Citrus Sinensis ID: 044468


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
cccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccccccccccEEEcccccccccccHHHHHccccHHHHHHHHccccccEEEEEEcccHHHHHHHHHccccccEEEcccEEEccccccccccccccccccccEEccccccccccccccccEEEEccccccccccEEEEccccccccccccccccccEEEEcccccccccccccccccccHHccccccccccccEEEccccccccEEcccccccccccEEEEccccccccccccccccccccEEEEccHHHHHHcccccHHHHHHHccccEEcc
ccccccccccccHHHHHEEEcccccHHHccccccccccEEEEEEccccccccHHHHHHcccEEEEEccccccHHHccHHHHHHHEEEEEEcccccHHHccHHHHHHHHHHEEEccccccHcHccccHHHcHHccEEEEEEccccccccccccccccccHHHHHHHHHHHHccHccEEEccHHHHHHHHccHHHHHHHHHHHHHHcccccccEEccccHHcHcHcEEEEEcccccEEEEEcccccccccccccccccEEEEEEcccccccHHHHEcccccEEEEcccHHHHHHEcccccccccccccccccccHHHEEEEEcccHHHHHHHcccccccccEEEEEEccccHcccccccccccccEEEEEccHHHHHHcccccHHHHHHccccccccc
gagltgaprigMWKEITRMSLMQNAIQNltetptcphlralflhsnhlgtvsnnfFHSMASLRVLIFLYNrslenlplgILNLVSlqhldlswtgittLPIELKYLVNLKClnleytfclsripqpvisDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYcnssrsintQSLCLRHlnnsnllsaFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSihssylpfprlkEICVWKCAelkklpldcnqGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
gagltgaprigMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSevlveellalkhlnlltvtlQIFGALQRLLNYCNSSRSINTQSLCLRHlnnsnllsafsfaslRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
********RIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACF****
GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEII********************RLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPL***********IKGQDRWWNELQWDDQATQNASLACFQSLY
GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
***LTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEK********MDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q8RXS5888 Probable disease resistan yes no 0.939 0.418 0.344 2e-41
Q9FLB4874 Putative disease resistan no no 0.929 0.421 0.329 1e-38
Q9SH22884 Probable disease resistan no no 0.909 0.407 0.333 1e-36
O64973889 Disease resistance protei no no 0.921 0.410 0.321 5e-36
Q9SI85893 Probable disease resistan no no 0.891 0.395 0.322 3e-34
Q9C8T9898 Putative disease resistan no no 0.909 0.400 0.340 2e-33
Q9LVT3948 Probable disease resistan no no 0.883 0.369 0.319 3e-33
O64789925 Probable disease resistan no no 0.898 0.384 0.323 1e-31
O82484892 Putative disease resistan no no 0.931 0.413 0.314 1e-31
O22727967 Probable disease resistan no no 0.924 0.378 0.330 3e-31
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function desciption
 Score =  170 bits (430), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 138/401 (34%), Positives = 206/401 (51%), Gaps = 29/401 (7%)

Query: 2   AGLTGA--PRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSM 59
           AGL     P I  WK   R+SLM N I+++ + P  P L  L L  N LG +S++FF  M
Sbjct: 497 AGLQSRNIPEIEKWKVARRVSLMFNNIESIRDAPESPQLITLLLRKNFLGHISSSFFRLM 556

Query: 60  ASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFC 119
             L VL    NR L +LP  I   VSLQ+L LS T I   P  L  L  L  LNLEYT  
Sbjct: 557 PMLVVLDLSMNRDLRHLPNEISECVSLQYLSLSRTRIRIWPAGLVELRKLLYLNLEYTRM 616

Query: 120 LSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQ 179
           +  I    IS L  L+ LR+F  GF            +   ++ EL  L++L  LT+TL 
Sbjct: 617 VESICG--ISGLTSLKVLRLFVSGFP-----------EDPCVLNELQLLENLQTLTITLG 663

Query: 180 IFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNI 239
           +   L++ L+  N   +  T++L + +LN  + + +F  A++  L  LH   +D  E+ +
Sbjct: 664 LASILEQFLS--NQRLASCTRALRIENLNPQSSVISF-VATMDSLQELHFADSDIWEIKV 720

Query: 240 DAGE----VKRIRETRGFHSLQKVYINY-SKFRHATWLVLAPRAKVIRISNCQRLQEIIS 294
              E    +     T  F +L +V + + ++ R  TWL+ AP   V+R+ +   L+E+I+
Sbjct: 721 KRNETVLPLHIPTTTTFFPNLSQVSLEFCTRLRDLTWLIFAPNLTVLRVISASDLKEVIN 780

Query: 295 MEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLP 354
            EK  +       NLI F  L+ L LE +Q LK IH   LPFP L++I V  C+EL+KLP
Sbjct: 781 KEKAEQ------QNLIPFQELKELRLENVQMLKHIHRGPLPFPCLQKILVNGCSELRKLP 834

Query: 355 LDCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQSL 395
           L+        ++I+   +W   L+W+D+AT+   L   ++ 
Sbjct: 835 LNFTSVPRGDLVIEAHKKWIEILEWEDEATKARFLPTLKAF 875




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVT3|DRL38_ARATH Probable disease resistance protein At5g47260 OS=Arabidopsis thaliana GN=At5g47260 PE=3 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
24461866 890 NBS-LRR type disease resistance protein 0.974 0.433 0.466 3e-78
24461865 892 NBS-LRR type disease resistance protein 0.977 0.433 0.465 5e-74
24461861 890 NBS-LRR type disease resistance protein 0.964 0.429 0.463 5e-71
224122896 820 cc-nbs-lrr resistance protein [Populus t 0.952 0.459 0.410 3e-69
24461863 889 NBS-LRR type disease resistance protein 0.964 0.429 0.435 2e-68
24461864 899 NBS-LRR type disease resistance protein 0.974 0.429 0.436 5e-68
359482672 905 PREDICTED: probable disease resistance p 0.979 0.428 0.431 2e-66
225442867 893 PREDICTED: probable disease resistance p 0.952 0.422 0.424 3e-64
147852651 882 hypothetical protein VITISV_017542 [Viti 0.904 0.405 0.418 1e-63
359482674 991 PREDICTED: probable disease resistance p 0.941 0.376 0.42 3e-63
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  298 bits (763), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 186/399 (46%), Positives = 244/399 (61%), Gaps = 13/399 (3%)

Query: 1   GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMA 60
           G GL  AP +  W++  R+SLM N I NL+E  TCPHL  LFL+ N L  + N+FF  M 
Sbjct: 500 GVGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLTLFLNENELQMIHNDFFRFMP 559

Query: 61  SLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCL 120
           SL+VL  L + SL NLP GI  LVSLQHLDLS + I  LP+ELK LVNLKCLNLEYT+ L
Sbjct: 560 SLKVL-NLADSSLTNLPEGISKLVSLQHLDLSKSSIEELPLELKALVNLKCLNLEYTWSL 618

Query: 121 SRIPQPVISDLKMLRALRMFECGFKVEQEA--DRILFGDSEVLVEELLALKHLNLLTVTL 178
           + IP+ +IS+L  L  LRMF         A  D ILFG  E++VEELL LK+L +++ TL
Sbjct: 619 TTIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTL 678

Query: 179 QIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLY-FNDFEEL 237
           +    LQ  L+  +  RS  T++L L+  N+S  L   + A L+ L  L +      EEL
Sbjct: 679 RSSHGLQSFLS-SHKLRSC-TRALLLQCFNDSTSLEVSALADLKQLNRLWITECKKLEEL 736

Query: 238 NID-AGEVKRIRETRGFHSLQKVYI-NYSKFRHATWLVLAPRAKVIRISNCQRLQEIISM 295
            +D   EV++      FHSL+KV I   SK +  T+LV AP  + I +  C  ++E++SM
Sbjct: 737 KMDYTREVQQFV----FHSLKKVEILACSKLKDLTFLVFAPNLESIELMGCPAMEEMVSM 792

Query: 296 EKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPL 355
            K  E+  EV+ NL  F +L+ L L G  NLKSI+   LPFP LK +    C +LKKLPL
Sbjct: 793 GKFAEV-PEVVANLNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPL 851

Query: 356 DCNQGLEQKIIIKGQDRWWNELQWDDQATQNASLACFQS 394
           D N   E+ I+I G  RWW +L+W D+AT+NA L CF S
Sbjct: 852 DSNSARERNIVISGTRRWWEQLEWVDEATRNAFLPCFDS 890




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.351 0.157 0.418 1.6e-35
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.351 0.155 0.415 8.7e-35
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.353 0.160 0.345 4.9e-32
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.345 0.154 0.442 6.3e-32
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.338 0.150 0.417 1.9e-31
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.325 0.145 0.382 6e-31
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.348 0.156 0.394 7.2e-31
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.363 0.188 0.452 2.1e-30
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.318 0.132 0.418 1.8e-29
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.335 0.148 0.425 2.5e-29
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.6e-35, Sum P(2) = 1.6e-35
 Identities = 59/141 (41%), Positives = 80/141 (56%)

Query:     1 GAGLTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSN-HLGTVSNNFFHSM 59
             G  L   P++  WK ++RMSL+ N I+ +  +P CP L  LFL  N HL  +S  FF SM
Sbjct:   505 GFRLNEIPKVKDWKVVSRMSLVNNRIKEIHGSPECPKLTTLFLQDNRHLVNISGEFFRSM 564

Query:    60 ASLRVLIFLYNRSLENLPLGILNLVSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFC 119
               L VL   +N +L  LP  I  LVSL++LDLS++ I  LP+ L  L  L  LNLE   C
Sbjct:   565 PRLVVLDLSWNVNLSGLPDQISELVSLRYLDLSYSSIGRLPVGLLKLKKLMHLNLESMLC 624

Query:   120 LSRIPQ-PVISDLKMLRALRM 139
             L  +     +S+LK +R L +
Sbjct:   625 LESVSGIDHLSNLKTVRLLNL 645


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XIII000034
cc-nbs-lrr resistance protein (820 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
 Score = 40.2 bits (95), Expect = 6e-05
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 37 HLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGIL-NLVSLQHLDLSWTG 95
          +L++L L +N L  + +  F  + +L+VL    N +L ++       L SL+ LDLS   
Sbjct: 1  NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGN-NLTSISPEAFSGLPSLRSLDLSGNN 59

Query: 96 I 96
          +
Sbjct: 60 L 60


Length = 60

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.23
KOG4341483 consensus F-box protein containing LRR [General fu 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.57
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.57
PLN03150623 hypothetical protein; Provisional 98.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.5
PLN03150623 hypothetical protein; Provisional 98.45
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.21
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.92
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.62
PRK15386426 type III secretion protein GogB; Provisional 97.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.18
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.08
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.2
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.3
smart0037026 LRR Leucine-rich repeats, outliers. 89.48
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.48
smart0037026 LRR Leucine-rich repeats, outliers. 88.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.85
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.87
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.09
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.91  E-value=7.8e-24  Score=221.96  Aligned_cols=323  Identities=22%  Similarity=0.182  Sum_probs=144.6

Q ss_pred             cCCCccccEEEcccccccc-ccCC--CCCCCCcEEEccCCccC-ccChHHHhcCccccEEEeecCCCCccccccccCCCc
Q 044468           10 IGMWKEITRMSLMQNAIQN-LTET--PTCPHLRALFLHSNHLG-TVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVS   85 (396)
Q Consensus        10 ~~~~~~L~~L~l~~~~~~~-l~~~--~~~~~L~~L~l~~~~~~-~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~l~~l~~   85 (396)
                      +..+++|+.|++++|.+.. +|..  ..+++|++|++++|.+. .+|.   ..+++|++|++++|...+.+|..++++++
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~  165 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETLDLSNNMLSGEIPNDIGSFSS  165 (968)
T ss_pred             HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCEEECcCCcccccCChHHhcCCC
Confidence            4445555555555555543 4433  24555555555555442 2222   23455555555555222244444555555


Q ss_pred             CCEEEccCCCCC-ccchhhhcCCcccEEecccccCCCCCCcchhcCCCcccEEEeeccCccchhccchhccCCchhhhHh
Q 044468           86 LQHLDLSWTGIT-TLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEE  164 (396)
Q Consensus        86 L~~L~l~~~~l~-~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~  164 (396)
                      |++|++++|.+. .+|..+.++++|++|++++|.....+|.. ++.+++|++|++.+|.+.+.             ....
T Consensus       166 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~~~-------------~p~~  231 (968)
T PLN00113        166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNLSGE-------------IPYE  231 (968)
T ss_pred             CCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCccCCc-------------CChh
Confidence            555555555443 44555555555555555555444444444 55555555555555554431             3344


Q ss_pred             hhcCCCCcEEEEEecccch-hhhhhhccCCCCCcccceEEecccCCCcccchhhhhccccccceeeeccccceeeecccc
Q 044468          165 LLALKHLNLLTVTLQIFGA-LQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGE  243 (396)
Q Consensus       165 l~~l~~L~~L~l~~~~~~~-~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~l~~~~~~  243 (396)
                      +.++++|+.|++..+.... .+     ..+.++++|+.|.+.++.-... ....+..+++|+.|+++.+.+.........
T Consensus       232 l~~l~~L~~L~L~~n~l~~~~p-----~~l~~l~~L~~L~L~~n~l~~~-~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~  305 (968)
T PLN00113        232 IGGLTSLNHLDLVYNNLTGPIP-----SSLGNLKNLQYLFLYQNKLSGP-IPPSIFSLQKLISLDLSDNSLSGEIPELVI  305 (968)
T ss_pred             HhcCCCCCEEECcCceeccccC-----hhHhCCCCCCEEECcCCeeecc-CchhHhhccCcCEEECcCCeeccCCChhHc
Confidence            4555555555555444321 11     1233344455555544321111 111234445555555553333211000000


Q ss_pred             ---------------ccccccc-cccccCcEeEEeCceeec-CC-ccCCCCCccEEeeccccccceeecccccccchhcc
Q 044468          244 ---------------VKRIRET-RGFHSLQKVYINYSKFRH-AT-WLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEV  305 (396)
Q Consensus       244 ---------------~~~~~~~-~~~~~L~~L~l~~~~l~~-l~-~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~  305 (396)
                                     .+.+|.. +.+++|+.|++.+|.++. ++ .++.+++|+.|+++++.....+.            
T Consensus       306 ~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p------------  373 (968)
T PLN00113        306 QLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIP------------  373 (968)
T ss_pred             CCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCC------------
Confidence                           0011111 133444444444443322 11 13334444444444433111111            


Q ss_pred             ccccccccCcceeeccCCcccccccCCCCCCCCcceEEeccCcccccCCCCCCCCCCCceEEee
Q 044468          306 MDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKG  369 (396)
Q Consensus       306 ~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~i~~c~~L~~lp~~~~~~~~~l~~~~~  369 (396)
                       .....+++|+.|++.++.-...++.....+++|+.|++.+|.--..+|... ...+.++.+..
T Consensus       374 -~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L  435 (968)
T PLN00113        374 -EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF-TKLPLVYFLDI  435 (968)
T ss_pred             -hhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhH-hcCCCCCEEEC
Confidence             123344556666666554333444445567778888887775333444432 23345555543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score = 87.1 bits (216), Expect = 7e-19
 Identities = 65/284 (22%), Positives = 108/284 (38%), Gaps = 33/284 (11%)

Query: 1   GAGLTGAPRIGMWKEITRMSLMQNAIQNLTET--PTCPHLRALFLHSNHLGTVSNNFFHS 58
                  P  G+  E   + L +N I+ L +    + PHL  L L+ N +  V    F++
Sbjct: 20  RKRFVAVPE-GIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNN 78

Query: 59  MASLRVLIFLYNRSLENLPLGIL-NLVSLQHLDLSWTGITTLPIEL-KYLVNLKCLNLEY 116
           + +LR L    NR L+ +PLG+   L +L  LD+S   I  L   + + L NLK L +  
Sbjct: 79  LFNLRTLGLRSNR-LKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGD 137

Query: 117 TFCLSRIPQPVISDLKMLRALRMFECGF-KVEQEADRILFGDSEVLVEELLALKHLNLLT 175
              L  I     S L  L  L + +C    +  EA          L+   L L+HLN+  
Sbjct: 138 ND-LVYISHRAFSGLNSLEQLTLEKCNLTSIPTEA----LSHLHGLIV--LRLRHLNINA 190

Query: 176 VTLQIFGALQRL----LNYCNSSRSINTQSLCLRHL-------NNSNLLSAFSFASLRHL 224
           +    F  L RL    +++     ++    L   +L        N   +   +   L +L
Sbjct: 191 IRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYL 250

Query: 225 WTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRH 268
             L+L +N    +                  LQ++ +   +   
Sbjct: 251 RFLNLSYNPISTIEGSM--------LHELLRLQEIQLVGGQLAV 286


>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.33
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.28
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.23
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.86
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.58
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.98
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.96
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.38
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.33
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.96  E-value=5e-28  Score=223.65  Aligned_cols=308  Identities=16%  Similarity=0.165  Sum_probs=243.2

Q ss_pred             CCCCCccCCCccccEEEccccccccccCCCCCCCCcEEEccCCccCccChHHHhcCccccEEEeecCCCCccccccccCC
Q 044468            4 LTGAPRIGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNL   83 (396)
Q Consensus         4 l~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~l~~l   83 (396)
                      +.++..+..++++++|+++++.+..++....+++|++|++++|.+..++.  +..+++|++|++++| .++.++ .+.++
T Consensus        34 ~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~--~~~l~~L~~L~L~~n-~i~~~~-~~~~l  109 (347)
T 4fmz_A           34 VTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISP--LSNLVKLTNLYIGTN-KITDIS-ALQNL  109 (347)
T ss_dssp             TTSEECHHHHTTCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-CCCCCG-GGTTC
T ss_pred             cCCcccchhcccccEEEEeCCccccchhhhhcCCccEEEccCCccccchh--hhcCCcCCEEEccCC-cccCch-HHcCC
Confidence            44455566788999999999999988777889999999999999988876  899999999999999 777765 58899


Q ss_pred             CcCCEEEccCCCCCccchhhhcCCcccEEecccccCCCCCCcchhcCCCcccEEEeeccCccchhccchhccCCchhhhH
Q 044468           84 VSLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGFKVEQEADRILFGDSEVLVE  163 (396)
Q Consensus        84 ~~L~~L~l~~~~l~~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~i~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~  163 (396)
                      ++|++|++++|.++.++. +.++++|++|++++|.....++.  +..+++|++|++.+|.+...               .
T Consensus       110 ~~L~~L~l~~n~i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~--~~~l~~L~~L~l~~~~~~~~---------------~  171 (347)
T 4fmz_A          110 TNLRELYLNEDNISDISP-LANLTKMYSLNLGANHNLSDLSP--LSNMTGLNYLTVTESKVKDV---------------T  171 (347)
T ss_dssp             TTCSEEECTTSCCCCCGG-GTTCTTCCEEECTTCTTCCCCGG--GTTCTTCCEEECCSSCCCCC---------------G
T ss_pred             CcCCEEECcCCcccCchh-hccCCceeEEECCCCCCcccccc--hhhCCCCcEEEecCCCcCCc---------------h
Confidence            999999999999998876 88999999999999866665554  88999999999999987763               2


Q ss_pred             hhhcCCCCcEEEEEecccchhhhhhhccCCCCCcccceEEecccCCCcccchhhhhccccccceeeeccccceeeecccc
Q 044468          164 ELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGE  243 (396)
Q Consensus       164 ~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~i~~l~~~~~~  243 (396)
                      .+..+++|+.|++..+.......      +..+++|+.+++.++......   .+..+++|++|+++.+.+.++..  . 
T Consensus       172 ~~~~l~~L~~L~l~~n~l~~~~~------~~~l~~L~~L~l~~n~l~~~~---~~~~~~~L~~L~l~~n~l~~~~~--~-  239 (347)
T 4fmz_A          172 PIANLTDLYSLSLNYNQIEDISP------LASLTSLHYFTAYVNQITDIT---PVANMTRLNSLKIGNNKITDLSP--L-  239 (347)
T ss_dssp             GGGGCTTCSEEECTTSCCCCCGG------GGGCTTCCEEECCSSCCCCCG---GGGGCTTCCEEECCSSCCCCCGG--G-
T ss_pred             hhccCCCCCEEEccCCccccccc------ccCCCccceeecccCCCCCCc---hhhcCCcCCEEEccCCccCCCcc--h-
Confidence            27888999999998887765543      445666999999876433222   26788999999999887775432  1 


Q ss_pred             ccccccccccccCcEeEEeCceeecCCccCCCCCccEEeeccccccceeecccccccchhccccccccccCcceeeccCC
Q 044468          244 VKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQRLQEIISMEKLGEISAEVMDNLILFGRLEYLILEGL  323 (396)
Q Consensus       244 ~~~~~~~~~~~~L~~L~l~~~~l~~l~~l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  323 (396)
                             ..+++|++|++.+|.++.++.+..+++|++|++++|. ++++ .             ....+++|+.|++++|
T Consensus       240 -------~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~-l~~~-~-------------~~~~l~~L~~L~L~~n  297 (347)
T 4fmz_A          240 -------ANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQ-ISDI-S-------------VLNNLSQLNSLFLNNN  297 (347)
T ss_dssp             -------TTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSC-CCCC-G-------------GGGGCTTCSEEECCSS
T ss_pred             -------hcCCCCCEEECCCCccCCChhHhcCCCcCEEEccCCc-cCCC-h-------------hhcCCCCCCEEECcCC
Confidence                   1789999999999988888888889999999999885 5544 1             4567899999999998


Q ss_pred             cccccccCCCCCCCCcceEEeccCcccccCCCCCCCCCCCceEEeeh
Q 044468          324 QNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIKGQ  370 (396)
Q Consensus       324 ~~l~~~~~~~~~~~~L~~L~i~~c~~L~~lp~~~~~~~~~l~~~~~~  370 (396)
                      .--...+.....+++|+.|++.+|+ ++.+|+  ....+.++.+...
T Consensus       298 ~l~~~~~~~l~~l~~L~~L~L~~n~-l~~~~~--~~~l~~L~~L~l~  341 (347)
T 4fmz_A          298 QLGNEDMEVIGGLTNLTTLFLSQNH-ITDIRP--LASLSKMDSADFA  341 (347)
T ss_dssp             CCCGGGHHHHHTCTTCSEEECCSSS-CCCCGG--GGGCTTCSEESSS
T ss_pred             cCCCcChhHhhccccCCEEEccCCc-cccccC--hhhhhccceeehh
Confidence            5333333345568999999999986 777766  2333566665533



>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 45.4 bits (106), Expect = 6e-06
 Identities = 40/270 (14%), Positives = 88/270 (32%), Gaps = 17/270 (6%)

Query: 27  QNLTETPTC--PHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLV 84
             L + P    P    L L +N +  + +  F ++ +L  LI + N+  +  P     LV
Sbjct: 20  LGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLV 79

Query: 85  SLQHLDLSWTGITTLPIELKYLVNLKCLNLEYTFCLSRIPQPVISDLKMLRALRMFECGF 144
            L+ L LS   +  LP ++   +        +   ++++ + V + L  +  + +     
Sbjct: 80  KLERLYLSKNQLKELPEKMPKTLQELR---VHENEITKVRKSVFNGLNQMIVVELGTNPL 136

Query: 145 KVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSL-- 202
           K     +    G  ++     + +   N+ T+   +  +L  L    N    ++  SL  
Sbjct: 137 KSSGIENGAFQGMKKL---SYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKG 193

Query: 203 --CLRHLNNSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVY 260
              L  L  S    +                +       +   VK          +Q VY
Sbjct: 194 LNNLAKLGLSFNSISAVDNGSLANTPHLRELHLN-----NNKLVKVPGGLADHKYIQVVY 248

Query: 261 INYSKFRHATWLVLAPRAKVIRISNCQRLQ 290
           ++ +           P     + ++   + 
Sbjct: 249 LHNNNISAIGSNDFCPPGYNTKKASYSGVS 278


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.29
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.92
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.77
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.89  E-value=4.7e-22  Score=183.62  Aligned_cols=299  Identities=15%  Similarity=0.150  Sum_probs=201.6

Q ss_pred             cCCCccccEEEccccccccccCCCCCCCCcEEEccCCccCccChHHHhcCccccEEEeecCCCCccccccccCCCcCCEE
Q 044468           10 IGMWKEITRMSLMQNAIQNLTETPTCPHLRALFLHSNHLGTVSNNFFHSMASLRVLIFLYNRSLENLPLGILNLVSLQHL   89 (396)
Q Consensus        10 ~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~l~~l~~L~~L   89 (396)
                      ...+.+|++|++++++++++.....+++|++|++++|.+.++++  ++.+++|++|++++| .+..++. ++++++|+.|
T Consensus        40 ~~~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n-~i~~i~~-l~~l~~L~~L  115 (384)
T d2omza2          40 QTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNN-QIADITP-LANLTNLTGL  115 (384)
T ss_dssp             HHHHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSS-CCCCCGG-GTTCTTCCEE
T ss_pred             HHHhCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc--ccCCccccccccccc-ccccccc-cccccccccc
Confidence            44567899999999999988666889999999999999998875  899999999999999 6766654 7899999999


Q ss_pred             EccCCCCCccchhhhcCCcccEEeccccc-----------------------------------------CCCCCCcchh
Q 044468           90 DLSWTGITTLPIELKYLVNLKCLNLEYTF-----------------------------------------CLSRIPQPVI  128 (396)
Q Consensus        90 ~l~~~~l~~l~~~l~~l~~L~~L~l~~~~-----------------------------------------~~~~~~~~~i  128 (396)
                      +++++.++.++... ....+.......+.                                         ....... ..
T Consensus       116 ~~~~~~~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  193 (384)
T d2omza2         116 TLFNNQITDIDPLK-NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDIS-VL  193 (384)
T ss_dssp             ECCSSCCCCCGGGT-TCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCG-GG
T ss_pred             cccccccccccccc-ccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccccc-cc
Confidence            99988776544321 12222222211100                                         0011112 25


Q ss_pred             cCCCcccEEEeeccCccchhccchhccCCchhhhHhhhcCCCCcEEEEEecccchhhhhhhccCCCCCcccceEEecccC
Q 044468          129 SDLKMLRALRMFECGFKVEQEADRILFGDSEVLVEELLALKHLNLLTVTLQIFGALQRLLNYCNSSRSINTQSLCLRHLN  208 (396)
Q Consensus       129 ~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~  208 (396)
                      ..+++++.+.+.++.+...               ......++|+.+++.++....++.      +..+++|+.|.+.++.
T Consensus       194 ~~l~~~~~l~l~~n~i~~~---------------~~~~~~~~L~~L~l~~n~l~~~~~------l~~l~~L~~L~l~~n~  252 (384)
T d2omza2         194 AKLTNLESLIATNNQISDI---------------TPLGILTNLDELSLNGNQLKDIGT------LASLTNLTDLDLANNQ  252 (384)
T ss_dssp             GGCTTCSEEECCSSCCCCC---------------GGGGGCTTCCEEECCSSCCCCCGG------GGGCTTCSEEECCSSC
T ss_pred             ccccccceeeccCCccCCC---------------CcccccCCCCEEECCCCCCCCcch------hhcccccchhccccCc
Confidence            6678888888888876653               234566788888888877665543      3345558888887754


Q ss_pred             CCcccchhhhhccccccceeeeccccceeeeccccccccccccccccCcEeEEeCceeecCCccCCCCCccEEeeccccc
Q 044468          209 NSNLLSAFSFASLRHLWTLHLYFNDFEELNIDAGEVKRIRETRGFHSLQKVYINYSKFRHATWLVLAPRAKVIRISNCQR  288 (396)
Q Consensus       209 ~~~~~~~~~l~~~~~L~~L~l~~~~i~~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~l~~l~~l~~L~~L~l~~~~~  288 (396)
                      - ...  ..+..+++|+.|+++++.+..+..         - ..++.++.+.+.+|.++.+..+..++++++|+++++. 
T Consensus       253 l-~~~--~~~~~~~~L~~L~l~~~~l~~~~~---------~-~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~-  318 (384)
T d2omza2         253 I-SNL--APLSGLTKLTELKLGANQISNISP---------L-AGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNN-  318 (384)
T ss_dssp             C-CCC--GGGTTCTTCSEEECCSSCCCCCGG---------G-TTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSC-
T ss_pred             c-CCC--CcccccccCCEeeccCcccCCCCc---------c-ccccccccccccccccccccccchhcccCeEECCCCC-
Confidence            3 222  236777888888888766654321         0 1567777777777777777667777888888887764 


Q ss_pred             cceeecccccccchhccccccccccCcceeeccCCcccccccCCCCCCCCcceEEeccCcccccCCCCCCCCCCCceEEe
Q 044468          289 LQEIISMEKLGEISAEVMDNLILFGRLEYLILEGLQNLKSIHSSYLPFPRLKEICVWKCAELKKLPLDCNQGLEQKIIIK  368 (396)
Q Consensus       289 l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~i~~c~~L~~lp~~~~~~~~~l~~~~  368 (396)
                      ++++.              .+..+++|++|++++| .++.++ ....+++|+.|++.+| +++.+|+  ....+.++.+.
T Consensus       319 l~~l~--------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~--l~~l~~L~~L~  379 (384)
T d2omza2         319 ISDIS--------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLTP--LANLTRITQLG  379 (384)
T ss_dssp             CSCCG--------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCGG--GTTCTTCSEEE
T ss_pred             CCCCc--------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCChh--hccCCCCCEee
Confidence            44442              2456778888888877 466554 2455788888888776 5777764  23334555543



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure