Citrus Sinensis ID: 044676

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
KQREMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFKT
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccHHHHHHHcccccccEEEEEcccccccccccccEEEEEEccccccccccccc
cHHHHHHHHHHEEcccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHccccccEEEEEccccccccccccccEEEEEEHHHHHHHcccccc
kqremethsdsapmnggngahsysknsfYQKQFADLVKDKIVEVISAKLdvkslcsvssvpftladlgcsvgpnTVIAMQNFMEAIKLkyqdqgpahsqilpqfQVFFNDQVLNDFNTLFRYLPQDRQYFAagvagsfycrlfpessihfvYSSTALHWLSRVFKT
kqremethsdsapmnggnGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFKT
KQREMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFKT
**************************SFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVF**
***********APMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKL**************QFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRV***
**************NGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFKT
KQREMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KQREMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q9FKR0 361 Probable S-adenosylmethio no no 0.951 0.437 0.469 4e-33
Q9FKD0 362 Probable S-adenosylmethio no no 0.957 0.439 0.450 2e-31
Q9LS10 359 Probable S-adenosylmethio no no 0.945 0.437 0.434 3e-30
Q9FKC8 362 Probable S-adenosylmethio no no 0.957 0.439 0.450 4e-30
Q9SPV4 359 Salicylate O-methyltransf N/A no 0.861 0.398 0.389 2e-24
Q8H0D2 384 3,7-dimethylxanthine N-me N/A no 0.855 0.369 0.357 9e-22
Q9FLN8 386 Indole-3-acetate O-methyl no no 0.849 0.365 0.395 3e-21
Q8H0G0 384 Theobromine synthase 2 OS N/A no 0.855 0.369 0.357 4e-21
Q0J998 404 Indole-3-acetate O-methyl yes no 0.855 0.351 0.377 7e-21
A4GE70 384 3,7-dimethylxanthine N-me N/A no 0.855 0.369 0.357 3e-20
>sp|Q9FKR0|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1 Back     alignment and function desciption
 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/162 (46%), Positives = 103/162 (63%), Gaps = 4/162 (2%)

Query: 5   METHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTL 64
           M T S S PM+GG+  HSY  NS YQK   D V++K  + I   LD+ ++    S  FT+
Sbjct: 1   MSTSSQSYPMSGGDDQHSYIHNSSYQKAGIDGVQEKARQYILENLDLLNMNPNLST-FTI 59

Query: 65  ADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILP-QFQVFFNDQVLNDFNTLFRYL 123
           AD GCS+GPNT  A+QN ++ +KLK+  +    S++ P +FQV+FND   NDFNTLFR  
Sbjct: 60  ADFGCSIGPNTFHAVQNIIDIVKLKHLKESQEDSRVAPLEFQVYFNDLPNNDFNTLFRTQ 119

Query: 124 P--QDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRV 163
           P    ++YF+ GV GSFY R+ P +SIH   +S   HWLS+V
Sbjct: 120 PPSSKQEYFSVGVPGSFYGRVLPRNSIHIGNTSFTTHWLSKV 161

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FKD0|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1 Back     alignment and function description
>sp|Q9LS10|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKC8|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2 Back     alignment and function description
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLN8|IAMT1_ARATH Indole-3-acetate O-methyltransferase 1 OS=Arabidopsis thaliana GN=IAMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0G0|CTS2_COFAR Theobromine synthase 2 OS=Coffea arabica GN=CTS2 PE=1 SV=1 Back     alignment and function description
>sp|Q0J998|IAMT1_ORYSJ Indole-3-acetate O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=IAMT1 PE=1 SV=1 Back     alignment and function description
>sp|A4GE70|DXMT1_COFCA 3,7-dimethylxanthine N-methyltransferase OS=Coffea canephora GN=DXMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
224111418 357 predicted protein [Populus trichocarpa] 0.885 0.411 0.613 5e-48
225424403 353 PREDICTED: probable S-adenosylmethionine 0.891 0.419 0.607 2e-45
225424399 360 PREDICTED: probable S-adenosylmethionine 0.915 0.422 0.605 2e-45
225424405 361 PREDICTED: probable S-adenosylmethionine 0.915 0.421 0.605 2e-45
297737616 402 unnamed protein product [Vitis vinifera] 0.915 0.378 0.592 7e-45
224101907 359 predicted protein [Populus trichocarpa] 0.933 0.431 0.575 8e-45
225466372 353 PREDICTED: probable S-adenosylmethionine 0.891 0.419 0.601 1e-44
297737614 347 unnamed protein product [Vitis vinifera] 0.873 0.417 0.613 3e-44
297737617 347 unnamed protein product [Vitis vinifera] 0.873 0.417 0.613 4e-44
225424401 353 PREDICTED: probable S-adenosylmethionine 0.873 0.410 0.613 4e-44
>gi|224111418|ref|XP_002315848.1| predicted protein [Populus trichocarpa] gi|222864888|gb|EEF02019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (76%), Gaps = 3/150 (2%)

Query: 14  MNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGP 73
           MNGGNG +SY+KNS  Q++ A+ V++KI E I+ KLD+++LCS S   F +AD GCS GP
Sbjct: 5   MNGGNGTYSYAKNSTLQRKSANAVREKIDEAIAEKLDMETLCS-SGKSFHIADFGCSTGP 63

Query: 74  NTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQYFAAG 133
           NT IAMQN +E+++ KY+ Q P     +P+FQ FFNDQ  NDFNTLF  LP DRQYF AG
Sbjct: 64  NTFIAMQNILESVERKYKSQCPTRQ--IPEFQAFFNDQASNDFNTLFTTLPLDRQYFVAG 121

Query: 134 VAGSFYCRLFPESSIHFVYSSTALHWLSRV 163
           V GSF+ RLFP+SS+HF YSSTALHWLS+V
Sbjct: 122 VPGSFHGRLFPDSSLHFAYSSTALHWLSKV 151

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225424403|ref|XP_002281406.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi|297737615|emb|CBI26816.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424399|ref|XP_002281366.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi|297737618|emb|CBI26819.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424405|ref|XP_002284898.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737616|emb|CBI26817.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101907|ref|XP_002312470.1| predicted protein [Populus trichocarpa] gi|222852290|gb|EEE89837.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225466372|ref|XP_002276659.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737614|emb|CBI26815.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737617|emb|CBI26818.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424401|ref|XP_002281378.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
TAIR|locus:2200186 363 AT1G68040 [Arabidopsis thalian 0.951 0.435 0.469 1.1e-34
TAIR|locus:2166640 361 AT5G38780 [Arabidopsis thalian 0.951 0.437 0.469 5.2e-33
TAIR|locus:504956193 351 AT1G15125 [Arabidopsis thalian 0.861 0.407 0.493 2.3e-30
TAIR|locus:2144461 359 AT5G38100 [Arabidopsis thalian 0.945 0.437 0.434 3e-30
TAIR|locus:2033409 353 PXMT1 [Arabidopsis thaliana (t 0.873 0.410 0.451 2.7e-29
TAIR|locus:2082117 379 AT3G44870 "AT3G44870" [Arabido 0.885 0.387 0.445 1.5e-28
TAIR|locus:2082157 348 AT3G44840 [Arabidopsis thalian 0.903 0.431 0.452 1.9e-28
TAIR|locus:2082112 348 FAMT "farnesoic acid carboxyl- 0.903 0.431 0.445 1.9e-28
TAIR|locus:2033414 353 AT1G66690 "AT1G66690" [Arabido 0.891 0.419 0.434 2.4e-28
TAIR|locus:2033389 352 AT1G66720 [Arabidopsis thalian 0.891 0.420 0.421 6.6e-26
TAIR|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 376 (137.4 bits), Expect = 1.1e-34, P = 1.1e-34
 Identities = 76/162 (46%), Positives = 105/162 (64%)

Query:     4 EMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFT 63
             ++E   +S PM+GG+G +SYSKNS  Q++   L+K+KI +++  KL+ K+L S  S  F 
Sbjct:     3 KVEIVRNSLPMSGGDGPNSYSKNSHLQRKTTSLLKEKIDKLVLEKLNAKTLISSDSNTFR 62

Query:    64 LADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYL 123
             +ADLGC+ GPNT   + N +++I+   +    +     P+F VFFND   NDFNTLF  L
Sbjct:    63 IADLGCATGPNTFFLVDNIIKSIETSLRKSNSSK----PEFLVFFNDLPQNDFNTLFTSL 118

Query:   124 PQDRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFK 165
             PQDR Y A GV GSFY R+ P+SS+H V +  A HWLS V K
Sbjct:   119 PQDRSYLAVGVPGSFYGRVLPQSSVHIVVTMGATHWLSSVPK 160
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS
TAIR|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033409 PXMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082117 AT3G44870 "AT3G44870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082157 AT3G44840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082112 FAMT "farnesoic acid carboxyl-O-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033414 AT1G66690 "AT1G66690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033389 AT1G66720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.6373.1
hypothetical protein (357 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
pfam03492 331 pfam03492, Methyltransf_7, SAM dependent carboxyl 3e-47
PLN02668 386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 6e-33
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information 
 Score =  155 bits (395), Expect = 3e-47
 Identities = 62/127 (48%), Positives = 81/127 (63%), Gaps = 11/127 (8%)

Query: 41  IVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQI 100
           + E IS  L    L ++      +ADLGCS GPNT +A+ N ++ ++ KYQ +       
Sbjct: 1   LEEAISELL----LRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEP-- 54

Query: 101 LPQFQVFFNDQVLNDFNTLFRYLPQ----DRQYFAAGVAGSFYCRLFPESSIHFVYSSTA 156
            P+FQVFFND   NDFNTLF+ LP      R YF +GV GSFY RLFP +S+HFV+SS +
Sbjct: 55  -PEFQVFFNDLPSNDFNTLFKLLPPFQKKKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYS 113

Query: 157 LHWLSRV 163
           LHWLS+V
Sbjct: 114 LHWLSQV 120

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331
>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
PLN02668 386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 97.61
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 96.87
PRK10258 251 biotin biosynthesis protein BioC; Provisional 96.84
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 96.38
PRK06202232 hypothetical protein; Provisional 96.37
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 95.93
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.71
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.5
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.34
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 95.31
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 94.84
PRK11207197 tellurite resistance protein TehB; Provisional 94.45
KOG2940 325 consensus Predicted methyltransferase [General fun 94.23
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.22
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 93.88
PRK12335287 tellurite resistance protein TehB; Provisional 93.48
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 93.24
PRK06922 677 hypothetical protein; Provisional 93.11
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 92.95
PRK05785226 hypothetical protein; Provisional 92.81
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 92.58
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 92.28
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 92.21
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 92.15
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 91.5
PLN02244 340 tocopherol O-methyltransferase 91.5
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 91.45
TIGR00740239 methyltransferase, putative. A simple BLAST search 91.45
PRK08317 241 hypothetical protein; Provisional 91.29
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 90.98
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 90.96
PLN02490 340 MPBQ/MSBQ methyltransferase 90.82
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 90.73
PLN02233261 ubiquinone biosynthesis methyltransferase 90.44
TIGR03438 301 probable methyltransferase. This model represents 90.02
PLN02336 475 phosphoethanolamine N-methyltransferase 89.69
PLN02336 475 phosphoethanolamine N-methyltransferase 89.58
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 89.51
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 89.16
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 89.11
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 88.78
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 88.66
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 86.88
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 86.57
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 86.04
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 85.78
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 85.48
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 85.34
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 84.78
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 84.58
PHA03412241 putative methyltransferase; Provisional 84.26
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 83.29
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 82.92
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 81.36
KOG3010 261 consensus Methyltransferase [General function pred 80.02
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=1.5e-57  Score=400.48  Aligned_cols=154  Identities=42%  Similarity=0.661  Sum_probs=138.4

Q ss_pred             cccccCccccccCCCCCCchHHhhHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCceEEEeecCCCCcccHHHHHHHH
Q 044676            4 EMETHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFM   83 (166)
Q Consensus         4 ~~~~~~~~~~M~gg~G~~sY~~nS~~Q~~~i~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IADlGCS~G~Nsl~~~~~ii   83 (166)
                      ||+ +++++||+||+|++||++||.+|++++..++|+|++||+++.. . .  ...++++|||||||+|+||+.+|++||
T Consensus        12 ~m~-~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~-~-~--~p~~~~~iaDlGcs~G~ntl~~vs~iI   86 (386)
T PLN02668         12 NMK-LEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHL-N-S--SPEVPFTAVDLGCSSGSNTIHIIDVIV   86 (386)
T ss_pred             cce-eccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhcc-c-c--CCCcceeEEEecCCCCccHHHHHHHHH
Confidence            577 5789999999999999999999999999999999999988642 1 1  023689999999999999999999999


Q ss_pred             HHHHHHHhhcCCCCCCCCCceEEEecCCCCCchHHHhhhCCCC----------------CccEEeeecccccccccCCCc
Q 044676           84 EAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQD----------------RQYFAAGVAGSFYCRLFPESS  147 (166)
Q Consensus        84 ~~i~~~~~~~~~~~~~~~~eiqv~~nDLP~NDFntLF~~L~~~----------------~~~f~~gvpgSFY~rlfP~~S  147 (166)
                      ++|+++|.+.+..    +|||||||||||+||||+||++||++                ++||++|||||||+||||++|
T Consensus        87 ~~i~~~~~~~~~~----~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~S  162 (386)
T PLN02668         87 KHMSKRYESAGLD----PPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARS  162 (386)
T ss_pred             HHHHHHhhhcCCC----CCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCc
Confidence            9999999865433    78999999999999999999999853                249999999999999999999


Q ss_pred             eeEEEecccccccccCCCC
Q 044676          148 IHFVYSSTALHWLSRVFKT  166 (166)
Q Consensus       148 vh~~~Ss~alHWLS~vP~~  166 (166)
                      |||+||+||||||||+|++
T Consensus       163 lh~~~Ss~slHWLS~vP~~  181 (386)
T PLN02668        163 IDVFHSAFSLHWLSQVPES  181 (386)
T ss_pred             eEEEEeeccceecccCchh
Confidence            9999999999999999984

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1m6e_X 359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 2e-25
3b5i_A 374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 6e-23
2efj_A 384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 2e-21
2eg5_A 372 The Structure Of Xanthosine Methyltransferase Lengt 3e-21
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 88/154 (57%), Gaps = 11/154 (7%)
Query: 14  MNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGP 73
           M GG G +SY+ NSF Q+Q   + K      I+A     ++    +    +ADLGCS GP
Sbjct: 9   MKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTV----TTRLAIADLGCSSGP 64
Query: 74  NTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLP----QDRQY 129
           N + A+   ++ ++   +  G  +S   P++Q+F ND   NDFN +FR LP     D   
Sbjct: 65  NALFAVTELIKTVEELRKKMGRENS---PEYQIFLNDLPGNDFNAIFRSLPIENDVDGVC 121
Query: 130 FAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRV 163
           F  GV GSFY RLFP +++HF++SS +L WLS+V
Sbjct: 122 FINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQV 155
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 9e-43
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 2e-40
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 3e-40
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
 Score =  144 bits (365), Expect = 9e-43
 Identities = 66/176 (37%), Positives = 87/176 (49%), Gaps = 23/176 (13%)

Query: 5   METHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTL 64
           M+       M GG G  SY+ NS  Q   A  +   + E +    +V    S S  PFT 
Sbjct: 1   MKLERL-LSMKGGKGQDSYANNSLAQAMHARSMLHLLEETLE---NVHLNSSASPPPFTA 56

Query: 65  ADLGCSVGPNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLP 124
            DLGCS G NTV  +   ++ I  ++     A     P+F  FF+D   NDFNTLF+ LP
Sbjct: 57  VDLGCSSGANTVHIIDFIVKHISKRFD----AAGIDPPEFTAFFSDLPSNDFNTLFQLLP 112

Query: 125 Q---------------DRQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRVFK 165
                           +R YF AGV GSFY RLFP  +I F +S+ +LHWLS+V +
Sbjct: 113 PLVSNTCMEECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPE 168
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 96.75
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 96.71
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 96.4
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 96.03
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 95.97
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 95.87
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 95.8
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 95.69
3ege_A 261 Putative methyltransferase from antibiotic biosyn 95.67
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 95.64
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 95.47
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 95.43
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 95.4
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 95.39
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.38
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.07
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 94.71
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 94.61
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 94.38
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 94.29
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 94.25
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 94.25
1xxl_A 239 YCGJ protein; structural genomics, protein structu 94.23
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 94.1
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 94.09
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 94.08
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 94.02
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 93.88
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 93.81
2p7i_A 250 Hypothetical protein; putative methyltransferase, 93.8
3lcc_A235 Putative methyl chloride transferase; halide methy 93.8
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 93.71
3f4k_A 257 Putative methyltransferase; structural genomics, P 93.62
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 93.62
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 93.61
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 93.6
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 93.59
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 93.47
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 93.44
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 93.32
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 93.32
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 93.3
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 93.29
3hnr_A220 Probable methyltransferase BT9727_4108; structural 93.28
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 93.22
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 93.2
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 93.13
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 93.06
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 92.97
3m70_A286 Tellurite resistance protein TEHB homolog; structu 92.9
1vlm_A219 SAM-dependent methyltransferase; possible histamin 92.86
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 92.84
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 92.74
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 92.54
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.46
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 92.43
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 92.41
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 92.36
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 92.3
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 92.04
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 91.89
3cc8_A 230 Putative methyltransferase; structural genomics, j 91.87
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 91.61
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 91.53
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 91.52
2r3s_A335 Uncharacterized protein; methyltransferase domain, 91.5
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 91.46
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 91.41
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 91.4
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 91.37
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 91.27
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 91.11
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 90.99
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 90.91
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 90.83
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 90.68
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 90.57
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 90.38
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 90.38
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 90.2
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 90.16
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 90.15
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 90.13
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 90.1
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 89.65
3dp7_A363 SAM-dependent methyltransferase; structural genomi 89.61
3i9f_A170 Putative type 11 methyltransferase; structural gen 89.59
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 89.51
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 89.39
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 89.29
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 89.13
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 88.83
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 88.53
1wzn_A252 SAM-dependent methyltransferase; structural genomi 88.35
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 88.29
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 88.16
3ocj_A305 Putative exported protein; structural genomics, PS 87.79
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 87.72
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 87.67
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 87.51
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 87.49
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 87.15
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 86.48
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 86.47
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 85.8
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 85.3
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 85.03
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 84.61
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 84.36
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 84.11
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 83.6
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 83.55
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 83.39
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 83.35
1jsx_A207 Glucose-inhibited division protein B; methyltransf 81.84
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 81.65
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
Probab=100.00  E-value=1.1e-57  Score=397.22  Aligned_cols=151  Identities=38%  Similarity=0.658  Sum_probs=138.0

Q ss_pred             cCccccccCCCCCCchHHhhHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCceEEEeecCCCCcccHHHHHHHHHHHH
Q 044676            8 HSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFMEAIK   87 (166)
Q Consensus         8 ~~~~~~M~gg~G~~sY~~nS~~Q~~~i~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IADlGCS~G~Nsl~~~~~ii~~i~   87 (166)
                      +++++||+||+|++||++||.+|++++..++|++++||++++..  .  ..+++++|||||||+|+||+.+++.||++|+
T Consensus         3 ~~~~~~m~gg~G~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~--~--~~~~~~~IaDlGCs~G~Nt~~~v~~ii~~i~   78 (359)
T 1m6e_X            3 VRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSG--D--TVTTRLAIADLGCSSGPNALFAVTELIKTVE   78 (359)
T ss_dssp             CHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSS--S--SSSSEECCEEESCCSSTTTTTGGGTTHHHHH
T ss_pred             cccccccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhc--c--CCCCceEEEecCCCCCcchHHHHHHHHHHHH
Confidence            56799999999999999999999999999999999999997642  1  0467899999999999999999999999999


Q ss_pred             HHHhhcCC-CCCCCCCceEEEecCCCCCchHHHhhhCCCC----CccEEeeecccccccccCCCceeEEEeccccccccc
Q 044676           88 LKYQDQGP-AHSQILPQFQVFFNDQVLNDFNTLFRYLPQD----RQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSR  162 (166)
Q Consensus        88 ~~~~~~~~-~~~~~~~eiqv~~nDLP~NDFntLF~~L~~~----~~~f~~gvpgSFY~rlfP~~Svh~~~Ss~alHWLS~  162 (166)
                      ++|.+.++ +    +|||||||||||+||||+||++|+.+    ++||++|||||||+||||++|+||+||++||||||+
T Consensus        79 ~~~~~~~~~~----~pe~~v~~nDLp~NDFntlF~~L~~~~~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~  154 (359)
T 1m6e_X           79 ELRKKMGREN----SPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQ  154 (359)
T ss_dssp             HHHHSSSCSS----CCEEEEEEEECTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSS
T ss_pred             HHHHhcCCCC----CCceEEEecCCCchHHHHHHHhcchhcccCCCEEEEecchhhhhccCCCCceEEEEehhhhhhccc
Confidence            99976553 3    68999999999999999999999862    579999999999999999999999999999999999


Q ss_pred             CCCC
Q 044676          163 VFKT  166 (166)
Q Consensus       163 vP~~  166 (166)
                      +|++
T Consensus       155 ~p~~  158 (359)
T 1m6e_X          155 VPIG  158 (359)
T ss_dssp             CCSC
T ss_pred             Cchh
Confidence            9963
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d1m6ex_ 359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 1e-51
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  166 bits (422), Expect = 1e-51
 Identities = 59/155 (38%), Positives = 88/155 (56%), Gaps = 11/155 (7%)

Query: 13  PMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVG 72
            M GG G +SY+ NSF Q+Q   + K      I+A     ++ +       +ADLGCS G
Sbjct: 8   HMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTT----RLAIADLGCSSG 63

Query: 73  PNTVIAMQNFMEAIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQDRQ---- 128
           PN + A+   ++ ++   +  G  +S   P++Q+F ND   NDFN +FR LP +      
Sbjct: 64  PNALFAVTELIKTVEELRKKMGRENS---PEYQIFLNDLPGNDFNAIFRSLPIENDVDGV 120

Query: 129 YFAAGVAGSFYCRLFPESSIHFVYSSTALHWLSRV 163
            F  GV GSFY RLFP +++HF++SS +L WLS+V
Sbjct: 121 CFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQV 155

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 97.43
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.98
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.69
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.42
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.12
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.07
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.97
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.89
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 95.58
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 95.42
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.4
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 95.4
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.23
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 95.18
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 94.88
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 94.78
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.52
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 94.13
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 93.86
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 92.9
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 92.48
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 92.04
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 91.55
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 91.3
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 91.15
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 91.0
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 90.69
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 90.51
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 89.69
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 89.02
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 88.6
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 88.24
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 83.71
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 82.73
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=7.2e-64  Score=434.17  Aligned_cols=154  Identities=38%  Similarity=0.664  Sum_probs=140.4

Q ss_pred             ccccCccccccCCCCCCchHHhhHHHHHHHHHHHHHHHHHHHhhhcccccCCCCCCceEEEeecCCCCcccHHHHHHHHH
Q 044676            5 METHSDSAPMNGGNGAHSYSKNSFYQKQFADLVKDKIVEVISAKLDVKSLCSVSSVPFTLADLGCSVGPNTVIAMQNFME   84 (166)
Q Consensus         5 ~~~~~~~~~M~gg~G~~sY~~nS~~Q~~~i~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IADlGCS~G~Nsl~~~~~ii~   84 (166)
                      |+ ++++|||+||+|++||++||.+|+++|++++|+|++||+++++..    ..+++|+|||||||+|+||+.+|++||+
T Consensus         1 m~-~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~----~~~~~~~IADlGCS~G~Ntl~~v~~iI~   75 (359)
T d1m6ex_           1 MD-VRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGD----TVTTRLAIADLGCSSGPNALFAVTELIK   75 (359)
T ss_dssp             CC-CHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSS----SSSSEECCEEESCCSSTTTTTGGGTTHH
T ss_pred             CC-ccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCC----CCCCceEEEEeCCCCCccHHHHHHHHHH
Confidence            45 588999999999999999999999999999999999999977531    1467899999999999999999999999


Q ss_pred             HHHHHHhhcCCCCCCCCCceEEEecCCCCCchHHHhhhCCCC----CccEEeeecccccccccCCCceeEEEeccccccc
Q 044676           85 AIKLKYQDQGPAHSQILPQFQVFFNDQVLNDFNTLFRYLPQD----RQYFAAGVAGSFYCRLFPESSIHFVYSSTALHWL  160 (166)
Q Consensus        85 ~i~~~~~~~~~~~~~~~~eiqv~~nDLP~NDFntLF~~L~~~----~~~f~~gvpgSFY~rlfP~~Svh~~~Ss~alHWL  160 (166)
                      +|+++|++.+..   .+|||||||||||+||||+||++||..    ++||++|||||||+||||++||||+||+||||||
T Consensus        76 ~i~~~~~~~~~~---~~pe~qvf~nDLP~NDFNtLF~~L~~~~~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWL  152 (359)
T d1m6ex_          76 TVEELRKKMGRE---NSPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWL  152 (359)
T ss_dssp             HHHHHHHSSSCS---SCCEEEEEEEECTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBC
T ss_pred             HHHHHHHhcCCC---CCCeEEEEeCCCCcchHHHHHHhccccccCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhh
Confidence            999999876432   168999999999999999999999874    4699999999999999999999999999999999


Q ss_pred             ccCCCC
Q 044676          161 SRVFKT  166 (166)
Q Consensus       161 S~vP~~  166 (166)
                      ||+|++
T Consensus       153 S~vP~~  158 (359)
T d1m6ex_         153 SQVPIG  158 (359)
T ss_dssp             SSCCSC
T ss_pred             hcCCcc
Confidence            999975
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure