIKALMQ 302

Query: 115 ALILAAAET 123
            +I AA +T
Sbjct: 303 DMIAAATDT 311

Length = 514
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.66
PLN03234 499 cytochrome P450 83B1; Provisional 99.25
PLN02971 543 tryptophan N-hydroxylase 99.2
PLN02183 516 ferulate 5-hydroxylase 99.19
PLN02687 517 flavonoid 3'-monooxygenase 99.12
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.12
PLN02966 502 cytochrome P450 83A1 99.06
PLN03112 514 cytochrome P450 family protein; Provisional 99.05
PLN02655 466 ent-kaurene oxidase 99.03
PLN02290 516 cytokinin trans-hydroxylase 99.0
PLN00168 519 Cytochrome P450; Provisional 98.96
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 98.94
PLN03018 534 homomethionine N-hydroxylase 98.87
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 98.82
PTZ00404 482 cytochrome P450; Provisional 98.75
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 98.68
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 98.62
PLN03195 516 fatty acid omega-hydroxylase; Provisional 98.53
PLN02394 503 trans-cinnamate 4-monooxygenase 98.5
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 98.46
PLN02500 490 cytochrome P450 90B1 98.46
PLN02936 489 epsilon-ring hydroxylase 98.46
PLN02738 633 carotene beta-ring hydroxylase 98.44
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.42
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.4
PLN02302 490 ent-kaurenoic acid oxidase 98.38
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.36
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.27
PLN02774 463 brassinosteroid-6-oxidase 97.91
PLN02196 463 abscisic acid 8'-hydroxylase 97.46
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 97.02
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.66  E-value=9.8e-16  Score=103.75  Aligned_cols=117  Identities=31%  Similarity=0.558  Sum_probs=92.8

Q ss_pred             Ceeeecccccc-c--chhHHHHHHHHHHHHhcCCcchhhhh-hccccc-ccchHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q 044349            1 MRIIAGKRYTS-Q--ESSDFQEQATNIFAFFGKLGASDALP-FLRWMD-IGGNERLMRKTAKEFDIVLQEWLDEHTMKRV   75 (123)
Q Consensus         1 ~~~~fG~~~~~-~--~~~~~~~~~~~~~~~~~~~~~~~~~P-~l~~l~-~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~   75 (123)
                      |+++||+||+. +  ...++.+++.+.....+.+.+.+++| |+.+++ ..+..++.+.....++.++.++|++|++..+
T Consensus       180 ~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~  259 (489)
T KOG0156|consen  180 CRMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIG  259 (489)
T ss_pred             HHHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            57899999983 2  33457888999999899888899999 777773 3466777777777899999999999988762


Q ss_pred             cCCCCCCCCHHHHHhhccccccccCCCCCCHHHHHHHHHHHHHhhccC
Q 044349           76 SGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET  123 (123)
Q Consensus        76 ~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~i~~~~~~~~~aG~eT  123 (123)
                      .   .+.+||+|.||...+++.  .+. +|+++|...|.++++||+||
T Consensus       260 ~---~~~~D~vD~lL~~~~~~~--~~~-~t~~~i~~~~~dl~~AGtdT  301 (489)
T KOG0156|consen  260 D---EEGRDFVDALLKLMKEEK--AEG-LTDDHLKALILDLFLAGTDT  301 (489)
T ss_pred             c---CCCCcHHHHHHHhhcccc--cCC-CCHHHHHHHHHHHHhcccch
Confidence            1   223899999998876431  112 99999999999999999998

>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-14
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-06
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-05
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-04
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-04
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-04
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score = 66.9 bits (164), Expect = 2e-14
 Identities = 17/125 (13%), Positives = 38/125 (30%), Gaps = 17/125 (13%)

Query: 1   MRIIAGKRYTS--QESSDFQEQATNIFAFFGKLGASDALPFLRWMDIGGNERLMRKTAKE 58
             ++    Y +     ++     T I+  F +      LP L    +   E+ +   A+E
Sbjct: 159 YSLLFKTGYLTVFGAENNNSAALTQIYEEFRRF--DKLLPKLARTTVNKEEKQIASAARE 216

Query: 59  FDIVLQEWLDEHTMKRVSGQVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALIL 118
               L +WL    + R       ++ ++   +  L D    +         +   L  + 
Sbjct: 217 K---LWKWLTPSGLDR----KPREQSWLGSYVKQLQDEG--IDAEM----QRRAMLLQLW 263

Query: 119 AAAET 123
                
Sbjct: 264 VTQGN 268
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.29
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.25
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.24
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.2
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.19
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.17
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.17
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.15
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.14
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 98.83
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.78
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.75
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 98.71
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 98.7
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 98.67
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 98.66
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 98.65
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 98.61
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 98.56
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.52
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 98.47
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.37
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 98.3
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.28
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 98.27
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 98.27
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 98.07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 98.05
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 97.98
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 97.96
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 97.96
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 97.96
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 97.95
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 97.95
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.92
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 97.92
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 97.92
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 97.91
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 97.9
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 97.9
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 97.89
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 97.86
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 97.85
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 97.84
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 97.83
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 97.82
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 97.82
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 97.81
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 97.81
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 97.8
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 97.79
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 97.77
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 97.75
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 97.73
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 97.72
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 97.71
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 97.7
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 97.66
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 97.57
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 97.5
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 97.49
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 97.39
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 97.37
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 97.34
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 97.33
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 97.3
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 97.26
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 97.24
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 96.9
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 96.62
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 96.27
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 95.85
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 95.54
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
Probab=99.29  E-value=1.2e-11  Score=83.03  Aligned_cols=118  Identities=18%  Similarity=0.217  Sum_probs=77.2

Q ss_pred             eeeecccccc-c-chhHHHHHHHHHHHHhcCCc--chhhhhhcccccccchHHHHHHHHHHHHHHHHHHHHHHHHhhhcC
Q 044349            2 RIIAGKRYTS-Q-ESSDFQEQATNIFAFFGKLG--ASDALPFLRWMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSG   77 (123)
Q Consensus         2 ~~~fG~~~~~-~-~~~~~~~~~~~~~~~~~~~~--~~~~~P~l~~l~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~   77 (123)
                      +++||.+++. + ....+.+.+...+.......  +.+.+||+++++ .+..++..+....+.+++.++++++++.... 
T Consensus       167 ~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~l~~lp-~~~~~~~~~~~~~~~~~~~~~i~~r~~~~~~-  244 (481)
T 3czh_A          167 LIIFGERFTYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILP-FGKHQQLFRNAAVVYDFLSRLIEKASVNRKP-  244 (481)
T ss_dssp             HHHHSSCCCTTCHHHHHHHHHHHHHHHHTTSHHHHHHHHCGGGGGCS-SSHHHHHHHHHHHHHHHHHHHHHHHHTTCCT-
T ss_pred             HHHcCCCCCCCCHHHHHHHHHHHHHHhhhccchhHHhhhhHHHHhCC-chHHHHHHHHHHHHHHHHHHHHHHHHHhcCC-
Confidence            4578988862 1 22334444455544333222  456789887662 2344566777778888999999888765432 


Q ss_pred             CCCCCCCHHHHHhhccccccccCCCCCCHHHHHHHHHHHHHhhccC
Q 044349           78 QVKGDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET  123 (123)
Q Consensus        78 ~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~i~~~~~~~~~aG~eT  123 (123)
                        ..+.|+++.|+....+.....+..+++++|.+++.++++||+||
T Consensus       245 --~~~~d~l~~ll~~~~~~~~~~~~~l~~~ei~~~~~~l~~AG~dT  288 (481)
T 3czh_A          245 --QLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTET  288 (481)
T ss_dssp             --TCCSSHHHHHHHHHHHTTTCTTCCCCHHHHHHHHHHHHHHHHHH
T ss_pred             --CchHHHHHHHHHHHHhcccCccccccHHHHHHHHHHHHHhccch
Confidence              34579999999764321101123599999999999999999997
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.87
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 98.77
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.44
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.26
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.05
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 97.96
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 97.2
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 96.85
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 96.83
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 96.76
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 96.52
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 96.27
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 95.62
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 94.36
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 92.12
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 92.01
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 91.27
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 88.11
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 84.26
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 84.18
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=98.87  E-value=3.7e-09  Score=68.52  Aligned_cols=110  Identities=15%  Similarity=0.234  Sum_probs=69.2

Q ss_pred             eeeecccccccchhHHHHHHHHHHHHhcCCcchhhhhhcc-cccccchHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCC
Q 044349            2 RIIAGKRYTSQESSDFQEQATNIFAFFGKLGASDALPFLR-WMDIGGNERLMRKTAKEFDIVLQEWLDEHTMKRVSGQVK   80 (123)
Q Consensus         2 ~~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~-~l~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~   80 (123)
                      .++||.++.......+.+.+..+.+..      ..++++. ++ +....++..+..+.+.+++...++++++....+  .
T Consensus       146 ~~~fG~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~l-~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~~~~--~  216 (445)
T d2ciba1         146 ACLIGKKFRDQLDGRFAKLYHELERGT------DPLAYVDPYL-PIESFRRRDEARNGLVALVADIMNGRIANPPTD--K  216 (445)
T ss_dssp             HHHTCHHHHTTCCHHHHHHHHHHHTTC------CGGGGTCTTC-SCHHHHHHHHHHHHHHHHHHHHHHHHHHCC------
T ss_pred             eccccccccchhhhHHHHHHHHhhhhh------hhhccccchh-hhHHHHHHHHHHHHHHHHHHHHHhhhccccccc--c
Confidence            356788876323445555555543211      1122221 22 123456677788888888888888777665432  4


Q ss_pred             CCCCHHHHHhhccccccccCCCCCCHHHHHHHHHHHHHhhccC
Q 044349           81 GDEDFMYVMLSLLDDNAELLPDRDSDSVIKATCLALILAAAET  123 (123)
Q Consensus        81 ~~~d~l~~ll~~~~~~~~~~~~~~~~~~i~~~~~~~~~aG~eT  123 (123)
                      ..+|+++.|++...+.   ....++++++.+++.++++||+||
T Consensus       217 ~~~dll~~ll~~~~~~---~~~~ls~~ei~~~~~~ll~ag~~t  256 (445)
T d2ciba1         217 SDRDMLDVLIAVKAET---GTPRFSADEITGMFISMMFAGHHT  256 (445)
T ss_dssp             -CCCHHHHHHHCBCTT---SSBSCCHHHHHHHHHHHHHHHHHH
T ss_pred             cccchhhhhhcccccc---ccccCCcchhhhhhhhhhhhcccc
Confidence            5689999999875432   234699999999999999999986
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure