Citrus Sinensis ID: 044637

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370
SKRRAGGTIKACYVPSLEFTSLALMAEKTIFVWNPGMEEESLSNVKRSKTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLYPSGI
ccccccccEEEEEccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHcccccEEEEEEcccccccccccccccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEEccccccccccccccccccccEEEEEccccccHHHHcccccccEEEEEcccccccccHHHHccccccccEEEEEEccccccccEEccccccccccccEEEEEcccccccccccccccccccEEEEEccEEEccEEEEccccccccccEEEEcccccccEEEEcccccccccEEEEccccccccccccccccccccEEEcccccHHHHHHHHHcccccccccEEEccccc
ccccccccEEEEcHHHHHHHHHHHHHHHcccEcccccccccccccccEEHEcccHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcEEcccccccHHccHHHHHHHHHHHHEccccccccccccccccHHHHcHccccccccHHHHHHHHHHHHHHEEEEccccccHHHHHHHHHHcccccEEEEEccccHcccccccccccccccccEEEEEEccccccccHHHHHHccccHEEEEEEccccccEEEEEccccccccEEEEEcccccccEEEEcccccccccEEEEcccHHHHHcccHHHHHHHHHEEEEccccHHHHHHHccccccccEEEEEEccccc
skrraggtikacyvpsleftSLALMAEKTIfvwnpgmeeeslsnvkrsktDHLALIQCENFCKKFKHLRVLNLGsavldqyppglenfFYLKYLKlnipslkclpSLLCTLInlqtlempssyidhspEDIWMMLKLMHLnfgsitlpappknnsstlkNLIFIsalhpgsctpdilgrlpnvqtlrisgdlsyyhsgvskslcqlHKLECLKLVNEGNMRQLSRMILseykfppsltqlslsntelmedpmptleelphleVLKLKQNSYLErklvcvgcssfpqlkILHLKSMLWLEewtmgagampkleslilnpcaylRKLPEELWCIKSLCklelhwpqpeLRQRLRAFEDMEWRygiqlypsgi
skrraggtikacyvpslefTSLALMAEKTIFVWNPGMEEESLSNVKRSKTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKlelhwpqpELRQRLRAFEDMEWRYGiqlypsgi
SKRRAGGTIKACYVPSLEFTSLALMAEKTIFVWNPGMEEESLSNVKRSKTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLYPSGI
*******TIKACYVPSLEFTSLALMAEKTIFVWNPG*************TDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPA*******TLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFP***********************LPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLY****
*KRRAGGTIKACYVPSLEFTSLALMAEKTIFVWN*****************HLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSIT***********L**LIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELR*********EWRYGIQLYPSGI
********IKACYVPSLEFTSLALMAEKTIFVWNPGME**********KTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLYPSGI
******GTIKACYVPSLEFTSLALMAEKTIFVWNPGMEEESLSNVKRSKTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLYPS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SKRRAGGTIKACYVPSLEFTSLALMAEKTIFVWNPGMEEESLSNVKRSKTDHLALIQCENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEWRYGIQLYPSGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query370 2.2.26 [Sep-21-2011]
Q8W474907 Probable disease resistan no no 0.713 0.291 0.316 5e-19
Q9XIF0906 Putative disease resistan yes no 0.789 0.322 0.319 5e-19
Q9FJB5901 Disease resistance RPP8-l no no 0.789 0.324 0.267 4e-18
P59584910 Disease resistance protei no no 0.762 0.309 0.264 1e-16
Q9FJK8908 Probable disease resistan no no 0.735 0.299 0.278 6e-16
Q8W4J9908 Disease resistance protei no no 0.754 0.307 0.281 8e-16
P0DI18 1049 Probable disease resistan no no 0.681 0.240 0.289 7e-15
P0DI17 1049 Probable disease resistan no no 0.681 0.240 0.289 7e-15
P0C8S1906 Probable disease resistan no no 0.794 0.324 0.275 8e-15
Q8W3K3910 Putative disease resistan no no 0.740 0.301 0.275 1e-14
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 94/297 (31%), Positives = 144/297 (48%), Gaps = 33/297 (11%)

Query: 64  KFKHLRVLNLGSAVLD--QYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQ--TLEM 119
           + K LRVL+L     +  + P G+ N  +L+YL L    +  LPS L  L+ L    L++
Sbjct: 582 RLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDV 641

Query: 120 PSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKN-----NSSTLKNLIFISALHPGSCTP 174
            + +I   P+   + +++  L +  + L    K      N   L+ L++ S  H  S + 
Sbjct: 642 DTEFI-FVPD---VFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWH--SSSK 695

Query: 175 DILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVN--------EG---NMRQL 223
           D+ G +  + TL I          +S S+  L  LE L +V         EG   +   L
Sbjct: 696 DLCG-MTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHL 754

Query: 224 SRMILSEY-----KFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVC 278
             ++L  Y      FP  LT + LS   L EDPMP LE+L HL+ + L + SY  R++VC
Sbjct: 755 KHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVC 814

Query: 279 VGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSL 335
            G   FPQLK L +  +   EEW +  G+MP LE+L +  C  L+++P+ L  I SL
Sbjct: 815 SG-GGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSL 870
Possible disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
359491404 922 PREDICTED: probable disease resistance R 0.964 0.387 0.288 1e-29
359496848 856 PREDICTED: disease resistance RPP8-like 0.829 0.358 0.295 6e-27
147766035 902 hypothetical protein VITISV_038742 [Viti 0.829 0.340 0.289 1e-25
351720730 761 NBS-LRR disease-resistance protein scn3r 0.745 0.362 0.301 1e-24
359495931 1359 PREDICTED: probable disease resistance p 0.659 0.179 0.341 1e-22
147795782 1450 hypothetical protein VITISV_023621 [Viti 0.659 0.168 0.341 2e-22
296081343 1312 unnamed protein product [Vitis vinifera] 0.659 0.185 0.341 2e-22
224075299 896 nbs-lrr resistance protein [Populus tric 0.727 0.300 0.298 6e-22
444301787 878 NBS type disease resistance protein [Mal 0.832 0.350 0.314 7e-22
255577203 1064 conserved hypothetical protein [Ricinus 0.783 0.272 0.290 7e-22
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  136 bits (343), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 117/406 (28%), Positives = 191/406 (47%), Gaps = 49/406 (12%)

Query: 1   SKRRAGGTIKACYVPSL--EFTSLALMAEKTIFVWNPGMEEESLSNVKR----------- 47
           + R++ G IK C V  L  E +      ++ + + +      SL+ V+R           
Sbjct: 494 ATRKSNGRIKTCCVHDLLHELSVSKGKEDQFLDIIHGEFTVSSLTRVRRLAIHLGVPPTT 553

Query: 48  SKTDHLALIQCENFC-------KKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPS 100
             T  +  + C + C       +KFK LR+L+L    + +    + N  +L+YL L    
Sbjct: 554 KNTSKVRSLLCFDICEPSFQELRKFKLLRILDLEGVYISRLHSSIGNLIHLRYLGLRGTW 613

Query: 101 LKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKN 160
           LK LP  +  L+NLQTL++ S+ ++  P  IW M KL HL F  +   A      ++L N
Sbjct: 614 LKKLPPSIQFLLNLQTLDLRSTLLNPIPIVIWKMQKLRHLYFNELEEMAVNPPTDASLAN 673

Query: 161 LIFISA--LHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEG 218
           L  +    ++  S   + L +L N++ L + GDL  +   + K +    +LECLKL    
Sbjct: 674 LQTLHGICINQTSYVENGLSKLTNLRELGLHGDLLLHEEAIGKWIFSSERLECLKLHTRD 733

Query: 219 NMRQ-------------------------LSRMILSEYKFPPSLTQLSLSNTELMEDPMP 253
            M                           ++++  +EY FP +LT+LSL  + LMEDPM 
Sbjct: 734 VMGDFAKNAIPKLNFSSHPHLIKLHLKGFMAKLFDAEY-FPQNLTELSLKGSFLMEDPMV 792

Query: 254 TLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKLES 313
            LE L  L VLKLK ++YL ++++C  C  FPQL  L L  +  +E W +  GAM +L  
Sbjct: 793 KLEMLQSLRVLKLKHSAYLGKEMIC-SCGGFPQLHFLKLSFLNTVERWRIEDGAMGRLRQ 851

Query: 314 LILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRLRAFEDMEW 359
           L +  C  L+ +P  L  + ++ KL+L +   E   +++  +   W
Sbjct: 852 LEIIECKRLKIVPRGLQPVTTIHKLKLGYMPREFEMKVQERQGENW 897

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496848|ref|XP_002269653.2| PREDICTED: disease resistance RPP8-like protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351720730|ref|NP_001237442.1| NBS-LRR disease-resistance protein scn3r1 [Glycine max] gi|212293340|gb|ACJ24527.1| NBS-LRR disease-resistance protein scn3r1 [Glycine max] Back     alignment and taxonomy information
>gi|359495931|ref|XP_003635117.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795782|emb|CAN61050.1| hypothetical protein VITISV_023621 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081343|emb|CBI17689.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075299|ref|XP_002304589.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222842021|gb|EEE79568.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|444301787|gb|AGD98930.1| NBS type disease resistance protein [Malus x domestica] Back     alignment and taxonomy information
>gi|255577203|ref|XP_002529484.1| conserved hypothetical protein [Ricinus communis] gi|223531042|gb|EEF32894.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.767 0.313 0.324 1.2e-21
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.751 0.306 0.281 1.5e-20
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.786 0.322 0.265 2e-19
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.748 0.305 0.277 6.9e-19
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.670 0.273 0.32 1.7e-18
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.745 0.242 0.322 2.9e-15
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.681 0.240 0.297 4.4e-15
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.681 0.240 0.297 4.4e-15
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.683 0.248 0.307 1.3e-13
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.683 0.248 0.307 1.3e-13
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 270 (100.1 bits), Expect = 1.2e-21, P = 1.2e-21
 Identities = 99/305 (32%), Positives = 152/305 (49%)

Query:    68 LRVLNLGSAVLD--QYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQ--TLEMPSSY 123
             LRVL+L  A     + P  +    +LKYL L   S+  LPS L  L +L    L + S  
Sbjct:   575 LRVLDLDGAKFKGGKLPSSIGKLIHLKYLSLYQASVTYLPSSLRNLKSLLYLNLRINSGQ 634

Query:   124 IDHSPEDIWMMLKLMHLN--FGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDILGRLP 181
             + + P     ML+L +L+  +   +L      N   L+ LI  S     S   D L R+ 
Sbjct:   635 LINVPNVFKEMLELRYLSLPWERSSLTKLELGNLLKLETLINFST--KDSSVTD-LHRMT 691

Query:   182 NVQTLRI--SGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLS------RMILSEYK- 232
              ++TL+I  SG+   +   +S +L  L  LE L +    N  Q        R +L + + 
Sbjct:   692 KLRTLQILISGE-GLHMETLSSALSMLGHLEDLTVTPSENSVQFKHPKLIYRPMLPDVQH 750

Query:   233 FPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHL 292
             FP  LT +SL    L EDPMPTLE+L  L+V+ L  N+Y+ R++VC G   FP L  L +
Sbjct:   751 FPSHLTTISLVYCFLEEDPMPTLEKLLQLKVVSLWYNAYVGRRMVCTG-GGFPPLHRLEI 809

Query:   293 KSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWPQPELRQRL- 351
               +  LEEW +  G+MP L +L +  C  L+++P+ L  I SL +L +   +   ++++ 
Sbjct:   810 WGLDALEEWIVEEGSMPLLHTLHIVDCKKLKEIPDGLRFISSLKELAIRTNEKVFQKKVS 869

Query:   352 RAFED 356
             +  ED
Sbjct:   870 KGGED 874
GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017592001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (858 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 370
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.64
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.43
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
KOG4237498 consensus Extracellular matrix protein slit, conta 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG4341483 consensus F-box protein containing LRR [General fu 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.7
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.7
PLN03150623 hypothetical protein; Provisional 98.59
KOG4341483 consensus F-box protein containing LRR [General fu 98.54
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.5
PLN03150623 hypothetical protein; Provisional 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.28
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.11
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.03
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.02
PRK15386426 type III secretion protein GogB; Provisional 97.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.8
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.47
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.22
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.9
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.74
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.43
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.29
smart0037026 LRR Leucine-rich repeats, outliers. 91.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.76
smart0037026 LRR Leucine-rich repeats, outliers. 90.76
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.02
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.94  E-value=2.4e-26  Score=238.41  Aligned_cols=151  Identities=19%  Similarity=0.236  Sum_probs=80.3

Q ss_pred             HhccCCeeeEEEcCCCCcc-cCCcccCCcCCCcEEeeCCCCCc-ccChhhhcCCCCcEEecCCCcC-ccccHHHhccccC
Q 044637           61 FCKKFKHLRVLNLGSAVLD-QYPPGLENFFYLKYLKLNIPSLK-CLPSLLCTLINLQTLEMPSSYI-DHSPEDIWMMLKL  137 (370)
Q Consensus        61 ~~~~~~~L~~L~L~~~~~~-~~~~~~~~l~~L~~L~l~~~~~~-~lp~~~~~l~~L~~L~l~~~~~-~~lp~~i~~l~~L  137 (370)
                      ++..+++|++|++++|.++ .+|.  +.+++|++|++++|.+. .+|..++++++|++|++++|.+ ..+|..++++++|
T Consensus       113 ~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L  190 (968)
T PLN00113        113 IFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSL  190 (968)
T ss_pred             HhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCC
Confidence            3446677777777766665 3332  33555666666665554 4555555556666666655532 3455555555555


Q ss_pred             cEEEccCCcC-CCCCCCCCCCCCCCceeccccCC--CCCccccCCCCCccEEEEecccccchhcHHHhhhccCCCCEEEE
Q 044637          138 MHLNFGSITL-PAPPKNNSSTLKNLIFISALHPG--SCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKL  214 (370)
Q Consensus       138 ~~L~l~~~~~-~~~~~~~l~~l~~L~~L~l~~~~--~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l  214 (370)
                      ++|+++ +|. .+.+|..++++++|+.|++..+.  ...|..++.+++|+.|++++|.  ..+.+|..++++++|+.|++
T Consensus       191 ~~L~L~-~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~--l~~~~p~~l~~l~~L~~L~L  267 (968)
T PLN00113        191 EFLTLA-SNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN--LTGPIPSSLGNLKNLQYLFL  267 (968)
T ss_pred             Ceeecc-CCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCce--eccccChhHhCCCCCCEEEC
Confidence            555555 333 33445555555555555544444  3444455555555555555543  33344444445555555544


Q ss_pred             ec
Q 044637          215 VN  216 (370)
Q Consensus       215 ~~  216 (370)
                      +.
T Consensus       268 ~~  269 (968)
T PLN00113        268 YQ  269 (968)
T ss_pred             cC
Confidence            43

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 63.4 bits (155), Expect = 2e-11
 Identities = 54/292 (18%), Positives = 102/292 (34%), Gaps = 39/292 (13%)

Query: 59  ENFCKKFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLL--CTLINLQT 116
             +       +                 N    +       +LK    LL   T      
Sbjct: 26  RPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVA 85

Query: 117 LEMPSSYIDHSPEDIWMMLKLMHLNFGSITLPAPPKNNSSTLKNLIFISALHPGSCTPDI 176
           LE+ S  +   P+  + +  L H+             +++ L  L            PD 
Sbjct: 86  LELRSVPLPQFPDQAFRLSHLQHMTI-----------DAAGLMEL------------PDT 122

Query: 177 LGRLPNVQTLRISG-DLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQL-----SRMILSE 230
           + +   ++TL ++   L      +  S+  L++L  L +     + +L     S     E
Sbjct: 123 MQQFAGLETLTLARNPLR----ALPASIASLNRLRELSIRACPELTELPEPLASTDASGE 178

Query: 231 YKFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKIL 290
           ++   +L  L L  T +   P  ++  L +L+ LK++ +  L      +     P+L+ L
Sbjct: 179 HQGLVNLQSLRLEWTGIRSLP-ASIANLQNLKSLKIRNSP-LSALGPAIH--HLPKLEEL 234

Query: 291 HLKSMLWLEEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHW 342
            L+    L  +    G    L+ LIL  C+ L  LP ++  +  L KL+L  
Sbjct: 235 DLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRG 286
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.86
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.61
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.48
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.46
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.22
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.21
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.09
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.95
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.92
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.63
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.61
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.13
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.96  E-value=4e-29  Score=251.64  Aligned_cols=296  Identities=20%  Similarity=0.187  Sum_probs=200.3

Q ss_pred             CCeeeEEEcCCCCcc-cCCcccCCcCCCcEEeeCCCCCc-ccChhhhcCCCCcEEecCCCcCc-cccHHHhccccCcEEE
Q 044637           65 FKHLRVLNLGSAVLD-QYPPGLENFFYLKYLKLNIPSLK-CLPSLLCTLINLQTLEMPSSYID-HSPEDIWMMLKLMHLN  141 (370)
Q Consensus        65 ~~~L~~L~L~~~~~~-~~~~~~~~l~~L~~L~l~~~~~~-~lp~~~~~l~~L~~L~l~~~~~~-~lp~~i~~l~~L~~L~  141 (370)
                      ++.|++|++++|.++ .+|..++.+++|++|++++|.+. .+|..++.+++|++|++++|.+. .+|..++.+++|++|+
T Consensus       393 ~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  472 (768)
T 3rgz_A          393 KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI  472 (768)
T ss_dssp             TCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEE
T ss_pred             cCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEE
Confidence            556777777777766 66677777777777777777776 66777777777777777777543 6677777777777777


Q ss_pred             ccCCcC-CCCCCCCCCCCCCCceeccccCC--CCCccccCCCCCccEEEEecccccchhcHHHhhhccCCCCEEEEec--
Q 044637          142 FGSITL-PAPPKNNSSTLKNLIFISALHPG--SCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVN--  216 (370)
Q Consensus       142 l~~~~~-~~~~~~~l~~l~~L~~L~l~~~~--~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~--  216 (370)
                      ++ +|. .+.+|..++++++|++|++.++.  ...|..++.+++|+.|++++|.  ..+.+|..++.+++|+.|++++  
T Consensus       473 L~-~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~--l~~~~p~~l~~l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          473 LD-FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS--FSGNIPAELGDCRSLIWLDLNTNL  549 (768)
T ss_dssp             CC-SSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC--CEEECCGGGGGCTTCCEEECCSSE
T ss_pred             ec-CCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCc--ccCcCCHHHcCCCCCCEEECCCCc
Confidence            77 555 44667777777777777777666  4667777777778888887775  6667777777777888877765  


Q ss_pred             -CCCcc----c---cce---------------------------------------------------EEE------ecC
Q 044637          217 -EGNMR----Q---LSR---------------------------------------------------MIL------SEY  231 (370)
Q Consensus       217 -~~~~~----~---L~~---------------------------------------------------L~l------~~~  231 (370)
                       .+...    .   +..                                                   -.+      .+.
T Consensus       550 l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~  629 (768)
T 3rgz_A          550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD  629 (768)
T ss_dssp             EESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCS
T ss_pred             cCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhh
Confidence             11100    0   000                                                   000      233


Q ss_pred             CCCCCceEEEEeccCCCCCCcccccCCCCCCeEEeecccccCceeEEecCCCCccccEEEecCCCCCceeEeCCCCCCCc
Q 044637          232 KFPPSLTQLSLSNTELMEDPMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWLEEWTMGAGAMPKL  311 (370)
Q Consensus       232 ~~p~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~i~~~~~~l~~L  311 (370)
                      .+ ++|++|++++|.+.+.+|..++.+++|+.|++++|.+++.. +.. ++.+++|+.|+|+++.--..+|..++.+++|
T Consensus       630 ~l-~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~i-p~~-l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L  706 (768)
T 3rgz_A          630 NN-GSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI-PDE-VGDLRGLNILDLSSNKLDGRIPQAMSALTML  706 (768)
T ss_dssp             SS-BCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCC-CGG-GGGCTTCCEEECCSSCCEECCCGGGGGCCCC
T ss_pred             cc-ccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCC-ChH-HhCCCCCCEEECCCCcccCcCChHHhCCCCC
Confidence            45 67888999999888888888999999999999988888765 444 7788899999999865333788888889999


Q ss_pred             ceEeecCCcccCCCchhcccCCCCcEEEecCCC----HHHHHhhccccCCccccceecccCC
Q 044637          312 ESLILNPCAYLRKLPEELWCIKSLCKLELHWPQ----PELRQRLRAFEDMEWRYGIQLYPSG  369 (370)
Q Consensus       312 ~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~~~----~~l~~~~~~~~~~~~~~~i~~i~~i  369 (370)
                      +.|++++|...+.+|.. +.+.++....+.||+    .-+. .|.. ..+++|++|+|+|.+
T Consensus       707 ~~L~ls~N~l~g~iP~~-~~~~~~~~~~~~gN~~Lcg~~l~-~C~~-~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          707 TEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLP-RCDP-SNADGYAHHQRSHHH  765 (768)
T ss_dssp             SEEECCSSEEEEECCSS-SSGGGSCGGGGCSCTEEESTTSC-CCCS-CC-------------
T ss_pred             CEEECcCCcccccCCCc-hhhccCCHHHhcCCchhcCCCCc-CCCC-CccCCCCCCCCcccc
Confidence            99999999888788864 335555555555554    1122 5666 889999999999875
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.3
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.17
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.06
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.61
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.23
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.31
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=1.5e-21  Score=178.40  Aligned_cols=257  Identities=19%  Similarity=0.203  Sum_probs=140.8

Q ss_pred             cCCeeeEEEcCCCCcccCCcccCCcCCCcEEeeCCCCCcccChhhhcCCCCcEEecCCCcCccccHHHhccccCcEEEcc
Q 044637           64 KFKHLRVLNLGSAVLDQYPPGLENFFYLKYLKLNIPSLKCLPSLLCTLINLQTLEMPSSYIDHSPEDIWMMLKLMHLNFG  143 (370)
Q Consensus        64 ~~~~L~~L~L~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~lp~~i~~l~~L~~L~l~  143 (370)
                      .+.+|++|+++++.++.+ +++..+++|++|++++|+++.+| .++++++|++|++++|.+..++ .++++++|+.|+++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~~~  118 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLTLF  118 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCc-cccCCccccccccccccccccc-cccccccccccccc
Confidence            456778888888877765 45777888888888888888776 3777888888888888776665 36778888888877


Q ss_pred             CCcCCCCCC----------------------------------------------------------------CCCCCCC
Q 044637          144 SITLPAPPK----------------------------------------------------------------NNSSTLK  159 (370)
Q Consensus       144 ~~~~~~~~~----------------------------------------------------------------~~l~~l~  159 (370)
                       ++....++                                                                .....++
T Consensus       119 -~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  197 (384)
T d2omza2         119 -NNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLT  197 (384)
T ss_dssp             -SSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCT
T ss_pred             -cccccccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccccccccccc
Confidence             43211111                                                                1122233


Q ss_pred             CCceeccccCC-CCCccccCCCCCccEEEEecccccchhcHHHhhhccCCCCEEEEecCCCccccceEEEecCCCCCCce
Q 044637          160 NLIFISALHPG-SCTPDILGRLPNVQTLRISGDLSYYHSGVSKSLCQLHKLECLKLVNEGNMRQLSRMILSEYKFPPSLT  238 (370)
Q Consensus       160 ~L~~L~l~~~~-~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~L~~L~l~~~~~p~~L~  238 (370)
                      +++.+.+.++. ..++ ....+++|+.|++.++.   ...+ ..+..+++|+.|++.+..    +..+. .+..+ ++|+
T Consensus       198 ~~~~l~l~~n~i~~~~-~~~~~~~L~~L~l~~n~---l~~~-~~l~~l~~L~~L~l~~n~----l~~~~-~~~~~-~~L~  266 (384)
T d2omza2         198 NLESLIATNNQISDIT-PLGILTNLDELSLNGNQ---LKDI-GTLASLTNLTDLDLANNQ----ISNLA-PLSGL-TKLT  266 (384)
T ss_dssp             TCSEEECCSSCCCCCG-GGGGCTTCCEEECCSSC---CCCC-GGGGGCTTCSEEECCSSC----CCCCG-GGTTC-TTCS
T ss_pred             ccceeeccCCccCCCC-cccccCCCCEEECCCCC---CCCc-chhhcccccchhccccCc----cCCCC-ccccc-ccCC
Confidence            34444433333 2111 13344555566655552   2222 244555666666655410    00000 22333 4455


Q ss_pred             EEEEeccCCCCC--------------------CcccccCCCCCCeEEeecccccCceeEEecCCCCccccEEEecCCCCC
Q 044637          239 QLSLSNTELMED--------------------PMPTLEELPHLEVLKLKQNSYLERKLVCVGCSSFPQLKILHLKSMLWL  298 (370)
Q Consensus       239 ~L~l~~~~~~~~--------------------~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l  298 (370)
                      +|+++++.+.+.                    .+..+..+++++.|++++|.+.+..   . +..+++|++|++++| .+
T Consensus       267 ~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l~---~-l~~l~~L~~L~L~~n-~l  341 (384)
T d2omza2         267 ELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDIS---P-VSSLTKLQRLFFANN-KV  341 (384)
T ss_dssp             EEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCCG---G-GGGCTTCCEEECCSS-CC
T ss_pred             EeeccCcccCCCCccccccccccccccccccccccccchhcccCeEECCCCCCCCCc---c-cccCCCCCEEECCCC-CC
Confidence            555554443221                    1223445566666666666554422   1 345666666666664 45


Q ss_pred             ceeEeCCCCCCCcceEeecCCcccCCCchhcccCCCCcEEEecCC
Q 044637          299 EEWTMGAGAMPKLESLILNPCAYLRKLPEELWCIKSLCKLELHWP  343 (370)
Q Consensus       299 ~~i~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~~  343 (370)
                      +.++ .++.+++|+.|++++|.. ..++. +.++++|+.|+++++
T Consensus       342 ~~l~-~l~~l~~L~~L~l~~N~l-~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         342 SDVS-SLANLTNINWLSAGHNQI-SDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCCG-GGGGCTTCCEEECCSSCC-CBCGG-GTTCTTCSEEECCCE
T ss_pred             CCCh-hHcCCCCCCEEECCCCcC-CCChh-hccCCCCCEeeCCCC
Confidence            5554 355666666666666653 33332 556666666666654
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure