Citrus Sinensis ID: 044387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
ccccccccccccccccHHHHHHHHccccHHHHHHHHHHccccHHHHccccEEEEEccccccccccccccccHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccEEEEEEEEEccccccccccccccEEEEEEEcccccHHHHHHHccccccEEEEcEEEccccccEEEEEEcccccEEEEEEccccccccccccEEEEEccccEEEEEEEcccccEEEEcccccEEEEEEEEEcccccccHHHHHHHHHccccccEEEEEccEEEEEEccccccccccccEEEEEEEEccccccHHHHHHcccccccEEEEEEccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHcccccccccEEEEc
ccccccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccccEEccccEEEcccEEEEEEEcEEEccccccccccHHHHEEEEEEEEccHHHHHHHHHcccHHHEEEEEEcccccccEEEEEEEccccEEEEEEEccccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEcccccccHHHHHHHHHHHHccEEEEEccccEEEEcccccccccccccEEEEEEEcccccHHHHHHHHHccccccEEEEEcccccccccccccccccccccHHccccEEEEEEEcccccHHHHHHHHHHHHHcHHHEEEEEEEccccccHHHHHHHHHHHcccccccccEEEEc
MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYfddrqsrrlpgmmgdpmpgfEEFVETVltgtyptnittffvhcsrpvdlssfhLWVCSAVRRNAREIELYLDqnhrvelpeelYTSVSVEVLKLMSDFVikvpaggtsfpnvKILSVQlespenslteklfcscpaleELSIQAYlndegpttkfvissstlkrcTLWVATEGEMFTQAEYKVritapslerLHIMSDIFGKFVVHDLNSLTDVILDIVygewsrvdpnRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRkqsrfevteeqfgwiegdivpncllQHVKKIEikgvegdddeLILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASnrcklelv
mqkqtevkadwisalpdSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKlyfddrqsrrlpGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLdqnhrvelpEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATegemftqaeYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQfgwiegdivpNCLLQHVKKIEikgvegdddeLILVDYLLKYSSVLEVMVICFKgsvskqerrdigrsilqvqrasnrcklelv
MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVilsssqnlqslilRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
********ADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDR************MPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSV***************************
******V****ISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
********ADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
*********DWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTVSYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRCKLELV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q9SCQ5427 Putative FBD-associated F yes no 0.912 0.953 0.295 9e-30
Q56XS8456 F-box/FBD/LRR-repeat prot no no 0.932 0.912 0.277 2e-29
Q9FWZ1451 F-box/LRR-repeat protein no no 0.928 0.917 0.276 1e-27
Q9M190 532 Putative F-box/LRR-repeat no no 0.912 0.765 0.267 1e-27
Q9ZV93458 F-box/FBD/LRR-repeat prot no no 0.943 0.919 0.261 2e-26
Q9LXQ6427 Putative F-box protein At no no 0.923 0.964 0.251 9e-26
Q0V7P8459 FBD-associated F-box prot no no 0.948 0.921 0.262 5e-25
Q9FNJ5450 F-box/FBD/LRR-repeat prot no no 0.937 0.928 0.264 5e-25
Q9FNJ4443 Putative F-box/FBD/LRR-re no no 0.930 0.936 0.274 1e-24
Q8H1R7419 F-box/FBD/LRR-repeat prot no no 0.890 0.947 0.276 1e-24
>sp|Q9SCQ5|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 134/454 (29%), Positives = 211/454 (46%), Gaps = 47/454 (10%)

Query: 10  DWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDP 69
           D IS L D +L  I+S LPTK+ V T LL++RWK +W  + KL FDD      P   G  
Sbjct: 2   DRISNLSDDLLLKIVSSLPTKDVVVTMLLSKRWKFLWMMVPKLRFDDEFELE-PSYYG-- 58

Query: 70  MPGFEEFVET--VLTGTYPTNITTFFVH-CSRPVDLSSFHLWVCSAVRRNAREIEL---- 122
              F ++V+   VL          F V  C    D+++   W+   + RN RE+E+    
Sbjct: 59  --RFLKYVDKSMVLNRAQVLETVKFNVGPCCSSEDIAT---WIRIGMVRNMRELEISHCE 113

Query: 123 -YLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILS-VQLESPENSLT 180
            Y  ++  ++LP+ LYT   +EVLKL S  V+ VP     FP++K L  V +E       
Sbjct: 114 GYFREHRSIKLPKSLYTYEKLEVLKLASTVVLNVPI-DVCFPSLKSLHLVCVEYKTKKSH 172

Query: 181 EKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITA 240
            +L   CP LEEL +    N       F +   TL+  ++ + T GE++   ++   + A
Sbjct: 173 RRLLSGCPVLEELVLDKSYNS-FHVRSFYVEIPTLQSLSI-LDTSGELY--GDFTFVVNA 228

Query: 241 PSLERLHIMSDIFGKFVVHD-LNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTV 299
           P+L+  + + D +G   + D +  + DV + ++Y      +P +   LL  L + K L++
Sbjct: 229 PALKYFNFV-DFYGDLCLRDNMPEVVDVNIKVIYR-----NPKK---LLGPLKSVKRLSL 279

Query: 300 SYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLPVILSSSQNLQSLILRKQSRFEV 359
                  L +  H+ F  L HL+    A+  + W +L  +L SS  LQ L   K    + 
Sbjct: 280 CLSPSTTLHN--HMEFYQLVHLELCGDAL--MWWDLLTWMLQSSPKLQVL---KIYECKC 332

Query: 360 TEEQF-------GWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMV 412
            E  +        W E   VP CLL H+   E K     D+E  +V Y+LK +  L+   
Sbjct: 333 EEHDYLDDPIEEHWEEPSSVPQCLLFHLNIFEWKYYNAGDEEKKVVAYILKNARQLKTAT 392

Query: 413 ICFKGSV-SKQERRDIGRSILQVQRASNRCKLEL 445
                 +  K+ER      ++ + RAS+ C+L L
Sbjct: 393 FSAASYLYPKEERSRELNELVYMARASSSCQLLL 426

Arabidopsis thaliana (taxid: 3702)
>sp|Q56XS8|FDL2_ARATH F-box/FBD/LRR-repeat protein At1g13780 OS=Arabidopsis thaliana GN=At1g13780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWZ1|FBL13_ARATH F-box/LRR-repeat protein 13 OS=Arabidopsis thaliana GN=FBL13 PE=2 SV=1 Back     alignment and function description
>sp|Q9M190|FBL49_ARATH Putative F-box/LRR-repeat protein At3g42770 OS=Arabidopsis thaliana GN=At3g42770 PE=4 SV=1 Back     alignment and function description
>sp|Q9ZV93|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750 OS=Arabidopsis thaliana GN=At1g78750 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXQ6|FB193_ARATH Putative F-box protein At3g44060 OS=Arabidopsis thaliana GN=At3g44060 PE=4 SV=1 Back     alignment and function description
>sp|Q0V7P8|FBD15_ARATH FBD-associated F-box protein At5g27750 OS=Arabidopsis thaliana GN=At5g27750 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNJ5|FDL31_ARATH F-box/FBD/LRR-repeat protein At5g22660 OS=Arabidopsis thaliana GN=At5g22660 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNJ4|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1 Back     alignment and function description
>sp|Q8H1R7|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340 OS=Arabidopsis thaliana GN=At4g26340 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
147812093 607 hypothetical protein VITISV_040899 [Viti 0.973 0.714 0.324 5e-46
296086770411 unnamed protein product [Vitis vinifera] 0.849 0.922 0.304 1e-34
356566321409 PREDICTED: F-box/FBD/LRR-repeat protein 0.878 0.958 0.285 2e-33
224114976462 predicted protein [Populus trichocarpa] 0.950 0.917 0.287 5e-31
297819758426 F-box family protein [Arabidopsis lyrata 0.912 0.955 0.295 1e-29
357492961436 F-box/LRR-repeat protein [Medicago trunc 0.912 0.933 0.299 5e-29
297844280455 F16A14.1 [Arabidopsis lyrata subsp. lyra 0.928 0.909 0.282 2e-28
15229834427 putative FBD-associated F-box protein [A 0.912 0.953 0.295 6e-28
8778383451 F16A14.1 [Arabidopsis thaliana] gi|46518 0.932 0.922 0.277 1e-27
79343779456 F-box/FBD/LRR-repeat -containing protein 0.932 0.912 0.277 1e-27
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 149/459 (32%), Positives = 237/459 (51%), Gaps = 25/459 (5%)

Query: 1   MQKQTEVKADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSR 60
           M  + E   D IS LPD +LCHILS+LPTK AV TS+L++RW+ +W S+  L FDD    
Sbjct: 1   MGSEYEESRDIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWL 60

Query: 61  RLPGM--MGDPMPGFEEFVETVLTGTYPTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAR 118
               +  + + +  F+ FV+ VL  +  + I  F +   R  +L S + W+C A+ R  +
Sbjct: 61  NPSTLVELEERIIMFQNFVDGVLRHSEVSCIKKFRLG-YRDNNLDSVYSWICIALERRVQ 119

Query: 119 EIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILSVQ-LESPEN 177
           E++L+L  + RVELP   +   ++ V+KL     + +P      P++K L ++ +E  ++
Sbjct: 120 ELDLHLLIDWRVELPPMFFICKTLVVVKLSCALFLDIPT-TVWLPSLKALHLKSVEYSDD 178

Query: 178 SLTEKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEG--EMFTQ--AE 233
              +KL   CP LEEL I+    D        +S+ +LK   ++  T+G    + Q   +
Sbjct: 179 DSIQKLLSGCPVLEELVIEREERDNQWVVN--VSNPSLKILRIFFFTDGFAHPYEQEDQD 236

Query: 234 YKVRITAPSLERLHIMSDIFGKFVVHDLNSLTDVILDIVYG--EWSRVDPNRAI------ 285
           YKV + AP+LE L I   +   + V DL SL    +D+     E+     N  I      
Sbjct: 237 YKVVVDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPI 296

Query: 286 -QLLQRLNNTKNLTVSYGVLCALDHAYHIW-FPALSHLQHLE-VAVGAIGWAVLPVILSS 342
            +LL R++N K L+++   L +L      +  P   ++  LE + +G   W  LP  L S
Sbjct: 297 YELLGRISNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNFLHS 356

Query: 343 SQNLQSLILRKQSRFEVTEEQFGWIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLL 402
           S NL++L++      E+  E  GW+    VP CL+ H+K+IEI+ + G+D EL  V+YLL
Sbjct: 357 SPNLEALVIETGYTNELIPE--GWLMPLQVPACLVLHLKEIEIRRIVGEDYELEAVEYLL 414

Query: 403 KYSSVLEVMVICFKGSVSKQERRDIGRSILQVQRASNRC 441
           K + VL+ M I    S   QE   + + +L + R S  C
Sbjct: 415 KNAEVLQQMTIDCHESYMDQEFC-VCKKLLGLPRGSRSC 452

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356566321|ref|XP_003551381.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g56420-like [Glycine max] Back     alignment and taxonomy information
>gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357492961|ref|XP_003616769.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355518104|gb|AES99727.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297844280|ref|XP_002890021.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] gi|297335863|gb|EFH66280.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15229834|ref|NP_190640.1| putative FBD-associated F-box protein [Arabidopsis thaliana] gi|75265626|sp|Q9SCQ5.1|FBD10_ARATH RecName: Full=Putative FBD-associated F-box protein At3g50710 gi|6561974|emb|CAB62440.1| putative protein [Arabidopsis thaliana] gi|332645179|gb|AEE78700.1| putative FBD-associated F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8778383|gb|AAF79391.1|AC068197_1 F16A14.1 [Arabidopsis thaliana] gi|46518457|gb|AAS99710.1| At1g13780 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79343779|ref|NP_172833.2| F-box/FBD/LRR-repeat -containing protein [Arabidopsis thaliana] gi|75217965|sp|Q56XS8.1|FDL2_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g13780 gi|62320538|dbj|BAD95126.1| hypothetical protein [Arabidopsis thaliana] gi|332190947|gb|AEE29068.1| F-box/FBD/LRR-repeat -containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
TAIR|locus:2101674427 AT3G50710 "AT3G50710" [Arabido 0.917 0.957 0.283 9.8e-32
TAIR|locus:2014859456 AT1G13780 "AT1G13780" [Arabido 0.939 0.918 0.264 3.7e-27
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.930 0.920 0.262 7.8e-27
TAIR|locus:2085013 532 AT3G42770 "AT3G42770" [Arabido 0.919 0.770 0.248 1.7e-25
TAIR|locus:2037578458 AT1G78750 "AT1G78750" [Arabido 0.950 0.925 0.248 1.7e-24
TAIR|locus:2161098439 AT5G56380 "AT5G56380" [Arabido 0.926 0.940 0.285 2.1e-24
TAIR|locus:2162489450 AT5G22660 "AT5G22660" [Arabido 0.946 0.937 0.251 3e-23
TAIR|locus:505006162422 AT1G32375 "AT1G32375" [Arabido 0.917 0.969 0.257 1.1e-22
TAIR|locus:2055993448 AT2G04230 "AT2G04230" [Arabido 0.634 0.631 0.287 7.9e-22
TAIR|locus:2015681449 AT1G16930 "AT1G16930" [Arabido 0.811 0.806 0.255 1.7e-21
TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 9.8e-32, P = 9.8e-32
 Identities = 128/452 (28%), Positives = 208/452 (46%)

Query:    10 DWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKLYFDDRQSRRLPGMMGDP 69
             D IS L D +L  I+S LPTK+ V T LL++RWK +W  + KL FDD      P   G  
Sbjct:     2 DRISNLSDDLLLKIVSSLPTKDVVVTMLLSKRWKFLWMMVPKLRFDDEFELE-PSYYGR- 59

Query:    70 MPGFEEFVET--VLTGTYPTNITTFFVH-CSRPVDLSSFHLWVCSAVRRNAREIEL---- 122
                F ++V+   VL          F V  C    D+++   W+   + RN RE+E+    
Sbjct:    60 ---FLKYVDKSMVLNRAQVLETVKFNVGPCCSSEDIAT---WIRIGMVRNMRELEISHCE 113

Query:   123 -YLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAGGTSFPNVKILS-VQLESPENSLT 180
              Y  ++  ++LP+ LYT   +EVLKL S  V+ VP     FP++K L  V +E       
Sbjct:   114 GYFREHRSIKLPKSLYTYEKLEVLKLASTVVLNVPID-VCFPSLKSLHLVCVEYKTKKSH 172

Query:   181 EKLFCSCPALEELSIQAYLNDEGPTTKFVISSSTLKRCTLWVATEGEMFTQAEYKVRITA 240
              +L   CP LEEL +    N       F +   TL+  ++ + T GE++   ++   + A
Sbjct:   173 RRLLSGCPVLEELVLDKSYNSFH-VRSFYVEIPTLQSLSI-LDTSGELY--GDFTFVVNA 228

Query:   241 PSLERLHIMSDIFGKFVVHD-LNSLTDVILDIVYGEWSRVDPNRAIQLLQRLNNTKNLTV 299
             P+L+  + + D +G   + D +  + DV + ++Y      +P +   LL  L + K L++
Sbjct:   229 PALKYFNFV-DFYGDLCLRDNMPEVVDVNIKVIYR-----NPKK---LLGPLKSVKRLSL 279

Query:   300 SYGVLCALDHAYHIWFPALSHLQHLEVAVGAIGWAVLP--VXXXXXXXXXXXXXRKQSRF 357
                    L +  H+ F  L HL+    A+  + W +L   +              K    
Sbjct:   280 CLSPSTTLHN--HMEFYQLVHLELCGDAL--MWWDLLTWMLQSSPKLQVLKIYECKCEEH 335

Query:   358 EVTEEQFG--WIEGDIVPNCLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICF 415
             +  ++     W E   VP CLL H+   E K     D+E  +V Y+LK +  L+      
Sbjct:   336 DYLDDPIEEHWEEPSSVPQCLLFHLNIFEWKYYNAGDEEKKVVAYILKNARQLKTATFSA 395

Query:   416 KGSV-SKQER-RDIGRSILQVQRASNRCKLEL 445
                +  K+ER R++   ++ + RAS+ C+L L
Sbjct:   396 ASYLYPKEERSRELNE-LVYMARASSSCQLLL 426
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2014859 AT1G13780 "AT1G13780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161098 AT5G56380 "AT5G56380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006162 AT1G32375 "AT1G32375" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000972001
SubName- Full=Chromosome chr19 scaffold_111, whole genome shotgun sequence; (360 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 1e-09
pfam0838751 pfam08387, FBD, FBD 3e-08
pfam0064648 pfam00646, F-box, F-box domain 1e-04
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.002
pfam1293747 pfam12937, F-box-like, F-box-like 0.004
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information 
 Score = 54.1 bits (131), Expect = 1e-09
 Identities = 22/71 (30%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 375 CLLQHVKKIEIKGVEGDDDELILVDYLLKYSSVLEVMVICFKGSVSKQERRDIGRSILQV 434
           CLL  ++ +EIKG  G ++E  LV Y L+ +  L+ + I  + +   +E+ +I + +L +
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVE-TSDDEEKLEILKELLSL 60

Query: 435 QRASNRCKLEL 445
            RAS+ C+++ 
Sbjct: 61  PRASSSCQVQF 71

Length = 72
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.59
KOG4341483 consensus F-box protein containing LRR [General fu 99.54
smart0057972 FBD domain in FBox and BRCT domain containing plan 99.46
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.3
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.69
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.57
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.38
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.28
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.21
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.13
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.12
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.08
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.07
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.85
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.61
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.48
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.42
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.26
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.23
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.21
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.19
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.95
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.76
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.63
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.2
KOG0617264 consensus Ras suppressor protein (contains leucine 95.92
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.5
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.41
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.51
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.21
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.02
KOG0281499 consensus Beta-TrCP (transducin repeats containing 93.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.7
KOG2997366 consensus F-box protein FBX9 [General function pre 92.98
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 92.92
KOG0617264 consensus Ras suppressor protein (contains leucine 92.86
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 91.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 91.64
PLN03150623 hypothetical protein; Provisional 91.01
KOG2123 388 consensus Uncharacterized conserved protein [Funct 90.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 89.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.68
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 87.67
PRK15386426 type III secretion protein GogB; Provisional 86.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.6
PRK15386426 type III secretion protein GogB; Provisional 85.02
PLN03150623 hypothetical protein; Provisional 82.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 81.75
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 80.03
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.59  E-value=3.8e-17  Score=143.22  Aligned_cols=187  Identities=20%  Similarity=0.209  Sum_probs=124.4

Q ss_pred             cCCCChHHHHHHhccCCccceeeecccccchHH------HhccCceeEeeccccccCCCCCCCCCCcHHHHHHHhhccCC
Q 044387           12 ISALPDSVLCHILSYLPTKNAVATSLLARRWKL------VWTSLQKLYFDDRQSRRLPGMMGDPMPGFEEFVETVLTGTY   85 (446)
Q Consensus        12 is~LPd~vL~~Ils~L~~~~~~r~s~lsrrWr~------lw~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~~   85 (446)
                      +..|||||+..||+.|+-||+.+.+.|||||.+      +|..   +++....+  +|           ....+.+. + 
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~---lDl~~r~i--~p-----------~~l~~l~~-r-  159 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQT---LDLTGRNI--HP-----------DVLGRLLS-R-  159 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceee---eccCCCcc--Ch-----------hHHHHHHh-C-
Confidence            678999999999999999999999999999986      4543   33333333  12           22223222 2 


Q ss_pred             CCcceEEEEEecCCCCccchhHHHHHHHhCCceEEEEEecCCCccccCCcccccCcccEEEEeceeEeecCCC---CccC
Q 044387           86 PTNITTFFVHCSRPVDLSSFHLWVCSAVRRNAREIELYLDQNHRVELPEELYTSVSVEVLKLMSDFVIKVPAG---GTSF  162 (446)
Q Consensus        86 ~~~l~~l~l~~~~~~~~~~~~~wl~~~~~~~v~~L~l~~~~~~~~~lp~~l~~~~~L~~L~L~~~~~~l~~~~---~~~~  162 (446)
                        .|..|++.-. ..+...++.. ...++.+++++++....-....+.-.+..|..|+.|.|.|  ..+.+|-   ...-
T Consensus       160 --gV~v~Rlar~-~~~~prlae~-~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg--~~LdD~I~~~iAkN  233 (419)
T KOG2120|consen  160 --GVIVFRLARS-FMDQPRLAEH-FSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEG--LRLDDPIVNTIAKN  233 (419)
T ss_pred             --CeEEEEcchh-hhcCchhhhh-hhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccc--cccCcHHHHHHhcc
Confidence              3666665422 1122222221 1234557899998775444455555566799999999999  8888863   4567


Q ss_pred             CcccEEEeeeec-CCchhhhhhhhcCCccceeEEEeecCCCCCCeEEE--eecCCcceEEEeee
Q 044387          163 PNVKILSVQLES-PENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFV--ISSSTLKRCTLWVA  223 (446)
Q Consensus       163 ~~L~~L~L~~~~-~~~~~l~~lls~cp~Le~L~l~~~~~~~~~~~~~~--i~~~~L~~L~l~~~  223 (446)
                      .+|+.|+|+.+. ++..++.-++++|..|.+|.|+-|...... +...  ..+++|+.|.+.+|
T Consensus       234 ~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~-Vtv~V~hise~l~~LNlsG~  296 (419)
T KOG2120|consen  234 SNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEK-VTVAVAHISETLTQLNLSGY  296 (419)
T ss_pred             ccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchh-hhHHHhhhchhhhhhhhhhh
Confidence            889999999996 455559999999999999999999754211 1100  23455666666555

>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 2e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 56.8 bits (136), Expect = 9e-09
 Identities = 57/440 (12%), Positives = 124/440 (28%), Gaps = 113/440 (25%)

Query: 55  DDRQSRRLPGMMGD-PMPGFEEFVETVLTGTY-------------PTNITTFFVHCSRPV 100
               + RL   +        ++FVE VL   Y             P+ +T  ++     +
Sbjct: 60  AVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRL 119

Query: 101 --DLSSFHLWVCSAVRRNAREIELYLD-QNHRVELPEELYTSV--------SVEVLKLMS 149
             D   F        + N   ++ YL  +   +EL       +        +   L +  
Sbjct: 120 YNDNQVF-------AKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCL 172

Query: 150 DFVIKVPAGGTSFPNVKI--LSV-QLESPE------NSLTEKLFCSCPALEELSIQAYLN 200
            + ++           KI  L++    SPE        L  ++  +  +  + S    L 
Sbjct: 173 SYKVQ-----CKMDF-KIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLR 226

Query: 201 DEGPTTKF------------------VISSSTLK----RCTLWVATEGEMFTQAEYKVRI 238
                 +                   V ++         C + + T  +  T        
Sbjct: 227 IHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATT 286

Query: 239 TAPSLERLHI------MSDIFGKFVVHDLNSLTDVILDI------VYGEWSRVDPNRAIQ 286
           T  SL+   +      +  +  K++      L   +L        +  E  R        
Sbjct: 287 THISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDN 346

Query: 287 LLQRLNNTKNLTV--SYGVLCALD--HAYH---IWFPALSHLQHLEVAVGAIGWAVLP-- 337
                 +     +  S  VL   +    +    + FP  +   H+   + ++ W  +   
Sbjct: 347 WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSV-FPPSA---HIPTILLSLIWFDVIKS 402

Query: 338 ---VILSSSQNLQSLILR--KQSRFEVTEEQFGWIEGDIVPNCLLQ---HVKKIE----I 385
              V+++      SL+ +  K+S   +          ++      +   H   ++     
Sbjct: 403 DVMVVVNKLHK-YSLVEKQPKESTISIPSIYL-----ELKVKLENEYALHRSIVDHYNIP 456

Query: 386 KGVEGDDDELILVD-YLLKY 404
           K  + DD     +D Y   +
Sbjct: 457 KTFDSDDLIPPYLDQYFYSH 476
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.96
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.91
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.77
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.76
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.74
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.74
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.71
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.71
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.71
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.7
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.7
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.69
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.67
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.66
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.65
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.64
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.63
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.63
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.6
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.6
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.58
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.55
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.55
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.54
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.52
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.49
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.49
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.48
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.47
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.46
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.46
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.45
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.45
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.43
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.41
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.4
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.39
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.39
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.38
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.34
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.31
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.23
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.1
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.08
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.03
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.02
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.96
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.91
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.9
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.9
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.89
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.85
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.71
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.68
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.68
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.62
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.53
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.49
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.46
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.35
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.35
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.3
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.29
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.27
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.23
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.16
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.92
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.91
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.64
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.62
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.52
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.4
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.26
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 95.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 94.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 91.74
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 88.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.32
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 87.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 87.39
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=99.84  E-value=2.4e-22  Score=205.75  Aligned_cols=38  Identities=24%  Similarity=0.546  Sum_probs=29.3

Q ss_pred             cCcccCCCChHHHHHHhccCC-ccceeeecccccchHHH
Q 044387            8 KADWISALPDSVLCHILSYLP-TKNAVATSLLARRWKLV   45 (446)
Q Consensus         8 ~~D~is~LPd~vL~~Ils~L~-~~~~~r~s~lsrrWr~l   45 (446)
                      +.|+++.||||||.+||+||| ++|+++++.|||||+++
T Consensus         2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~   40 (594)
T 2p1m_B            2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEI   40 (594)
T ss_dssp             --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHH
T ss_pred             cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHh
Confidence            459999999999999999999 89999999999999987
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 6e-07
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 1e-06
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 7e-04
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 0.002
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Cdc4 F-box and linker domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 45.4 bits (107), Expect = 6e-07
 Identities = 10/45 (22%), Positives = 22/45 (48%)

Query: 8  KADWISALPDSVLCHILSYLPTKNAVATSLLARRWKLVWTSLQKL 52
          K D I++LP  +   I +YL  ++ + +  +++ W  +      L
Sbjct: 2  KRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSL 46
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.02
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.97
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.66
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.31
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.25
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.25
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.17
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.17
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.13
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.07
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.99
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.91
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.91
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.43
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.28
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.27
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.27
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.22
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.14
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.8
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.13
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.48
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 92.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 92.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 87.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 86.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 80.64
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.02  E-value=3.9e-12  Score=115.01  Aligned_cols=84  Identities=12%  Similarity=0.084  Sum_probs=51.5

Q ss_pred             cccCcccEEEEeceeEeecCC----CCccCCcccEEEeeeecCCchhhhhhhhcCCccceeEEEeecCCCCCCeEEE-ee
Q 044387          137 YTSVSVEVLKLMSDFVIKVPA----GGTSFPNVKILSVQLESPENSLTEKLFCSCPALEELSIQAYLNDEGPTTKFV-IS  211 (446)
Q Consensus       137 ~~~~~L~~L~L~~~~~~l~~~----~~~~~~~L~~L~L~~~~~~~~~l~~lls~cp~Le~L~l~~~~~~~~~~~~~~-i~  211 (446)
                      +...+|++|+|++  +.+...    -...+++|++|+|+++.+.+..+.. +..||+|+.|++++|...+...+..+ -.
T Consensus        43 ~~~~~L~~LdLs~--~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l~~l~~~  119 (284)
T d2astb2          43 FSPFRVQHMDLSN--SVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT-LAKNSNLVRLNLSGCSGFSEFALQTLLSS  119 (284)
T ss_dssp             CCCBCCCEEECTT--CEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHH-HTTCTTCSEEECTTCBSCCHHHHHHHHHH
T ss_pred             ccCCCCCEEECCC--CccCHHHHHHHHHhCCCcccccccccCCCcHHHHH-HhcCCCCcCccccccccccccccchhhHH
Confidence            3456788888887  554432    1346788888888888766554443 45678888888887754211111100 23


Q ss_pred             cCCcceEEEeee
Q 044387          212 SSTLKRCTLWVA  223 (446)
Q Consensus       212 ~~~L~~L~l~~~  223 (446)
                      +++|++|.+.+|
T Consensus       120 ~~~L~~L~ls~c  131 (284)
T d2astb2         120 CSRLDELNLSWC  131 (284)
T ss_dssp             CTTCCEEECCCC
T ss_pred             HHhccccccccc
Confidence            567777777766
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure