Citrus Sinensis ID: 044553

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-----
MSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ
cccEEEEEEccccccccccHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccccEEEEcccEEcccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHccccccccEEEEcccccHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccEEEEccHHHHHcccccccccc
cccEEEEEEccccEEcccccHHHHHHccccHcHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccHHHHHEEEccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHcccccEEEccccccHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccc
MSGIVVIFdfdktiidcdsdnfvvdelgatdlfnqllptmpwnSLMDRMMKELHSQGKTIEDIVEVLKripihprvvpaIKSAHALGCELRIVSDANLFFIETILEHlgirdcfseintnpgfvdeegrlrifpfhdftkcshgcnlcppnmckGVVIERIQASLskegnkkiiylgdgsgdycpslklsegdhvmprknfplwdliirnpmlikaeihewtdgEELEQILLHLVNTIgstnnnnsaQLLSADCKLQTISAAAHETLPQVLSVTQ
MSGIVVIFdfdktiidcdsDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAhetlpqvlsvtq
MSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ
***IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTIS***************
MSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVN**************SADCKL*******************
MSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ
*SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGS********LLSADCKLQTISAAAHETLPQVL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGSTNNNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query275 2.2.26 [Sep-21-2011]
Q9FZ62279 Inorganic pyrophosphatase yes no 0.989 0.974 0.671 1e-108
Q67YC0295 Inorganic pyrophosphatase no no 0.985 0.918 0.690 1e-108
Q9SU92245 Inorganic pyrophosphatase no no 0.865 0.971 0.577 2e-78
Q6DBV4279 Probable phosphatase phos yes no 0.832 0.820 0.366 3e-33
Q66KD6238 Probable phosphatase phos yes no 0.796 0.920 0.337 5e-28
Q8R2H9267 Phosphoethanolamine/phosp yes no 0.829 0.853 0.307 2e-27
Q8TCT1267 Phosphoethanolamine/phosp yes no 0.832 0.857 0.310 2e-26
O73884268 Phosphoethanolamine/phosp yes no 0.821 0.843 0.295 1e-25
Q2KI06241 Pyridoxal phosphate phosp no no 0.723 0.825 0.316 1e-23
Q8TCD6241 Pyridoxal phosphate phosp no no 0.818 0.933 0.311 2e-23
>sp|Q9FZ62|PPSP2_ARATH Inorganic pyrophosphatase 2 OS=Arabidopsis thaliana GN=At1g17710 PE=2 SV=1 Back     alignment and function desciption
 Score =  392 bits (1006), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/277 (67%), Positives = 227/277 (81%), Gaps = 5/277 (1%)

Query: 2   SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE 61
           + IV++FDFDKTIID DSDN+VVDELG TDLFNQLLPTMPWNSLM+RMMKELH  GKTIE
Sbjct: 5   NNIVIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHDHGKTIE 64

Query: 62  DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP 121
           +I +VL+RIPIHPRV+PAIKSAHALGCELRIVSDAN  FIETI+EHLGI + FSEINTNP
Sbjct: 65  EIKQVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETIIEHLGIGEFFSEINTNP 124

Query: 122 GFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGN-KKIIYLGDGS 180
           G VDE+GRL + P+HDFTK SHGC+ CPPNMCKG++I+RIQASL+KEG   K+IYLGDG+
Sbjct: 125 GLVDEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQASLTKEGKTSKMIYLGDGA 184

Query: 181 GDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGS 240
           GDYCPSL L   D++MPRKNFP+WDLI +NPML+KA + +WTDGE++E+IL+ ++N I S
Sbjct: 185 GDYCPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIINEIMS 244

Query: 241 T--NNNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ 275
           +     N   L S +CK+       HE +   L++ +
Sbjct: 245 SEEGEENDKMLSSENCKISV--GIVHEPIQVPLNLVK 279
Catalyzes the specific cleavage of pyrophosphate.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q67YC0|PPSP1_ARATH Inorganic pyrophosphatase 1 OS=Arabidopsis thaliana GN=PS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SU92|PPSP3_ARATH Inorganic pyrophosphatase 3 OS=Arabidopsis thaliana GN=At4g29530 PE=2 SV=1 Back     alignment and function description
>sp|Q6DBV4|PHOP1_DANRE Probable phosphatase phospho1 OS=Danio rerio GN=phospho1 PE=2 SV=1 Back     alignment and function description
>sp|Q66KD6|PHOP2_XENTR Probable phosphatase phospho2 OS=Xenopus tropicalis GN=phospho2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R2H9|PHOP1_MOUSE Phosphoethanolamine/phosphocholine phosphatase OS=Mus musculus GN=Phospho1 PE=2 SV=1 Back     alignment and function description
>sp|Q8TCT1|PHOP1_HUMAN Phosphoethanolamine/phosphocholine phosphatase OS=Homo sapiens GN=PHOSPHO1 PE=1 SV=1 Back     alignment and function description
>sp|O73884|PHOP1_CHICK Phosphoethanolamine/phosphocholine phosphatase OS=Gallus gallus GN=PHOSPHO1 PE=2 SV=1 Back     alignment and function description
>sp|Q2KI06|PHOP2_BOVIN Pyridoxal phosphate phosphatase PHOSPHO2 OS=Bos taurus GN=PHOSPHO2 PE=2 SV=1 Back     alignment and function description
>sp|Q8TCD6|PHOP2_HUMAN Pyridoxal phosphate phosphatase PHOSPHO2 OS=Homo sapiens GN=PHOSPHO2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
224100273277 predicted protein [Populus trichocarpa] 0.996 0.989 0.763 1e-126
224134528283 predicted protein [Populus trichocarpa] 0.974 0.946 0.776 1e-123
255572989274 Phosphoethanolamine/phosphocholine phosp 0.989 0.992 0.761 1e-122
356526041272 PREDICTED: inorganic pyrophosphatase 2-l 0.981 0.992 0.736 1e-121
359807590272 uncharacterized protein LOC100785878 [Gl 0.981 0.992 0.736 1e-121
255572987274 Phosphoethanolamine/phosphocholine phosp 0.989 0.992 0.758 1e-120
225442333273 PREDICTED: inorganic pyrophosphatase 2 [ 0.970 0.978 0.787 1e-120
356522610272 PREDICTED: inorganic pyrophosphatase 2-l 0.981 0.992 0.736 1e-120
255637717272 unknown [Glycine max] 0.981 0.992 0.732 1e-120
449447842273 PREDICTED: inorganic pyrophosphatase 2-l 0.952 0.959 0.777 1e-120
>gi|224100273|ref|XP_002311810.1| predicted protein [Populus trichocarpa] gi|222851630|gb|EEE89177.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/275 (76%), Positives = 246/275 (89%), Gaps = 1/275 (0%)

Query: 2   SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE 61
           + IVV+FDFDKTIID DSDN+V+DELG T+ FNQLLPTM WNSLMDRMMKELH+ GKT+E
Sbjct: 3   AAIVVVFDFDKTIIDVDSDNWVIDELGFTESFNQLLPTMSWNSLMDRMMKELHANGKTME 62

Query: 62  DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP 121
           DI EVLKRIPIHP+V+ AIK+AHALGCELRIVSDAN+FFIETIL+HLG++D FSEINTNP
Sbjct: 63  DIAEVLKRIPIHPQVISAIKAAHALGCELRIVSDANMFFIETILKHLGLKDYFSEINTNP 122

Query: 122 GFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSG 181
           GFVDEEGRLRI P+HDFT+ SHGC+LCPPNMCKG++IERIQAS+SKEG+KKIIYLGDG+G
Sbjct: 123 GFVDEEGRLRISPYHDFTQSSHGCSLCPPNMCKGLIIERIQASISKEGSKKIIYLGDGAG 182

Query: 182 DYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIGST 241
           DYCPSLKL+E D++MPRKNFP+WDLI +NP LIKAEIHEW DG E+E++LL ++  I   
Sbjct: 183 DYCPSLKLTEADYMMPRKNFPVWDLISKNPKLIKAEIHEWNDGAEMERVLLQIIERISRE 242

Query: 242 N-NNNSAQLLSADCKLQTISAAAHETLPQVLSVTQ 275
             N+NSA+L SADCKLQTIS A H+ +PQ LSVTQ
Sbjct: 243 EINSNSAKLFSADCKLQTISIAGHDAMPQALSVTQ 277

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224134528|ref|XP_002327427.1| predicted protein [Populus trichocarpa] gi|222835981|gb|EEE74402.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572989|ref|XP_002527425.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus communis] gi|223533235|gb|EEF34991.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356526041|ref|XP_003531628.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|359807590|ref|NP_001241414.1| uncharacterized protein LOC100785878 [Glycine max] gi|255641141|gb|ACU20848.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255572987|ref|XP_002527424.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus communis] gi|223533234|gb|EEF34990.1| Phosphoethanolamine/phosphocholine phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225442333|ref|XP_002280889.1| PREDICTED: inorganic pyrophosphatase 2 [Vitis vinifera] gi|297743107|emb|CBI35974.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522610|ref|XP_003529939.1| PREDICTED: inorganic pyrophosphatase 2-like [Glycine max] Back     alignment and taxonomy information
>gi|255637717|gb|ACU19181.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449447842|ref|XP_004141676.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus] gi|449480589|ref|XP_004155938.1| PREDICTED: inorganic pyrophosphatase 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query275
TAIR|locus:2032748295 PS2 "phosphate starvation-indu 0.992 0.925 0.689 2e-102
TAIR|locus:2007958279 PEPC1 "phosphoethanolamine/pho 0.989 0.974 0.671 8.8e-102
TAIR|locus:2134353245 AT4G29530 "AT4G29530" [Arabido 0.865 0.971 0.577 1.4e-73
ZFIN|ZDB-GENE-040801-198279 phospho1 "phosphatase, orphan 0.814 0.802 0.383 5.2e-33
UNIPROTKB|Q2KI06241 PHOSPHO2 "Pyridoxal phosphate 0.818 0.933 0.311 9.4e-27
MGI|MGI:2447348267 Phospho1 "phosphatase, orphan 0.807 0.831 0.319 9.4e-27
RGD|1306182289 Phospho1 "phosphatase, orphan 0.807 0.768 0.319 9.4e-27
UNIPROTKB|F1S1V3241 PHOSPHO2 "Uncharacterized prot 0.818 0.933 0.307 3.2e-26
UNIPROTKB|Q8TCT1267 PHOSPHO1 "Phosphoethanolamine/ 0.829 0.853 0.315 5.2e-26
ZFIN|ZDB-GENE-080204-104241 phospho2 "phosphatase, orphan 0.821 0.937 0.301 6.6e-26
TAIR|locus:2032748 PS2 "phosphate starvation-induced gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1015 (362.4 bits), Expect = 2.0e-102, P = 2.0e-102
 Identities = 195/283 (68%), Positives = 228/283 (80%)

Query:     2 SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE 61
             + IVV+FDFDKTIID DSDN+V+DELG TDLFNQLLPTMPWN+LMDRMMKELH QGKTIE
Sbjct:    12 NNIVVVFDFDKTIIDVDSDNWVIDELGFTDLFNQLLPTMPWNTLMDRMMKELHDQGKTIE 71

Query:    62 DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP 121
             +I +VL+ IPIHPRVVPAIKSAH LGCELRIVSDAN+FFIETI+EHLGI + FSEIN+NP
Sbjct:    72 EIKQVLRTIPIHPRVVPAIKSAHDLGCELRIVSDANMFFIETIVEHLGISELFSEINSNP 131

Query:   122 GFVDEEGRLRIFPFHDFTKCSHGCNL--CPPNMCKGVVIERIQASLSKEGNKKIIYLGDG 179
             G+VDE G L+I P+HDFTK  H C+   CPPNMCKG++IERIQ SL+KEG KK+IYLGDG
Sbjct:   132 GYVDERGTLKISPYHDFTKSPHSCSCGTCPPNMCKGLIIERIQQSLAKEGKKKMIYLGDG 191

Query:   180 SGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTIG 239
             +GDYCPSLKL+  D+VMPRKNFP+WDLI +NPMLIKA I EWTDG+ +E IL+  +  I 
Sbjct:   192 AGDYCPSLKLNTEDYVMPRKNFPVWDLISQNPMLIKAAIREWTDGQSMEMILIGTIEEI- 250

Query:   240 STNNNNSAQLLSAD--CKLQTISAAA----HET-LPQVLSVTQ 275
                      L SA+  CK+QTIS       HE  LP+ L V+Q
Sbjct:   251 RLEEEKEKMLTSAENNCKMQTISIGINNVHHEPILPRALRVSQ 293
GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016791 "phosphatase activity" evidence=IEA
GO:0004427 "inorganic diphosphatase activity" evidence=IDA
GO:0016036 "cellular response to phosphate starvation" evidence=IEP;RCA
GO:0016462 "pyrophosphatase activity" evidence=IDA
GO:0051262 "protein tetramerization" evidence=IDA
GO:0019375 "galactolipid biosynthetic process" evidence=RCA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2007958 PEPC1 "phosphoethanolamine/phosphocholine phosphatase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134353 AT4G29530 "AT4G29530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-198 phospho1 "phosphatase, orphan 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI06 PHOSPHO2 "Pyridoxal phosphate phosphatase PHOSPHO2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2447348 Phospho1 "phosphatase, orphan 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306182 Phospho1 "phosphatase, orphan 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1V3 PHOSPHO2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TCT1 PHOSPHO1 "Phosphoethanolamine/phosphocholine phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-104 phospho2 "phosphatase, orphan 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8R2H9PHOP1_MOUSE3, ., 1, ., 3, ., 7, 50.30730.82900.8539yesno
Q6DBV4PHOP1_DANRE3, ., 1, ., 3, ., -0.36690.83270.8207yesno
Q9FZ62PPSP2_ARATH3, ., 6, ., 1, ., 10.67140.98900.9749yesno
Q8TCT1PHOP1_HUMAN3, ., 1, ., 3, ., 7, 50.31040.83270.8576yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
pfam06888234 pfam06888, Put_Phosphatase, Putative Phosphatase 1e-128
TIGR01489188 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1 2e-62
TIGR01488177 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superf 7e-25
COG4359220 COG4359, COG4359, Uncharacterized conserved protei 2e-10
COG0546220 COG0546, Gph, Predicted phosphatases [General func 3e-07
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 2e-05
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 2e-05
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 2e-04
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 6e-04
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 8e-04
pfam12710122 pfam12710, HAD, haloacid dehalogenase-like hydrola 0.001
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 0.001
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 0.001
>gnl|CDD|219218 pfam06888, Put_Phosphatase, Putative Phosphatase Back     alignment and domain information 
 Score =  362 bits (931), Expect = e-128
 Identities = 141/239 (58%), Positives = 172/239 (71%), Gaps = 12/239 (5%)

Query: 4   IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTI 60
           I+V+FDFDKTIID DSDN+VVDEL  T LF QL PTMP   WN LMDR+MKELH QG +I
Sbjct: 1   ILVVFDFDKTIIDVDSDNWVVDELPTTQLFEQLRPTMPKGFWNELMDRVMKELHDQGVSI 60

Query: 61  EDIVEVLKRIPIHPRVVPAIKSA--HALGCELRIVSDANLFFIETILEHLGIRDCFSEIN 118
            DI  VL+ IP+ P +V  IK    + LGC+L I+SDAN FFIETIL   G+ D FSEI 
Sbjct: 61  ADIKAVLRSIPLVPGMVRLIKFLAKNGLGCDLIIISDANSFFIETILRAAGLHDLFSEIF 120

Query: 119 TNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGN--KKIIYL 176
           TNP  VD  GRL + P+HD     H CNLCP NMCKG V++ I AS ++EG   +++IY+
Sbjct: 121 TNPASVDARGRLTVLPYHD-----HSCNLCPSNMCKGKVLDEIVASQAREGVRYERVIYV 175

Query: 177 GDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLV 235
           GDG+ D+CPSL+L E D  MPRK FPLW LI  NP+L+KA + EW+ G ELE+ILL L+
Sbjct: 176 GDGANDFCPSLRLRECDVAMPRKGFPLWKLISENPLLLKASVVEWSSGAELEEILLQLI 234

This family contains a number of putative eukaryotic acid phosphatases. Some family members represent the products of the PSI14 phosphatase family in Lycopersicon esculentum (Tomato). Length = 234
>gnl|CDD|213629 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>gnl|CDD|233435 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>gnl|CDD|226802 COG4359, COG4359, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|221729 pfam12710, HAD, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 275
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 100.0
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 100.0
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.94
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.93
COG4359220 Uncharacterized conserved protein [Function unknow 99.93
COG0546220 Gph Predicted phosphatases [General function predi 99.92
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.92
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.92
PRK13288214 pyrophosphatase PpaX; Provisional 99.92
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.91
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.91
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.91
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.9
PLN02954224 phosphoserine phosphatase 99.9
PRK13226229 phosphoglycolate phosphatase; Provisional 99.9
PRK13225273 phosphoglycolate phosphatase; Provisional 99.9
PRK09449224 dUMP phosphatase; Provisional 99.89
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.89
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.89
PRK11587218 putative phosphatase; Provisional 99.89
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.89
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.89
PRK13222226 phosphoglycolate phosphatase; Provisional 99.89
PLN02575381 haloacid dehalogenase-like hydrolase 99.87
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.87
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.87
PRK13223272 phosphoglycolate phosphatase; Provisional 99.87
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.87
PRK14988224 GMP/IMP nucleotidase; Provisional 99.86
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.86
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.86
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.86
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.85
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.85
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.85
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.85
PLN02940 382 riboflavin kinase 99.84
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.84
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.84
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.83
PRK11133322 serB phosphoserine phosphatase; Provisional 99.81
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.81
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.81
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.81
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.8
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.79
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.79
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.79
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.79
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.78
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.78
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.78
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.78
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.77
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.74
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.74
PHA02597197 30.2 hypothetical protein; Provisional 99.73
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.73
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.72
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.72
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.72
PLN02811220 hydrolase 99.71
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.7
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.69
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.69
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.65
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.65
PRK06769173 hypothetical protein; Validated 99.65
PRK11590211 hypothetical protein; Provisional 99.65
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.64
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.61
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.57
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.56
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.54
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.54
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.54
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.54
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.52
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.52
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.47
PRK08238 479 hypothetical protein; Validated 99.45
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.44
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.42
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.4
PHA02530300 pseT polynucleotide kinase; Provisional 99.38
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.37
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.33
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.32
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.32
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.31
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.3
TIGR01684301 viral_ppase viral phosphatase. These proteins also 99.27
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 99.21
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.21
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.18
PLN02645311 phosphoglycolate phosphatase 99.14
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.13
PRK01158230 phosphoglycolate phosphatase; Provisional 99.13
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 99.12
PHA03398303 viral phosphatase superfamily protein; Provisional 99.11
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.05
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.02
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.01
PRK10444248 UMP phosphatase; Provisional 99.0
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.99
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.98
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 98.93
COG4996164 Predicted phosphatase [General function prediction 98.91
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.9
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 98.86
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.85
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.83
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.82
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.81
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.76
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.75
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.7
PLN02177 497 glycerol-3-phosphate acyltransferase 98.69
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 98.69
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.67
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 98.67
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.65
TIGR01675229 plant-AP plant acid phosphatase. This model explic 98.63
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.62
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.61
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.59
PRK10671834 copA copper exporting ATPase; Provisional 98.53
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.51
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.46
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 98.45
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.43
PRK10513270 sugar phosphate phosphatase; Provisional 98.42
PTZ00445219 p36-lilke protein; Provisional 98.38
COG4229229 Predicted enolase-phosphatase [Energy production a 98.37
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 98.33
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 98.33
COG4087152 Soluble P-type ATPase [General function prediction 98.32
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.29
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.25
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 98.24
PRK14010673 potassium-transporting ATPase subunit B; Provision 98.23
PRK01122679 potassium-transporting ATPase subunit B; Provision 98.21
PRK10976266 putative hydrolase; Provisional 98.2
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 98.18
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 98.18
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 98.18
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 98.15
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 98.14
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 98.13
COG2503274 Predicted secreted acid phosphatase [General funct 98.07
PTZ00174247 phosphomannomutase; Provisional 98.06
PLN02580384 trehalose-phosphatase 98.03
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 98.02
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.0
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 98.0
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 98.0
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.99
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 97.99
PLN02887580 hydrolase family protein 97.98
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.97
COG3700237 AphA Acid phosphatase (class B) [General function 97.97
KOG3128298 consensus Uncharacterized conserved protein [Funct 97.96
PRK15122 903 magnesium-transporting ATPase; Provisional 97.95
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.94
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.94
COG4030315 Uncharacterized protein conserved in archaea [Func 97.94
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 97.94
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 97.91
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 97.91
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.91
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.86
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 97.83
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 97.82
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 97.8
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 97.79
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.72
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 97.72
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 97.7
PLN02382 413 probable sucrose-phosphatase 97.69
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 97.68
PLN02499 498 glycerol-3-phosphate acyltransferase 97.59
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 97.54
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 97.53
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 97.49
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 97.49
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.4
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.13
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 97.12
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.99
PLN02423245 phosphomannomutase 96.89
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 96.89
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 96.78
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 96.72
PLN03017366 trehalose-phosphatase 96.61
PLN02151354 trehalose-phosphatase 96.55
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 96.35
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 96.33
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 96.32
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 96.32
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 96.31
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 96.16
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 96.15
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 96.13
KOG2116738 consensus Protein involved in plasmid maintenance/ 96.0
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 95.96
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.95
PLN03190 1178 aminophospholipid translocase; Provisional 95.9
KOG2470510 consensus Similar to IMP-GMP specific 5'-nucleotid 95.87
PRK10513270 sugar phosphate phosphatase; Provisional 95.84
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 95.82
PRK10976266 putative hydrolase; Provisional 95.72
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 95.72
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 95.5
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 95.41
COG4850373 Uncharacterized conserved protein [Function unknow 95.36
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 95.33
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 95.03
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 94.98
PLN03063797 alpha,alpha-trehalose-phosphate synthase (UDP-form 94.78
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 94.52
PLN02887580 hydrolase family protein 94.43
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 94.36
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 94.19
KOG3189252 consensus Phosphomannomutase [Lipid transport and 94.15
KOG1618 389 consensus Predicted phosphatase [General function 94.09
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 94.05
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 93.72
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 93.24
PTZ00174247 phosphomannomutase; Provisional 92.74
PLN02423245 phosphomannomutase 92.56
KOG0206 1151 consensus P-type ATPase [General function predicti 89.91
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 89.54
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 88.57
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 87.99
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 87.69
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 87.51
COG5083580 SMP2 Uncharacterized protein involved in plasmid m 86.98
KOG2134 422 consensus Polynucleotide kinase 3' phosphatase [Re 85.7
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 85.31
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 85.11
COG0731296 Fe-S oxidoreductases [Energy production and conver 84.24
COG5663194 Uncharacterized conserved protein [Function unknow 84.05
KOG4549144 consensus Magnesium-dependent phosphatase [General 83.2
TIGR024681050 sucrsPsyn_pln sucrose phosphate synthase/possible 82.35
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 81.09
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 81.08
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 80.56
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-38  Score=262.35  Aligned_cols=226  Identities=50%  Similarity=0.940  Sum_probs=204.9

Q ss_pred             EEEEEcCCcccCCccHHHHHHHhCCChH---HHhhcCCCChHHHHHHHHHHHHhCCCCHHHHHHHHhcCCCCCCHHHHHH
Q 044553            5 VVIFDFDKTIIDCDSDNFVVDELGATDL---FNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVEVLKRIPIHPRVVPAIK   81 (275)
Q Consensus         5 ~viFD~DGTL~d~~~~~~~~~~~g~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~e~L~   81 (275)
                      +|+||||+||+|.++..++++.++....   .........|.++++.+++.++..+.+.+++.+.++.+++.||+.++++
T Consensus         2 LvvfDFD~TIvd~dsd~~v~~~l~~~~~~~~l~~~~~~~~wt~~m~~vl~~L~~~gvt~~~I~~~l~~ip~~pgm~~~l~   81 (234)
T PF06888_consen    2 LVVFDFDHTIVDQDSDDWVIELLPPEELPEELRESYPKGGWTEYMDRVLQLLHEQGVTPEDIRDALRSIPIDPGMKELLR   81 (234)
T ss_pred             EEEEeCCCCccCCccHHHHHHhcCCcccHHHHHHhccccchHHHHHHHHHHHHHcCCCHHHHHHHHHcCCCCccHHHHHH
Confidence            7899999999999999999999987644   3333444569999999999999999999999999999999999999999


Q ss_pred             HH--HHcCCcEEEEeCCCHHHHHHHHHHcCCcCCcceEecCCCccCCCCceeecccCCCCCCCCCCCcCCCCCchHHHHH
Q 044553           82 SA--HALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIE  159 (275)
Q Consensus        82 ~L--~~~g~~~~IvS~~~~~~i~~~l~~~gl~~~fd~i~~~~~~~~~~g~~~~kp~~~~~~~~~~~~~~~~~~~K~~~l~  159 (275)
                      .+  ++.|+.++|+|++...+|+.+|++.|+...|+.|++|...++.+|.+...|++.     |.|..|+.++||..+++
T Consensus        82 ~l~~~~~~~~~~IiSDaNs~fI~~iL~~~gl~~~f~~I~TNpa~~~~~G~l~v~pyh~-----h~C~~C~~NmCK~~il~  156 (234)
T PF06888_consen   82 FLAKNQRGFDLIIISDANSFFIETILEHHGLRDCFSEIFTNPACFDADGRLRVRPYHS-----HGCSLCPPNMCKGKILE  156 (234)
T ss_pred             HHHhcCCCceEEEEeCCcHhHHHHHHHhCCCccccceEEeCCceecCCceEEEeCccC-----CCCCcCCCccchHHHHH
Confidence            99  457999999999999999999999999999999999999999999988889885     78999999999999999


Q ss_pred             HHHHhhhcC--CCCeEEEEcCCCCCcccccccCCCCeEeecCCchhhHHHhhCCCceeEEEeeCCChHHHHHHHHHHH
Q 044553          160 RIQASLSKE--GNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLV  235 (275)
Q Consensus       160 ~~~~~~~~~--~~~~~i~vGDs~~Di~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~el~~~l~~~~  235 (275)
                      +++......  .+++++|||||.||+|++.+++..|++++|.||++++++++++....|.+++|++..||++.|++++
T Consensus       157 ~~~~~~~~~g~~~~rviYiGDG~nD~Cp~~~L~~~D~v~~R~~~~l~~~i~~~~~~~~a~v~~W~~g~~i~~~l~~~i  234 (234)
T PF06888_consen  157 RLLQEQAQRGVPYDRVIYIGDGRNDFCPALRLRPRDVVFPRKGYPLHKLIQKNPGEVKAEVVPWSSGEEILEILLQLI  234 (234)
T ss_pred             HHHHHHhhcCCCcceEEEECCCCCCcCcccccCCCCEEecCCCChHHHHHhcCCCcceeEEEecCCHHHHHHHHHhhC
Confidence            999874222  2589999999999999999999999999999999999999888788899999999999999998764

It includes plant phosphatases with homology to the haloacid dehalogenase (HAD) superfamily [, ]. PHOSPHO1 is a phosphoethanolamine/phosphocholine phosphatase [], while PHOSPHO2 has high activity toward pyridoxal 5'-phosphate (PLP), and it is active at much lower level toward pyrophosphate, phosphoethanolamine (PEA)and phosphocholine (PCho) []. ; GO: 0016791 phosphatase activity
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>COG4850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1618 consensus Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query275
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 4e-33
3fvv_A232 Uncharacterized protein; unknown function, structu 3e-08
1te2_A226 Putative phosphatase; structural genomics, phospha 2e-07
2g09_A297 Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMP 4e-07
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 8e-07
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 2e-06
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 2e-06
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 2e-05
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 2e-05
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 3e-05
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 5e-05
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 7e-05
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 9e-05
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 1e-04
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 1e-04
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 1e-04
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 1e-04
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 2e-04
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 4e-04
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 5e-04
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 5e-04
3sd7_A240 Putative phosphatase; structural genomics, haloaci 6e-04
2p11_A231 Hypothetical protein; putative haloacid dehalogena 7e-04
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 7e-04
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 8e-04
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
 Score =  119 bits (301), Expect = 4e-33
 Identities = 51/250 (20%), Positives = 84/250 (33%), Gaps = 29/250 (11%)

Query: 4   IVVIFDFDKTIIDCDSDNFVVDELG---ATDLFNQLLP-TMPWNSLMDRMMKELHSQGKT 59
             +I DFD TI   D+   ++          L + +L  T+     + RM   L S  K 
Sbjct: 7   PFIICDFDGTITMNDNIINIMKTFAPPEWMALKDGVLSKTLSIKEGVGRMFGLLPSSLK- 65

Query: 60  IEDIVE-VLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEIN 118
            E+I   VL+   I       +   +       ++S    FF+  +LE +  +D    I 
Sbjct: 66  -EEITSFVLEDAKIREGFREFVAFINEHEIPFYVISGGMDFFVYPLLEGIVEKD---RIY 121

Query: 119 TNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGD 178
            N    D +     +P      CS+ C       CK  VI  +      E N+ II +GD
Sbjct: 122 CNHASFDNDYIHIDWPHSCKGTCSNQC-----GCCKPSVIHEL-----SEPNQYIIMIGD 171

Query: 179 GSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNTI 238
              D          D    R    L +               + D  E+ + + ++    
Sbjct: 172 SVTDVEA---AKLSDLCFARD--YLLNECREQ----NLNHLPYQDFYEIRKEIENVKEVQ 222

Query: 239 GSTNNNNSAQ 248
               N N+ +
Sbjct: 223 EWLQNKNAGE 232
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
>2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Length = 219 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.93
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.91
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.91
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.9
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.89
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.89
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.89
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.89
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.89
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.88
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.88
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.88
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.88
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.88
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.88
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.87
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.87
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.87
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.87
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.87
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.86
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.86
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.86
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.86
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.86
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.86
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.85
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.85
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.85
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.85
3fvv_A232 Uncharacterized protein; unknown function, structu 99.85
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.85
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.85
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.85
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.85
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.84
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.84
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.84
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.84
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.84
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.84
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.84
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.84
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.83
1te2_A226 Putative phosphatase; structural genomics, phospha 99.83
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.83
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.83
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.83
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.82
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.82
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.82
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.82
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.82
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.81
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.81
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.81
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.81
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.81
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.81
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.8
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.8
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.8
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.8
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.8
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.8
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.8
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.79
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.78
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.77
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.76
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.75
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.75
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.74
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.73
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.72
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.7
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.7
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.66
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.65
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.64
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.62
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.62
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.61
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.6
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.6
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.59
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.59
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.57
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.57
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.56
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.56
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.54
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.54
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.53
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.53
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.51
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.5
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.49
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.48
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.18
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.44
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.42
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.42
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.4
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.4
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.4
4gxt_A385 A conserved functionally unknown protein; structur 99.39
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.38
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.36
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.35
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.33
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.33
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.32
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.32
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.3
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.29
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 99.29
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.29
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.28
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.28
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.28
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.26
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.23
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.22
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.14
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 99.09
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.08
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.07
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.06
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.04
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.03
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.02
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.98
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.87
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.71
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.58
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 98.58
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 98.43
2jc9_A555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 98.39
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.32
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 98.3
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 98.28
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.22
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 98.2
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 98.15
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 98.14
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 98.13
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 98.12
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 98.11
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 98.1
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.08
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.97
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 97.95
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 97.77
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.72
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 97.64
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 97.53
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 97.51
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 97.46
4g63_A470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 97.42
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 97.31
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 97.26
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 96.51
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 95.97
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 95.84
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 95.58
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 95.5
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 95.32
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 94.77
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 93.73
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.14
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 91.96
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 91.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 90.66
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 90.47
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 89.86
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 89.56
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 89.2
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 88.83
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 88.59
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 88.2
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 87.8
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 86.44
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 86.38
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 85.46
3dao_A283 Putative phosphatse; structural genomics, joint ce 83.13
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.93  E-value=3e-25  Score=182.72  Aligned_cols=199  Identities=14%  Similarity=0.128  Sum_probs=140.8

Q ss_pred             ceEEEEEcCCcccCCcc-----HHHHHHHhCCChH--HHhhcCCCChHHHHHHHHHHHHhCCCCHHHHHH---------H
Q 044553            3 GIVVIFDFDKTIIDCDS-----DNFVVDELGATDL--FNQLLPTMPWNSLMDRMMKELHSQGKTIEDIVE---------V   66 (275)
Q Consensus         3 ~~~viFD~DGTL~d~~~-----~~~~~~~~g~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~   66 (275)
                      +|+|+||+||||+|+..     +..+++++|.+..  ......+................ ....+.+..         .
T Consensus         1 IkAViFD~DGTL~ds~~~~~~a~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~   79 (216)
T 3kbb_A            1 MEAVIFDMDGVLMDTEPLYFEAYRRVAESYGKPYTEDLHRRIMGVPEREGLPILMEALEI-KDSLENFKKRVHEEKKRVF   79 (216)
T ss_dssp             CCEEEEESBTTTBCCGGGHHHHHHHHHHHTTCCCCHHHHHHHTTSCHHHHHHHHHHHTTC-CSCHHHHHHHHHHHHHHHH
T ss_pred             CeEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHHHHHHHhccchhhhhhhhhhcccc-hhhHHHHHHHHHHHHHHHH
Confidence            47999999999999865     3567788887522  22222233334444433333221 222332211         2


Q ss_pred             HhcCCCCCCHHHHHHHHHHcCCcEEEEeCCCHHHHHHHHHHcCCcCCcceEecCCCccCCCCceeecccCCCCCCCCCCC
Q 044553           67 LKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCN  146 (275)
Q Consensus        67 ~~~~~~~pg~~e~L~~L~~~g~~~~IvS~~~~~~i~~~l~~~gl~~~fd~i~~~~~~~~~~g~~~~kp~~~~~~~~~~~~  146 (275)
                      .....++||+.++++.|+++|++++|+||++...+...++.+|+.++||.+++++...      ..||+|          
T Consensus        80 ~~~~~~~pg~~~~l~~L~~~g~~~~i~tn~~~~~~~~~l~~~~l~~~fd~~~~~~~~~------~~KP~p----------  143 (216)
T 3kbb_A           80 SELLKENPGVREALEFVKSKRIKLALATSTPQREALERLRRLDLEKYFDVMVFGDQVK------NGKPDP----------  143 (216)
T ss_dssp             HHHCCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTCGGGCSEEECGGGSS------SCTTST----------
T ss_pred             HHhcccCccHHHHHHHHHHcCCCcccccCCcHHHHHHHHHhcCCCccccccccccccC------CCcccH----------
Confidence            2447899999999999999999999999999999999999999999999999876532      457766          


Q ss_pred             cCCCCCchHHHHHHHHHhhhcCCCCeEEEEcCCCCCcccccccCCCCeEeecCCchh-hHHHhhCCCceeEEEeeCCChH
Q 044553          147 LCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPL-WDLIIRNPMLIKAEIHEWTDGE  225 (275)
Q Consensus       147 ~~~~~~~K~~~l~~~~~~~~~~~~~~~i~vGDs~~Di~~a~~~~~~~~~~~~~~~~~-~~l~~~~~~~~~~~~~~~~~~~  225 (275)
                               ++++.++.+++.. |++|+||||+.+|+.+|+++|+..++....++.. ..+..... .      ...++.
T Consensus       144 ---------~~~~~a~~~lg~~-p~e~l~VgDs~~Di~aA~~aG~~~i~~v~~g~~~~~~l~~~~~-~------~i~~~~  206 (216)
T 3kbb_A          144 ---------EIYLLVLERLNVV-PEKVVVFEDSKSGVEAAKSAGIERIYGVVHSLNDGKALLEAGA-V------ALVKPE  206 (216)
T ss_dssp             ---------HHHHHHHHHHTCC-GGGEEEEECSHHHHHHHHHTTCCCEEEECCSSSCCHHHHHTTC-S------EEECGG
T ss_pred             ---------HHHHHHHHhhCCC-ccceEEEecCHHHHHHHHHcCCcEEEEecCCCCCHHHHHhCCC-c------EECCHH
Confidence                     6777888888765 5899999999999999999999887655555433 33333222 1      234678


Q ss_pred             HHHHHHHHHH
Q 044553          226 ELEQILLHLV  235 (275)
Q Consensus       226 el~~~l~~~~  235 (275)
                      +|.+.|++++
T Consensus       207 eli~~l~eLL  216 (216)
T 3kbb_A          207 EILNVLKEVL  216 (216)
T ss_dssp             GHHHHHHHHC
T ss_pred             HHHHHHHHHC
Confidence            8988888763
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 275
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 2e-14
d2bdua1291 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III 6e-13
d1nnla_217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 9e-09
d1j97a_210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 3e-05
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: MtnX-like
domain: 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX
species: Bacillus subtilis [TaxId: 1423]

 Score = 68.9 bits (167), Expect = 2e-14
 Identities = 42/235 (17%), Positives = 70/235 (29%), Gaps = 25/235 (10%)

Query: 5   VVIFDFDKTIIDCDSDNFVVDELG---ATDLFNQLLPTMPWNSLMDRMMKELHSQGKTIE 61
            +I DFD TI   D+   ++          L + +L            M  L       E
Sbjct: 6   FIICDFDGTITMNDNIINIMKTFAPPEWMALKDGVLSKTLSIKEGVGRMFGLLPSSLKEE 65

Query: 62  DIVEVLKRIPIHPRVVPAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNP 121
               VL+   I       +   +       ++S    FF+  +LE +  +D       N 
Sbjct: 66  ITSFVLEDAKIREGFREFVAFINEHEIPFYVISGGMDFFVYPLLEGIVEKDRIY---CNH 122

Query: 122 GFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGNKKIIYLGDGSG 181
              D +     +P      CS+ C       CK  VI  +        N+ II +GD   
Sbjct: 123 ASFDNDYIHIDWPHSCKGTCSNQC-----GCCKPSVIHELSEP-----NQYIIMIGDSVT 172

Query: 182 DYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVN 236
           D          D    R    L +               + D  E+ + + ++  
Sbjct: 173 DVEA---AKLSDLCFARDY--LLNECREQ----NLNHLPYQDFYEIRKEIENVKE 218
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query275
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.91
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.91
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.9
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.9
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.9
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.9
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.89
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.89
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.87
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.87
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.86
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.85
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.84
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.84
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.83
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.83
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.78
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.76
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.76
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.74
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.73
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.72
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.7
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.69
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.68
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 99.65
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.64
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.56
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.46
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.4
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.34
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.31
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.3
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.29
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.24
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.18
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.11
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 99.1
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.08
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.04
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.99
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.92
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.89
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.84
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.81
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.72
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.68
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 98.62
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.59
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 98.55
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.47
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.36
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 98.24
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 98.23
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 97.82
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.77
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 97.4
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 97.2
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 96.69
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: MtnX-like
domain: 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX
species: Bacillus subtilis [TaxId: 1423]

Probab=99.91  E-value=1.9e-24  Score=177.52  Aligned_cols=212  Identities=21%  Similarity=0.204  Sum_probs=141.9

Q ss_pred             ceEEEEEcCCcccCCccHHHHHHHhCCChHHH---hhc-CCCChHHHHHHHHHHHHhCCCCHHHHH-HHHhcCCCCCCHH
Q 044553            3 GIVVIFDFDKTIIDCDSDNFVVDELGATDLFN---QLL-PTMPWNSLMDRMMKELHSQGKTIEDIV-EVLKRIPIHPRVV   77 (275)
Q Consensus         3 ~~~viFD~DGTL~d~~~~~~~~~~~g~~~~~~---~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~pg~~   77 (275)
                      +.+|+|||||||+++++...+++.++.+.+..   ... +.......+...+....  +...+.+. .....++++||+.
T Consensus         4 k~lVifD~DGTL~~~d~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~pg~~   81 (226)
T d2feaa1           4 KPFIICDFDGTITMNDNIINIMKTFAPPEWMALKDGVLSKTLSIKEGVGRMFGLLP--SSLKEEITSFVLEDAKIREGFR   81 (226)
T ss_dssp             CEEEEECCTTTTBSSCHHHHHHHHHSCTHHHHHHHHHHTTSSCHHHHHHHHHTTSB--GGGHHHHHHHHHHHCCBCTTHH
T ss_pred             CeEEEEeCCCCCcCchHHHHHHHHHCcchHHHHHHHHHcCcccHHHHHHHHHHHhc--cccHHHHHHHHHhccchhHHHH
Confidence            57899999999999999999999998764322   222 23344444443332211  11233333 3345688999999


Q ss_pred             HHHHHHHHcCCcEEEEeCCCHHHHHHHHHHcCCcCCcceEecCCCccCCCCceeecccCCCCCCCCCCCcCCCCCchHHH
Q 044553           78 PAIKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVV  157 (275)
Q Consensus        78 e~L~~L~~~g~~~~IvS~~~~~~i~~~l~~~gl~~~fd~i~~~~~~~~~~g~~~~kp~~~~~~~~~~~~~~~~~~~K~~~  157 (275)
                      ++|+.|+++|++++|+||+....++.+++++|+..+   +++++..++.++....+|.+..     .+...+...+|..+
T Consensus        82 ~~l~~L~~~g~~~~ivS~~~~~~i~~~l~~l~~~~~---~~an~~~~~~~~~~~~~~~~~~-----~~~~~~k~~~~~~~  153 (226)
T d2feaa1          82 EFVAFINEHEIPFYVISGGMDFFVYPLLEGIVEKDR---IYCNHASFDNDYIHIDWPHSCK-----GTCSNQCGCCKPSV  153 (226)
T ss_dssp             HHHHHHHHHTCCEEEEEEEEHHHHHHHHTTTSCGGG---EEEEEEECSSSBCEEECTTCCC-----TTCCSCCSSCHHHH
T ss_pred             HHHHHHHhcccccccCCcchhhhHHHHHHHcCCccc---eeeeeEEEeCCcceeccccccc-----cccccCCHHHHHHH
Confidence            999999999999999999999999999999988644   6666655555555555665531     01101223334444


Q ss_pred             HHHHHHhhhcCCCCeEEEEcCCCCCcccccccCCCCeEeecCCchhhHHHhhCCCceeEEEeeCCChHHHHHHHHHHHHH
Q 044553          158 IERIQASLSKEGNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLIKAEIHEWTDGEELEQILLHLVNT  237 (275)
Q Consensus       158 l~~~~~~~~~~~~~~~i~vGDs~~Di~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~el~~~l~~~~~~  237 (275)
                      +    ..++.. +++++|||||.+|+.+|+.   +++.|++.+.  .+...+. ..+   +.+|++|+||..+++++.+-
T Consensus       154 ~----~~~~~~-~~~~i~iGDs~~Dl~~a~~---A~~~~a~~~~--~~~~~~~-~~~---~~~~~d~~~i~~~l~~~~~~  219 (226)
T d2feaa1         154 I----HELSEP-NQYIIMIGDSVTDVEAAKL---SDLCFARDYL--LNECREQ-NLN---HLPYQDFYEIRKEIENVKEV  219 (226)
T ss_dssp             H----HHHCCT-TCEEEEEECCGGGHHHHHT---CSEEEECHHH--HHHHHHT-TCC---EECCSSHHHHHHHHHTSHHH
T ss_pred             H----HHhcCC-CceEEEEeCchhhHHHHHH---CCEEEEecch--HHHHHHc-CCC---eeecCCHHHHHHHHHHHHHH
Confidence            4    444443 5799999999999999955   5677776432  2223232 223   55899999999999988764


Q ss_pred             h
Q 044553          238 I  238 (275)
Q Consensus       238 ~  238 (275)
                      .
T Consensus       220 ~  220 (226)
T d2feaa1         220 Q  220 (226)
T ss_dssp             H
T ss_pred             H
Confidence            4
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure