Citrus Sinensis ID: 044755

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------108

MAEMIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREEAGRFDRISYRTIPEEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKNREAQGMHETCSNKISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSFCKSSEEDKPDIPARQPLFLLEKV

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEEEccHHHHHHHccccEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccHHHHHHccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccEEcccccEEEEcHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEEEEccccccccccccccccEEEEEccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccccccccccccccccccccEEEcccccccHHHHccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEcccccccccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccc

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEccccHccHHHHcccccccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHccccccccccHHHEEcHcccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEEccccccHcccccccccccEEEEEcccccccccccccHHcccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccHHcccccccEEEEcccccccccccHHcccccccEEEEEEcccccccccccccccHHHHHHHHcccccccEEEEEccccccccccccHcccccccEEccccccccccccHHHcccccccHcccEccccccccccccccccHHHHHHHHccccccHcccccccEEEEcccccccccccccccccccccccEEEEcccHcHHHcccccccccccccEEEEEccccccccccccccccccccccccccccccEEEEcccccHccccccccccccccccccccEEEEccccccccccHHHcccccccccccEEEccccccccccccccccccccccccccEEEEcccccHHcccccHHHcccccccEEEEcccccHcEcccHcccccccccccccccccEEEEcccccHccccccccccccccccEEEEccccccccccHHHHHHHHHHHcccccccccccEEEEccc

MAEMIFSLVLEVVKclappterrvgyLRDYNANFENLRAEIEKLKEESTSIQRRVSEAerngenieEKVERWVVSVKKIIDEAAKFIQDEETATNkrclkglcpnfktryQLSKKAETEVKAAIVELREEagrfdrisyrtipeEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKILIILDNIWkcvdleavgipfgddhkGCKLLLTARDRnvlfrmgsqknfsiDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQElrmpsevnfegvpaeaySTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSClllegdsnqqlsmHDVIRDVAISIACRDQHAVLVRnedvwewpddialkecyaislrgcsihelpeglECLRleflhinpkdsffeinnpcnfftgmrklRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEElghltklrqldlsncfklkviapnVISRLVRLEELYMSncfvewddegpnseRINARLDelmhlprlttlevhvkndnvlpegffARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKhlhvqnnpdfmcivdskervplddafpileslnlynLIKLERICQDrlsvqsfnELKTIRVELCDQLSNIFLLSAakclprleRIAVINCRNIqeifvvdgeydaidhqkieFSQLRTlclgslpeltsfCCEVKknreaqgmhetcsnkissfEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTrlilskcpklkYIFSAsmlgsfehLQHLEICHCKGLQEIiskegaddqvlpnfvfpqvtslrlsglpelkclypgmhtsewpalkllkvsdcdqvtvFDSELFSFcksseedkpdiparqplfllekv

MAEMIFSLVLEVVKClappterrvgylrDYNANFENLRAEIeklkeestsiqrrvseaerngenieekverWVVSVKKIIDEAAKfiqdeetatnkrclkglcpnfktryqlskkaeTEVKAAIVELreeagrfdrisyrtipeeiwlkSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKlglvleeetgsrrasrlyerlKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARdrnvlfrmgsqknfsidILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCfvewddegpNSERINARLDELMHLPRlttlevhvkndnVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLkhlhvqnnPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKNreaqgmhetcsnKISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSfcksseedkpdiparqplfllekv

MAEMIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREEAGRFDRISYRTIPEEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQllllpssidllvnlQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKNREAQGMHETCSNKISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSFCKSSEEDKPDIPARQPLFLLEKV

***MIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRA****************************KVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREEAGRFDRISYRTIPEEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEE********RLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGP**ERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKN*********C**KISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSFC**********************

MAEMIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVE***********************************CALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLG**************LYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPS**NFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKV********LVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVV***********IEFSQLRTLCLGSLPELTSFCCEVKK*********T*S**ISS***************VVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKE********NFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFD****************IPARQPLFLLEKV

MAEMIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREEAGRF********************EAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKNREAQGMHETCSNKISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSFCKSSEEDKPDIPARQPLFLLEK*

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEMIFSLVLEVVKCLAPPTERRVGYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREEAGRFDRISYRTIPEEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGNSICTSYLFQCCMGLGILQKxxxxxxxxxxxxxxxxxxxxxCLLLEGDSNQQLSMHDVIRDVAISIACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQKIEFSQLRTLCLGSLPELTSFCCEVKKNREAQGMHETCSNKISSFEDKLDISSALFNEKVVLSNLEVLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEICHCKGLQEIISKEGADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVSDCDQVTVFDSELFSFCKSSEEDKPDIPARQPLFLLEKV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1079	2.2.26 [Sep-21-2011]
Q9T048		985	Disease resistance protei	yes	no	0.776	0.850	0.269	3e-72
Q42484		909	Disease resistance protei	no	no	0.659	0.783	0.288	3e-65
O81825		919	Probable disease resistan	no	no	0.638	0.749	0.288	7e-63
O64973		889	Disease resistance protei	no	no	0.708	0.859	0.275	2e-55
O22727		967	Probable disease resistan	no	no	0.529	0.590	0.297	1e-52
O64789		925	Probable disease resistan	no	no	0.520	0.607	0.298	6e-52
Q8RXS5		888	Probable disease resistan	no	no	0.417	0.506	0.306	5e-51
Q940K0		889	Probable disease resistan	no	no	0.521	0.633	0.297	1e-50
Q9C8K0		854	Probable disease resistan	no	no	0.658	0.832	0.263	3e-50
Q8L3R3		885	Disease resistance protei	no	no	0.545	0.665	0.273	7e-48

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function desciption

 Score =  274 bits (701), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 250/928 (26%), Positives = 445/928 (47%), Gaps = 90/928 (9%)

Query: 11  EVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVE 70
           E+++ +   T  RV     + +N + L   +E+L E   ++           + +  K+ 
Sbjct: 10  EILRLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLM 69

Query: 71  RWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREE 130
           RW    +++I +A   ++ EE  +   C   L P    +     K   EVK     L ++
Sbjct: 70  RWQREAEEVISKAR--LKLEERVS---CGMSLRPRMSRKLV---KILDEVKM----LEKD 117

Query: 131 AGRF-DRISYRTIPEEIWLKSRKGYEAFESRLCA--LKSVQNALTDVNVSIVGVYGMGGI 187
              F D +S  + PE +  +   G       + +  L  +++ LT      +GV+GMGG+
Sbjct: 118 GIEFVDMLSVESTPERV--EHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGV 175

Query: 188 GKTTLVKEVARQARED---KLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLE-EETGSRR 243
           GKTTLV+ +  + RE+   + F LV+F  VS+  D +++Q++IAE+L +  + EE+  + 
Sbjct: 176 GKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKL 235

Query: 244 ASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQK 303
           A R+Y  L KE K L+ILD++WK +DL+ +GIP  +++KG K++LT+R   V   M +  
Sbjct: 236 ARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDL 295

Query: 304 NFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRN-KSV 362
           +  +D L EE+AW LF   A D V +  ++  A  V+Q C GLP+A+ T+  A+R  K+V
Sbjct: 296 DVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNV 355

Query: 363 PEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGN--SICTS 420
             W   L +L   S    + +  + +  ++LS+  L+ ++ K  F+LC+L     SI  +
Sbjct: 356 KLWNHVLSKLS-KSVPWIKSIEEKIFQPLKLSYDFLE-DKAKFCFLLCALFPEDYSIEVT 413

Query: 421 YLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISI 480
            + +  M  G +++    ED+ N+    V  L+D CLL +GD    + MHDV+RD AI I
Sbjct: 414 EVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWI 473

Query: 481 ACR---DQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLE--CLRLEFLHIN 535
                 D H++++    + +   D        +SL    +  LP+ +E  C++   L + 
Sbjct: 474 MSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLL- 532

Query: 536 PKDSFFEINNPCNFFTGMRKLRVVDFTRMQLLLLPS-SIDLLVNLQTLCLVECM-LDDIA 593
            + +F     P  F      LR+++ +  ++   PS S+  L +L +L L +C  L  + 
Sbjct: 533 -QGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLP 591

Query: 594 IIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELY 653
            +  L  LE+L   G+ I+  P  L  L + R LDLS    L+ I   V+SRL  LE L 
Sbjct: 592 SLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLD 651

Query: 654 MSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVL--PEGFFARKLERFK- 710
           M++    W  +G  +++  A ++E+  L RL  L + + +   L      + ++L++F+ 
Sbjct: 652 MTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQL 710

Query: 711 ------------------ISKLQG--------IKDVEYLCLDKSQDVKNVLFDL--DREG 742
                             IS L          +     L L+  Q ++ ++  L  D +G
Sbjct: 711 VVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKG 770

Query: 743 FSRLKHLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLI-KLERICQDRLSVQSFN 801
           F  LK L ++N      I+++   V +       +S ++ +L+  LE +   R+ +++F+
Sbjct: 771 FKNLKSLTIEN-----VIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFS 825

Query: 802 ELKT-----------IRVELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEY 850
           EL+T           I + +C +L  +        +P LE I +  C ++Q +      +
Sbjct: 826 ELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNL------H 879

Query: 851 DAIDHQKIEFSQLRTLCLGSLPELTSFC 878
           +A+ + +     LR L L +LP L S C
Sbjct: 880 EALLYHQPFVPNLRVLKLRNLPNLVSIC 907

Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q42484\|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1	Back alignment and function description

>sp\|O81825\|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1	Back alignment and function description

>sp\|O64973\|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2	Back alignment and function description

>sp\|O22727\|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1	Back alignment and function description

>sp\|O64789\|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1	Back alignment and function description

>sp\|Q8RXS5\|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2	Back alignment and function description

>sp\|Q940K0\|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2	Back alignment and function description

>sp\|Q9C8K0\|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2	Back alignment and function description

>sp\|Q8L3R3\|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1079
224111296		1315	cc-nbs-lrr resistance protein [Populus t	0.969	0.795	0.421	0.0
224111284		1340	cc-nbs-lrr resistance protein [Populus t	0.953	0.767	0.428	0.0
224083434		1144	cc-nbs-lrr resistance protein [Populus t	0.962	0.907	0.418	0.0
224143316		1337	cc-nbs-lrr resistance protein [Populus t	0.966	0.780	0.419	0.0
255563252		1603	Disease resistance protein RPS5, putativ	0.978	0.658	0.417	0.0
359488027		1520	PREDICTED: disease resistance protein At	0.932	0.661	0.393	0.0
255574526		1232	Disease resistance protein RFL1, putativ	0.924	0.810	0.406	0.0
224125154		949	cc-nbs-lrr resistance protein [Populus t	0.835	0.950	0.425	0.0
358344903		2248	Cc-nbs-lrr resistance protein [Medicago	0.942	0.452	0.388	0.0
147865073		1694	hypothetical protein VITISV_021876 [Viti	0.943	0.600	0.384	0.0

>gi\|224111296\|ref\|XP_002332952.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834264\|gb\|EEE72741.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1105 (42%), Positives = 683/1105 (61%), Gaps = 59/1105 (5%)

Query: 3    EMIFSLVLEVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNG 62
            E++ S+V +V + L  P +R++GY+ + N N +NL+ E+EKL +  T +   + EA RNG
Sbjct: 2    EIVISIVAKVAELLVVPIKRQIGYVLNCNTNIQNLKNEVEKLTDARTRVNHSIEEARRNG 61

Query: 63   ENIEEKVERWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKA 122
            E IE +V  W+ SV  +ID     + DE   ++K+C  GLCP+ K RY+L K A+ E+  
Sbjct: 62   EEIEVEVFNWLGSVDGVIDGGGGGVADE---SSKKCFMGLCPDLKIRYRLGKAAKKEL-T 117

Query: 123  AIVELREEAGRFDRISYRTIPEEIWLKSRKGYEAFESRLCALKSVQNALTDVNVSIVGVY 182
             +V+L+E+ GRFDR+SYR  P  I     K YEAFESR   L ++ +AL D  V++VGVY
Sbjct: 118  VVVDLQEK-GRFDRVSYRAAPSGI--GPVKDYEAFESRDSVLNAIVDALKDGGVNMVGVY 174

Query: 183  GMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSR 242
            GM G+GKTTLVK+VA Q +E +LFD  V + VS T DI++IQ EIA+ LGL L+ ET   
Sbjct: 175  GMPGVGKTTLVKKVAEQVKEGRLFDKEVLAVVSHTPDIRRIQGEIADGLGLKLDAETDKG 234

Query: 243  RASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFR-MGS 301
            RAS+LYERLKK  ++L+ILD+IWK + LE VGIP G DH+GCK+L+++R+  VL R MGS
Sbjct: 235  RASQLYERLKKVTRVLVILDDIWKELKLEDVGIPSGSDHEGCKILMSSRNEYVLSREMGS 294

Query: 302  QKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKS 361
             +NF I +L   EAW LF+ M    V+   ++  A EVA+ C GLPI L T+ARAL+NK 
Sbjct: 295  NRNFPIQVLPASEAWNLFEKMVGVAVKKHSVRLVAAEVARRCAGLPILLATVARALKNKD 354

Query: 362  VPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLL-GNSICTS 420
            +  WK AL++L   +  + + +  + Y  +ELS+K+L+G+++K  F+LC  L  N+I  S
Sbjct: 355  LYAWKKALKQL---TRFDKDDIDDQVYLGLELSYKSLRGDEIKSLFLLCGQLRSNNILIS 411

Query: 421  YLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISI 480
             L +  +GL + +  + LE+ RN L  LV EL+ SCLLLEGD +  + MHDV+   AIS+
Sbjct: 412  DLLRYGIGLDLFKGCSTLEETRNSLLTLVDELKASCLLLEGDKDGSVKMHDVVHSFAISV 471

Query: 481  ACRDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRL-EFLHINPKDS 539
            A RD H + V +E   EWP +  L++  AISL    I +LP  LEC  L  FL +N KD 
Sbjct: 472  ALRDHHVLTVADE-FKEWPANDVLQQYTAISLPFRKIPDLPAILECPNLNSFLLLN-KDP 529

Query: 540  FFEINNPCNFFTGMRKLRVVDFTRMQLLLLPSSIDLLVNLQTLCLVECMLDDIAIIGKLK 599
              +I  P +FF  M++L+++D T + L  LPSS+  L NLQTLCL  C+L+DI+IIG+L 
Sbjct: 530  SLQI--PDSFFREMKELKILDLTEVNLSPLPSSLQFLENLQTLCLDHCVLEDISIIGELN 587

Query: 600  NLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFV 659
             L++LS   S IV LP E+G +T+L+ LDLSNC +L+VI+PN +S L RLE+LYM N FV
Sbjct: 588  KLKVLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLTRLEDLYMGNSFV 647

Query: 660  EWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVLPEGFFA--RKLERFKISKLQG- 716
            +W+ EG +S+R NA L EL HL  L+TL + + + + +P+  F+  + LERF+I    G 
Sbjct: 648  KWETEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQNLERFRIFIGDGW 707

Query: 717  -----------------------------IKDVEYLCLDKSQDVKNVLFDLDREGFSRLK 747
                                         +K  E L L +   VK++L DLD EGF +L+
Sbjct: 708  DWSVKDATSRTLKLKLNTVIQLEEGVNTLLKITEELHLQELNGVKSILNDLDGEGFPQLR 767

Query: 748  HLHVQNNPDFMCIVDSKERVPLDDAFPILESLNLYNLIKLERICQDRLSVQSFNELKTIR 807
            HLHVQN P    I++S    P   AF  L+SL L NL  LE+IC  +L  +S   L+ ++
Sbjct: 768  HLHVQNCPGVQYIINSIRMGP-RTAFLNLDSLFLENLDNLEKICHGQLMAESLGNLRILK 826

Query: 808  VELCDQLSNIFLLSAAKCLPRLERIAVINCRNIQEIFVVDGEYDAIDHQK-IEFSQLRTL 866
            VE C +L N+F +S A+ L RLE I +I+C+ ++E+   + E DA D +  IEF+QLR L
Sbjct: 827  VESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAEESENDAADGEPIIEFTQLRRL 886

Query: 867  CLGSLPELTSFCCEVKKNREAQGMHETCSNKISSFE----DKLDISSALFNEKVVLSNLE 922
             L  LP+ TSF   V+++ ++Q   +  +++  S E    ++L  S +LFN K++  NLE
Sbjct: 887  TLQCLPQFTSFHSNVEESSDSQRRQKLLASEARSKEIVAGNELGTSMSLFNTKILFPNLE 946

Query: 923  VLEMNKVNIEKIWHNQLPVAMFLCFQNLTRLILSKCPKLKYIFSASMLGSFEHLQHLEIC 982
             L+++ + +EKIWH+Q P     C +NL  + +  C  L Y+ ++SM+ S   L+ LEIC
Sbjct: 947  DLKLSSIKVEKIWHDQ-PSVQSPCVKNLASIAVENCRNLNYLLTSSMVESLAQLKKLEIC 1005

Query: 983  HCKGLQEIISKEG-ADDQVLPNFVFPQVTSLRLSGLPELKCLYPGMHTSEWPALKLLKVS 1041
            +CK ++EI+  E   + +++   +FP++  L L  LP+L   +   +  E  +LK+L V 
Sbjct: 1006 NCKSMEEIVVPEDIGEGKMMSKMLFPKLLILSLIRLPKL-TRFCTSNLLECHSLKVLTVG 1064

Query: 1042 DCDQVTVFDSELFSFCKSSEEDKPD 1066
            +C ++  F S + S        KPD
Sbjct: 1065 NCPELKEFIS-IPSSADVPAMSKPD 1088

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224111284\|ref\|XP_002332949.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222834261\|gb\|EEE72738.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224083434\|ref\|XP_002307025.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222856474\|gb\|EEE94021.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224143316\|ref\|XP_002336027.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222838884\|gb\|EEE77235.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255563252\|ref\|XP_002522629.1\| Disease resistance protein RPS5, putative [Ricinus communis] gi\|223538105\|gb\|EEF39716.1\| Disease resistance protein RPS5, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359488027\|ref\|XP_002269288.2\| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255574526\|ref\|XP_002528174.1\| Disease resistance protein RFL1, putative [Ricinus communis] gi\|223532386\|gb\|EEF34181.1\| Disease resistance protein RFL1, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224125154\|ref\|XP_002319513.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222857889\|gb\|EEE95436.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|358344903\|ref\|XP_003636525.1\| Cc-nbs-lrr resistance protein [Medicago truncatula] gi\|355502460\|gb\|AES83663.1\| Cc-nbs-lrr resistance protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|147865073\|emb\|CAN83232.1\| hypothetical protein VITISV_021876 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1079
TAIR\|locus:2136447		985	AT4G27190 [Arabidopsis thalian	0.631	0.691	0.282	2.8e-73
TAIR\|locus:2005517		909	RPS2 "RESISTANT TO P. SYRINGAE	0.502	0.596	0.283	2.6e-65
TAIR\|locus:2131689		919	AT4G27220 [Arabidopsis thalian	0.788	0.926	0.266	2.4e-60
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.494	0.600	0.295	6.6e-60
TAIR\|locus:2166320		888	AT5G63020 [Arabidopsis thalian	0.426	0.518	0.309	3.3e-56
TAIR\|locus:2008510		967	AT1G61190 "AT1G61190" [Arabido	0.424	0.473	0.307	1.2e-55
TAIR\|locus:2201986		885	RFL1 "AT1G12210" [Arabidopsis	0.488	0.595	0.270	1.7e-55
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.502	0.606	0.286	6.8e-55
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.568	0.681	0.277	2.2e-52
TAIR\|locus:2034765		884	AT1G12290 [Arabidopsis thalian	0.571	0.697	0.267	5.1e-50

TAIR\|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 689 (247.6 bits), Expect = 2.8e-73, Sum P(2) = 2.8e-73
 Identities = 204/721 (28%), Positives = 357/721 (49%)

Query:    11 EVVKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVE 70
             E+++ +   T  RV     + +N + L   +E+L E   ++           + +  K+ 
Sbjct:    10 EILRLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLM 69

Query:    71 RWVVSVKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRYQLSKKAETEVKAAIVELREE 130
             RW    +++I +A   ++ EE  +   C   L P    +  L K  + EVK     L ++
Sbjct:    70 RWQREAEEVISKAR--LKLEERVS---CGMSLRPRMSRK--LVKILD-EVKM----LEKD 117

Query:   131 AGRF-DRISYRTIPEEIWLKSRKGYEAFESRLCA--LKSVQNALTDVNVSIVGVYGMGGI 187
                F D +S  + PE +  +   G       + +  L  +++ LT      +GV+GMGG+
Sbjct:   118 GIEFVDMLSVESTPERV--EHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGV 175

Query:   188 GKTTLVKEVARQARED---KLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLE-EETGSRR 243
             GKTTLV+ +  + RE+   + F LV+F  VS+  D +++Q++IAE+L +  + EE+  + 
Sbjct:   176 GKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKL 235

Query:   244 ASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMGSQK 303
             A R+Y  L KE K L+ILD++WK +DL+ +GIP  +++KG K++LT+R   V   M +  
Sbjct:   236 ARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDL 295

Query:   304 NFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNK-SV 362
             +  +D L EE+AW LF   A D V +  ++  A  V+Q C GLP+A+ T+  A+R K +V
Sbjct:   296 DVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNV 355

Query:   363 PEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKFFMLCSLLGN--SICTS 420
               W   L +L   S    + +  + +  ++LS+  L+ ++ K  F+LC+L     SI  +
Sbjct:   356 KLWNHVLSKLSK-SVPWIKSIEEKIFQPLKLSYDFLE-DKAKFCFLLCALFPEDYSIEVT 413

Query:   421 YLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGDSNQQLSMHDVIRDVAISI 480
              + +  M  G +++    ED+ N+    V  L+D CLL +GD    + MHDV+RD AI I
Sbjct:   414 EVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWI 473

Query:   481 ACR---DQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLE--CLRLEFLHIN 535
                   D H++++    + +   D        +SL    +  LP+ +E  C++   L + 
Sbjct:   474 MSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQ 533

Query:   536 PKDSFFEINNPCNFFTGMRKLRVVDF--TRMQXXXXXXXXXXXXXXQTLCLVECM-LDDI 592
                   E+  P  F      LR+++   TR++               +L L +C  L  +
Sbjct:   534 GNFLLKEV--PIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSL-HSLFLRDCFKLVKL 590

Query:   593 AIIGKLKNLEILSFWGSVIVMLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEEL 652
               +  L  LE+L   G+ I+  P  L  L + R LDLS    L+ I   V+SRL  LE L
Sbjct:   591 PSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETL 650

Query:   653 YMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVKNDNVL--PEGFFARKLERFK 710
              M++    W  +G  +++  A ++E+  L RL  L + + +   L      + ++L++F+
Sbjct:   651 DMTSSHYRWSVQG-ETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQ 709

Query:   711 I 711
             +
Sbjct:   710 L 710

GO:0000166 "nucleotide binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.03110007	cc-nbs-lrr resistance protein (1315 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1079
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-43
pfam13401		124	pfam13401, AAA_22, AAA domain	7e-08
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	4e-06
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-04
smart00382		148	smart00382, AAA, ATPases associated with a variety	2e-04
pfam01637		223	pfam01637, Arch_ATPase, Archaeal ATPase	2e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-04
pfam05729		165	pfam05729, NACHT, NACHT domain	4e-04
COG1474		366	COG1474, CDC6, Cdc6-related protein, AAA superfami	0.004

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  158 bits (402), Expect = 3e-43
 Identities = 81/247 (32%), Positives = 133/247 (53%), Gaps = 13/247 (5%)

Query: 175 NVSIVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGL- 233
           N+ +VG+ GMGG+GKTTL K++         FD V +  VS+T    ++Q++I ++LGL 
Sbjct: 18  NLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLD 77

Query: 234 ---VLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTA 290
               +E+      A ++ E L   ++ L++LD++W+  D + +G+PF D   G ++++T 
Sbjct: 78  DSDWVEKNESE-LAVKIKEAL-LRKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTT 135

Query: 291 RDRNVLFRMGSQ-KNFSIDILNEEEAWRLFKLMADDH--VENRELQSTATEVAQACKGLP 347
           R  +V  RMG   K   ++ L  EE+W LF     +       EL+  A E+ + CKGLP
Sbjct: 136 RSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLP 195

Query: 348 IALTTIARALRNKS-VPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKNLKGEQLKKF 406
           +AL  +   L  KS V EW+  L++L        +G+  E  S + LS+ NL    LK+ 
Sbjct: 196 LALKVLGGLLAFKSTVQEWEHVLEQLN-NELAGRDGL-NEVLSILSLSYDNLP-MHLKRC 252

Query: 407 FMLCSLL 413
           F+  +L 
Sbjct: 253 FLYLALF 259

Length = 285

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|216619 pfam01637, Arch_ATPase, Archaeal ATPase	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|218719 pfam05729, NACHT, NACHT domain	Back alignment and domain information

>gnl\|CDD\|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1079
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.96
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.96
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.86
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.83
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.82
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.78
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.77
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.77
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.66
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.44
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.38
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.38
PRK04841		903	transcriptional regulator MalT; Provisional	99.29
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.29
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.28
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.2
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.2
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.18
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.17
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.17
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.05
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	99.04
PF05729		166	NACHT: NACHT domain	99.03
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	99.0
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.98
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.85
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.85
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.84
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.83
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.82
KOG4341		483	consensus F-box protein containing LRR [General fu	98.78
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.76
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.74
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.7
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.68
KOG4341		483	consensus F-box protein containing LRR [General fu	98.66
PRK06893		229	DNA replication initiation factor; Validated	98.66
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.61
PRK13342		413	recombination factor protein RarA; Reviewed	98.58
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.58
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	98.53
COG3899		849	Predicted ATPase [General function prediction only	98.5
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.46
PF13173		128	AAA_14: AAA domain	98.45
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	98.44
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.41
PRK04195		482	replication factor C large subunit; Provisional	98.41
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	98.4
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	98.39
PRK12402		337	replication factor C small subunit 2; Reviewed	98.38
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.38
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	98.36
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.36
KOG2028		554	consensus ATPase related to the helicase subunit o	98.35
PLN03025		319	replication factor C subunit; Provisional	98.32
COG3903		414	Predicted ATPase [General function prediction only	98.31
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.29
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.29
cd01128		249	rho_factor Transcription termination factor rho is	98.28
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.27
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	98.27
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.27
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	98.26
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	98.26
PRK09376		416	rho transcription termination factor Rho; Provisio	98.25
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	98.24
PRK08727		233	hypothetical protein; Validated	98.24
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.23
PRK00440		319	rfc replication factor C small subunit; Reviewed	98.22
PTZ00202		550	tuzin; Provisional	98.21
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	98.2
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.2
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.19
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.18
PRK13341		725	recombination factor protein RarA/unknown domain f	98.16
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	98.15
PRK08084		235	DNA replication initiation factor; Provisional	98.14
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	98.13
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.12
PRK15386		426	type III secretion protein GogB; Provisional	98.12
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.11
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	98.11
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	98.1
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.1
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.09
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	98.09
PLN03150		623	hypothetical protein; Provisional	98.09
PRK09087		226	hypothetical protein; Validated	98.09
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	98.08
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	98.08
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	98.08
PRK07471		365	DNA polymerase III subunit delta'; Validated	98.06
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	98.06
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	98.05
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.05
PLN03150		623	hypothetical protein; Provisional	98.03
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	98.01
TIGR00767		415	rho transcription termination factor Rho. Members	97.97
PRK15386		426	type III secretion protein GogB; Provisional	97.96
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	97.93
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	97.93
PRK08903		227	DnaA regulatory inactivator Hda; Validated	97.93
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.92
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.91
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.91
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.91
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	97.89
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	97.89
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	97.88
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.87
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	97.87
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	97.87
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.86
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	97.86
PHA02544		316	44 clamp loader, small subunit; Provisional	97.86
PRK05642		234	DNA replication initiation factor; Validated	97.82
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	97.81
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	97.8
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	97.8
CHL00181		287	cbbX CbbX; Provisional	97.8
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.8
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	97.79
PRK03992		389	proteasome-activating nucleotidase; Provisional	97.78
PF14516		331	AAA_35: AAA-like domain	97.78
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	97.78
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	97.77
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	97.76
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	97.72
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	97.72
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	97.72
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	97.7
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	97.66
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.66
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.66
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	97.65
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.64
CHL00095		821	clpC Clp protease ATP binding subunit	97.63
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	97.62
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.6
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	97.6
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.59
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	97.59
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	97.58
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.56
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	97.55
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	97.55
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.55
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	97.55
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	97.53
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.51
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	97.51
PRK06620		214	hypothetical protein; Validated	97.5
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.5
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.49
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	97.46
PF00004		132	AAA: ATPase family associated with various cellula	97.45
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.44
PRK14086		617	dnaA chromosomal replication initiation protein; P	97.43
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	97.42
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.42
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.41
PRK12422		445	chromosomal replication initiation protein; Provis	97.39
PRK07399		314	DNA polymerase III subunit delta'; Validated	97.39
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	97.37
COG0593		408	DnaA ATPase involved in DNA replication initiation	97.36
CHL00176		638	ftsH cell division protein; Validated	97.34
PRK05707		328	DNA polymerase III subunit delta'; Validated	97.32
PRK10536		262	hypothetical protein; Provisional	97.32
smart00382		148	AAA ATPases associated with a variety of cellular	97.32
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	97.32
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	97.31
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	97.27
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	97.25
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.24
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.24
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	97.23
PRK10865		857	protein disaggregation chaperone; Provisional	97.23
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	97.2
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	97.18
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	97.16
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.16
PRK08769		319	DNA polymerase III subunit delta'; Validated	97.12
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.1
PRK06090		319	DNA polymerase III subunit delta'; Validated	97.08
PRK08118		167	topology modulation protein; Reviewed	97.08
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	97.07
PRK08058		329	DNA polymerase III subunit delta'; Validated	97.04
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	97.02
PRK12608		380	transcription termination factor Rho; Provisional	96.98
CHL00195		489	ycf46 Ycf46; Provisional	96.95
PRK08116		268	hypothetical protein; Validated	96.93
PRK06871		325	DNA polymerase III subunit delta'; Validated	96.91
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	96.91
KOG0736		953	consensus Peroxisome assembly factor 2 containing	96.81
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.8
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	96.79
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	96.77
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	96.75
PHA00729		226	NTP-binding motif containing protein	96.73
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	96.71
PRK08181		269	transposase; Validated	96.69
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	96.68
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.68
PRK07261		171	topology modulation protein; Provisional	96.67
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	96.66
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.64
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.61
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	96.6
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	96.59
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	96.56
PRK10865		857	protein disaggregation chaperone; Provisional	96.53
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	96.5
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	96.46
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	96.46
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.45
KOG1514		767	consensus Origin recognition complex, subunit 1, a	96.44
PRK08939		306	primosomal protein DnaI; Reviewed	96.43
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	96.37
PRK07993		334	DNA polymerase III subunit delta'; Validated	96.37
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	96.37
TIGR02237		209	recomb_radB DNA repair and recombination protein R	96.35
PRK06964		342	DNA polymerase III subunit delta'; Validated	96.35
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	96.35
PRK12377		248	putative replication protein; Provisional	96.34
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	96.32
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.32
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	96.28
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	96.26
COG1484		254	DnaC DNA replication protein [DNA replication, rec	96.26
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.25
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	96.24
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	96.22
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	96.2
PRK06526		254	transposase; Provisional	96.19
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.18
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	96.18
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	96.18
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	96.17
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.17
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.16
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	96.16
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.14
COG2884		223	FtsE Predicted ATPase involved in cell division [C	96.13
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.09
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	96.08
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	96.07
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	96.03
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.02
PRK07952		244	DNA replication protein DnaC; Validated	96.01
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	95.99
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	95.99
PRK09183		259	transposase/IS protein; Provisional	95.98
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	95.98
PRK09354		349	recA recombinase A; Provisional	95.91
cd00983		325	recA RecA is a bacterial enzyme which has roles in	95.9
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	95.9
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	95.88
PRK06696		223	uridine kinase; Validated	95.83
PRK06835		329	DNA replication protein DnaC; Validated	95.82
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	95.81
PRK05541		176	adenylylsulfate kinase; Provisional	95.79
PRK06921		266	hypothetical protein; Provisional	95.77
PRK04132		846	replication factor C small subunit; Provisional	95.71
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	95.65
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	95.64
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	95.64
COG1066		456	Sms Predicted ATP-dependent serine protease [Postt	95.64
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	95.63
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	95.63
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	95.61
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	95.61
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	95.59
CHL00095		821	clpC Clp protease ATP binding subunit	95.56
KOG1969		877	consensus DNA replication checkpoint protein CHL12	95.53
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	95.51
PTZ00494		664	tuzin-like protein; Provisional	95.5
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	95.5
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	95.47
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	95.46
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	95.44
PF00006		215	ATP-synt_ab: ATP synthase alpha/beta family, nucle	95.44
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	95.35
cd03115		173	SRP The signal recognition particle (SRP) mediates	95.33
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	95.3
PRK00771		437	signal recognition particle protein Srp54; Provisi	95.28
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	95.27
PRK08533		230	flagellar accessory protein FlaH; Reviewed	95.26
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	95.26
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.26
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	95.25
PRK10867		433	signal recognition particle protein; Provisional	95.2
PRK14974		336	cell division protein FtsY; Provisional	95.19
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	95.19
TIGR00959		428	ffh signal recognition particle protein. This mode	95.18
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.17
PRK04296		190	thymidine kinase; Provisional	95.15
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.13
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	95.12
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	95.12
cd01135		276	V_A-ATPase_B V/A-type ATP synthase (non-catalytic)	95.08
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.07
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	95.06
PRK15455		644	PrkA family serine protein kinase; Provisional	95.03
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	95.02
TIGR02236		310	recomb_radA DNA repair and recombination protein R	94.99
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	94.98
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.94
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	94.94
PRK07667		193	uridine kinase; Provisional	94.94
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	94.92
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	94.9
PRK06547		172	hypothetical protein; Provisional	94.88
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	94.86
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	94.85
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	94.81
PTZ00035		337	Rad51 protein; Provisional	94.8
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	94.77
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	94.74
PRK04301		317	radA DNA repair and recombination protein RadA; Va	94.73
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	94.72
CHL00206		2281	ycf2 Ycf2; Provisional	94.71
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	94.69
cd01394		218	radB RadB. The archaeal protein radB shares simila	94.69
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	94.68
PF00154		322	RecA: recA bacterial DNA recombination protein; In	94.66
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	94.6
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	94.6
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	94.57
PRK05439		311	pantothenate kinase; Provisional	94.56
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	94.54
PRK04328		249	hypothetical protein; Provisional	94.53
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	94.5
PRK12597		461	F0F1 ATP synthase subunit beta; Provisional	94.5
TIGR00064		272	ftsY signal recognition particle-docking protein F	94.48
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	94.45
COG0488		530	Uup ATPase components of ABC transporters with dup	94.44
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.42
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	94.4
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	94.39
PRK08972		444	fliI flagellum-specific ATP synthase; Validated	94.38
TIGR01040		466	V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th	94.36
TIGR03305		449	alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit	94.36
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	94.34
PTZ00185		574	ATPase alpha subunit; Provisional	94.33
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	94.31
PRK06067		234	flagellar accessory protein FlaH; Validated	94.29
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	94.27
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	94.27
PRK09280		463	F0F1 ATP synthase subunit beta; Validated	94.27
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	94.26
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	94.25
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.23
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	94.23
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	94.22
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	94.2
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	94.18
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	94.18
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	94.18
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.18
PRK08233		182	hypothetical protein; Provisional	94.14
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	94.13
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	94.11
PRK08927		442	fliI flagellum-specific ATP synthase; Validated	94.08
PRK13531		498	regulatory ATPase RavA; Provisional	94.08
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	94.04
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	94.03
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	94.02
PRK08149		428	ATP synthase SpaL; Validated	94.02
PRK07132		299	DNA polymerase III subunit delta'; Validated	94.01
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	94.0
PRK06002		450	fliI flagellum-specific ATP synthase; Validated	93.99
PRK05480		209	uridine/cytidine kinase; Provisional	93.98
TIGR01041		458	ATP_syn_B_arch ATP synthase archaeal, B subunit. A	93.96
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	93.95
PTZ00301		210	uridine kinase; Provisional	93.94
PRK06762		166	hypothetical protein; Provisional	93.9
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	93.88
TIGR00235		207	udk uridine kinase. Model contains a number of lon	93.8
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	93.78
PRK03839		180	putative kinase; Provisional	93.76
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	93.73
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	93.72
PRK13765		637	ATP-dependent protease Lon; Provisional	93.71
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	93.7
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	93.7
cd03216		163	ABC_Carb_Monos_I This family represents the domain	93.67
PRK01184		184	hypothetical protein; Provisional	93.64
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	93.61
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	93.61
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	93.61
TIGR01039		461	atpD ATP synthase, F1 beta subunit. The sequences	93.59
cd01132		274	F1_ATPase_alpha F1 ATP synthase alpha, central dom	93.58
PRK11823		446	DNA repair protein RadA; Provisional	93.57
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	93.56
cd01134		369	V_A-ATPase_A V/A-type ATP synthase catalytic subun	93.52
PRK00625		173	shikimate kinase; Provisional	93.52
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	93.51
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	93.47
PRK04040		188	adenylate kinase; Provisional	93.43
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	93.42
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	93.4
PRK06936		439	type III secretion system ATPase; Provisional	93.38
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	93.37
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	93.37
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.34
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	93.33
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	93.31
PRK09519		790	recA DNA recombination protein RecA; Reviewed	93.27
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	93.26
PTZ00088		229	adenylate kinase 1; Provisional	93.25
cd03246		173	ABCC_Protease_Secretion This family represents the	93.24
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.24
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	93.22
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	93.22
cd01136		326	ATPase_flagellum-secretory_path_III Flagellum-spec	93.18
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	93.17
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	93.16
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	93.14
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	93.12
PRK10416		318	signal recognition particle-docking protein FtsY;	93.11
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.08
PRK05922		434	type III secretion system ATPase; Validated	93.07
COG3854		308	SpoIIIAA ncharacterized protein conserved in bacte	93.06
PRK09099		441	type III secretion system ATPase; Provisional	93.01
CHL00060		494	atpB ATP synthase CF1 beta subunit	93.01
PF13245		76	AAA_19: Part of AAA domain	92.97
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	92.92
PRK04196		460	V-type ATP synthase subunit B; Provisional	92.89
PRK00889		175	adenylylsulfate kinase; Provisional	92.83
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	92.81
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	92.77
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	92.76
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	92.7
PRK06851		367	hypothetical protein; Provisional	92.7
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	92.69
PRK05688		451	fliI flagellum-specific ATP synthase; Validated	92.65
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	92.64
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	92.64
PRK12678		672	transcription termination factor Rho; Provisional	92.63
PRK00131		175	aroK shikimate kinase; Reviewed	92.63
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.56
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.55
PRK07594		433	type III secretion system ATPase SsaN; Validated	92.53
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	92.52
TIGR03498		418	FliI_clade3 flagellar protein export ATPase FliI.	92.51
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	92.51
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	92.5
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	92.48
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	92.42
TIGR03324		497	alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a	92.42
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	92.42
PRK06217		183	hypothetical protein; Validated	92.42
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	92.4
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	92.39
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	92.35
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	92.34
PF07726		131	AAA_3: ATPase family associated with various cellu	92.33
TIGR03496		411	FliI_clade1 flagellar protein export ATPase FliI.	92.3
PRK11608		326	pspF phage shock protein operon transcriptional ac	92.27
PRK13949		169	shikimate kinase; Provisional	92.25
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	92.21
PF02374		305	ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_	92.21
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	92.2
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	92.2
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	92.2
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	92.19
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	92.17
PLN02924		220	thymidylate kinase	92.16
PRK14529		223	adenylate kinase; Provisional	92.14
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	92.13
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	92.13
PRK13947		171	shikimate kinase; Provisional	92.12
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	92.11
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	92.08
KOG0079		198	consensus GTP-binding protein H-ray, small G prote	92.07
TIGR03497		413	FliI_clade2 flagellar protein export ATPase FliI.	92.06
PRK13234		295	nifH nitrogenase reductase; Reviewed	92.04
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	92.02
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	92.01
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	91.99
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	91.98
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.93
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	91.93
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	91.91
PRK07196		434	fliI flagellum-specific ATP synthase; Validated	91.9
PRK06793		432	fliI flagellum-specific ATP synthase; Validated	91.88
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	91.87
COG4240		300	Predicted kinase [General function prediction only	91.84
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	91.82
PRK12339		197	2-phosphoglycerate kinase; Provisional	91.82
PRK14530		215	adenylate kinase; Provisional	91.82
KOG0473		326	consensus Leucine-rich repeat protein [Function un	91.78
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	91.78
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	91.76
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	91.75

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.7e-86  Score=791.18  Aligned_cols=740  Identities=26%  Similarity=0.408  Sum_probs=535.1

Q ss_pred             HHhhhhhhhhhhcccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHHHHHhhHHH
Q 044755           13 VKCLAPPTERRVGYLRDYNANFENLRAEIEKLKEESTSIQRRVSEAERNGENIEEKVERWVVSVKKIIDEAAKFIQDEET   92 (1079)
Q Consensus        13 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~a~~~~~~~~~~~~~Wl~~~~~~~~~~ed~~d~~~~   92 (1079)
                      ++++.+.+.++...       +.+.++.+..|++++..++.+++++++++ .....+..|.+.+++++|++||.++.+..
T Consensus         9 ~~~~~~~l~~~~~~-------~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~-~~~~~~~~~~e~~~~~~~~~e~~~~~~~v   80 (889)
T KOG4658|consen    9 VEKLDQLLNRESEC-------LDGKDNYILELKENLKALQSALEDLDAKR-DDLERRVNWEEDVGDLVYLAEDIIWLFLV   80 (889)
T ss_pred             hhhHHHHHHHHHHH-------HhchHHHHHHHHHHHHHHHHHHHHHHhhc-chHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444554444444       56778899999999999999999999885 45788999999999999999999876543


Q ss_pred             hhcc----------------cccCCC-CcChhhhhhhhHHHHHHHHHHHHHHHHhcCCCceecccCCC-ccccccccCCc
Q 044755           93 ATNK----------------RCLKGL-CPNFKTRYQLSKKAETEVKAAIVELREEAGRFDRISYRTIP-EEIWLKSRKGY  154 (1079)
Q Consensus        93 ~~~~----------------~~~~~~-~~~~~~~~~~~~~i~~~~~~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  154 (1079)
                      ....                -|+... ......-+.+++++.++.+. ++.+ ..++.|+.+.....+ ......+....
T Consensus        81 ~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~-ve~l-~~~~~~~~~~~~~~~~~~~e~~~~~~~  158 (889)
T KOG4658|consen   81 EEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLRE-VESL-GSKGVFEVVGESLDPREKVETRPIQSE  158 (889)
T ss_pred             HHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHH-HHHh-ccccceecccccccchhhcccCCCCcc
Confidence            2110                011111 12233334455555555555 5555 233334433321111 12222222333


Q ss_pred             cccccHHHHHHHHHHHhcCCCceEEEEEcCCCCcHHHHHHHHHHHhh-hcCCCCEEEEEEeCCccCHHHHHHHHHHHhCC
Q 044755          155 EAFESRLCALKSVQNALTDVNVSIVGVYGMGGIGKTTLVKEVARQAR-EDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGL  233 (1079)
Q Consensus       155 ~~~~gr~~~~~~l~~~l~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l~~  233 (1079)
                      .. +|.+..++++.+.|.+++..+++|+||||+||||||++++|+.. ++.+||.++||.||+.++...++++|+..++.
T Consensus       159 ~~-VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~  237 (889)
T KOG4658|consen  159 SD-VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGL  237 (889)
T ss_pred             cc-ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhcc
Confidence            33 89999999999999988779999999999999999999999988 89999999999999999999999999999887


Q ss_pred             Cccc---cchHHHHHHHHHHHHcCCcEEEEEeCCCCccccccccCCCCCCCCCcEEEEEecChhhhhh-cCCCceEeCCC
Q 044755          234 VLEE---ETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFR-MGSQKNFSIDI  309 (1079)
Q Consensus       234 ~~~~---~~~~~~~~~l~~~l~~~~~~LlvlDdv~~~~~~~~l~~~l~~~~~gs~iivTtR~~~v~~~-~~~~~~~~l~~  309 (1079)
                      ....   ....+.+..+.+.|. ++||+||+||||+..+|+.++.|+|...+||||++|||+++||.. |++...+++++
T Consensus       238 ~~~~~~~~~~~~~~~~i~~~L~-~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~  316 (889)
T KOG4658|consen  238 LDEEWEDKEEDELASKLLNLLE-GKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVEC  316 (889)
T ss_pred             CCcccchhhHHHHHHHHHHHhc-cCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccc
Confidence            4332   223455666777776 799999999999999999999999999999999999999999998 88889999999


Q ss_pred             CCHHHHHHHHHHHhcCC--CCChhhHHHHHHHHHHcCCCchHHHHHHHHHhcC-ChhHHHHHHHHhcCCCcCCCCCCchh
Q 044755          310 LNEEEAWRLFKLMADDH--VENRELQSTATEVAQACKGLPIALTTIARALRNK-SVPEWKSALQELRMPSEVNFEGVPAE  386 (1079)
Q Consensus       310 L~~~~~~~lf~~~~~~~--~~~~~~~~~~~~i~~~~~glPlai~~~~~~l~~~-~~~~w~~~~~~l~~~~~~~~~~~~~~  386 (1079)
                      |+++|||+||++.++..  ...+.++++|++++++|+|+|||++++|+.|+.| +..+|+++.+.+.+....+++++.+.
T Consensus       317 L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~  396 (889)
T KOG4658|consen  317 LTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEES  396 (889)
T ss_pred             cCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhh
Confidence            99999999999999543  3445589999999999999999999999999999 78899999999887766666777888


Q ss_pred             hhhhHHHhhccCChHHHHHHHHHhcccC--CCcchhHHHHHHHhhccccccCCHHHHHHHHHHHHHHHHhhccccccC--
Q 044755          387 AYSTIELSFKNLKGEQLKKFFMLCSLLG--NSICTSYLFQCCMGLGILQKANKLEDARNKLYALVHELRDSCLLLEGD--  462 (1079)
Q Consensus       387 ~~~~l~~sy~~L~~~~lk~cf~~~s~fp--~~~~~~~li~~w~aeg~i~~~~~~~~~~~~~~~~~~~L~~~~l~~~~~--  462 (1079)
                      +++++++||++||. ++|.||+|||+||  +.|+++.|+.+||||||+.+....+.+++.+++|+.+|+++++++..+  
T Consensus       397 i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~  475 (889)
T KOG4658|consen  397 ILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE  475 (889)
T ss_pred             hHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc
Confidence            99999999999995 4999999999999  556677999999999999986667788999999999999999998765  


Q ss_pred             -CCCcEeehHHHHHHHHHHhh-----ccCceEEeccCCcCCCCccccccceeEEEecCCCCCCCCCccCCCcccEEEecC
Q 044755          463 -SNQQLSMHDVIRDVAISIAC-----RDQHAVLVRNEDVWEWPDDIALKECYAISLRGCSIHELPEGLECLRLEFLHINP  536 (1079)
Q Consensus       463 -~~~~~~~Hdlv~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~l~~~~~~~~Lr~L~l~~  536 (1079)
                       ...+|+|||+|||+|.++|+     ++++++ ..+.+....++...+..+|++++.++.+..++....+++|++|.+.+
T Consensus       476 ~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv-~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~  554 (889)
T KOG4658|consen  476 GRKETVKMHDVVREMALWIASDFGKQEENQIV-SDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQR  554 (889)
T ss_pred             cceeEEEeeHHHHHHHHHHhccccccccceEE-ECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEee
Confidence             33679999999999999998     666333 33334455677777899999999999999999999999999999998


Q ss_pred             CCC-cccccCCcchhccCCcceEEEecCc-cccccCccccccccccEEeccccccCC-cccccCCcccceeeccCC-cCc
Q 044755          537 KDS-FFEINNPCNFFTGMRKLRVVDFTRM-QLLLLPSSIDLLVNLQTLCLVECMLDD-IAIIGKLKNLEILSFWGS-VIV  612 (1079)
Q Consensus       537 ~~~-~~~~~~~~~~~~~l~~Lr~L~L~~~-~i~~lp~~i~~L~~L~~L~L~~~~l~~-~~~i~~L~~L~~L~l~~~-~l~  612 (1079)
                      +.. ...+  +..||..++.||||||++| .+.++|++|+.|.|||||+++++.++. |.++++|+.|.+|++..+ .+.
T Consensus       555 n~~~l~~i--s~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~  632 (889)
T KOG4658|consen  555 NSDWLLEI--SGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLE  632 (889)
T ss_pred             cchhhhhc--CHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccc
Confidence            763 4555  7888999999999999976 567899988888888888888876655 555555555555555554 223


Q ss_pred             ccChhhccCCcccEEcccccccccccChhhhhcccccceeecccccccccCCCCCchhhhcchhhhccCCCCcEEEEEee
Q 044755          613 MLPEELGHLTKLRQLDLSNCFKLKVIAPNVISRLVRLEELYMSNCFVEWDDEGPNSERINARLDELMHLPRLTTLEVHVK  692 (1079)
Q Consensus       613 ~lp~~i~~L~~L~~L~l~~~~~l~~~~~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~  692 (1079)
                      .+|..+..|.+||+|.+..                         ....         .....+.++.++.+|+.+.+...
T Consensus       633 ~~~~i~~~L~~Lr~L~l~~-------------------------s~~~---------~~~~~l~el~~Le~L~~ls~~~~  678 (889)
T KOG4658|consen  633 SIPGILLELQSLRVLRLPR-------------------------SALS---------NDKLLLKELENLEHLENLSITIS  678 (889)
T ss_pred             cccchhhhcccccEEEeec-------------------------cccc---------cchhhHHhhhcccchhhheeecc
Confidence            3333334455555554443                         2111         11233444455555555554432


Q ss_pred             CCCCCCchhhhcccceeeeeeecCCcccceEeeccccccccccccccccccCCCceeeccCCCCcceecccCCcCCCCCC
Q 044755          693 NDNVLPEGFFARKLERFKISKLQGIKDVEYLCLDKSQDVKNVLFDLDREGFSRLKHLHVQNNPDFMCIVDSKERVPLDDA  772 (1079)
Q Consensus       693 ~~~~~~~~~~~~~L~~L~l~~~~~l~~L~~L~L~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~  772 (1079)
                      ....+.......+|.++          ...+.+.++.. ...  ......+++|+.|.+.+|...+..............
T Consensus       679 s~~~~e~l~~~~~L~~~----------~~~l~~~~~~~-~~~--~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~  745 (889)
T KOG4658|consen  679 SVLLLEDLLGMTRLRSL----------LQSLSIEGCSK-RTL--ISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLC  745 (889)
T ss_pred             hhHhHhhhhhhHHHHHH----------hHhhhhccccc-cee--ecccccccCcceEEEEcCCCchhhcccccccchhhh
Confidence            22111111111111111          11111111110 011  112245678888888877654322211111111013


Q ss_pred             CCccceeeccccccccccccCcCCcCCCCCcceEEeecCCCCCcccc
Q 044755          773 FPILESLNLYNLIKLERICQDRLSVQSFNELKTIRVELCDQLSNIFL  819 (1079)
Q Consensus       773 ~~~L~~L~l~~~~~l~~i~~~~~~~~~~~~L~~L~l~~c~~l~~l~~  819 (1079)
                      |+++..+.+.+|...+....    ....|+|+.|.+..|+.+..+.+
T Consensus       746 f~~l~~~~~~~~~~~r~l~~----~~f~~~L~~l~l~~~~~~e~~i~  788 (889)
T KOG4658|consen  746 FPNLSKVSILNCHMLRDLTW----LLFAPHLTSLSLVSCRLLEDIIP  788 (889)
T ss_pred             HHHHHHHHhhccccccccch----hhccCcccEEEEecccccccCCC
Confidence            66777777777765544321    24578888888888888877655

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PTZ00494 tuzin-like protein; Provisional	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12597 F0F1 ATP synthase subunit beta; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK08972 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit	Back alignment and domain information

>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00185 ATPase alpha subunit; Provisional	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09280 F0F1 ATP synthase subunit beta; Validated	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK08927 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PRK08149 ATP synthase SpaL; Validated	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK06002 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>TIGR01039 atpD ATP synthase, F1 beta subunit	Back alignment and domain information

>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK06936 type III secretion system ATPase; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK05922 type III secretion system ATPase; Validated	Back alignment and domain information

>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK09099 type III secretion system ATPase; Provisional	Back alignment and domain information

>CHL00060 atpB ATP synthase CF1 beta subunit	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK04196 V-type ATP synthase subunit B; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK05688 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PRK12678 transcription termination factor Rho; Provisional	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK07594 type III secretion system ATPase SsaN; Validated	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only]	Back alignment and domain information

>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK07196 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK06793 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1079
3sfz_A		1249	Crystal Structure Of Full-Length Murine Apaf-1 Leng		4e-07
1z6t_A		591	Structure Of The Apoptotic Protease-activating Fact		2e-06
3shf_A		1256	Crystal Structure Of The R265s Mutant Of Full-Lengt		2e-06
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		4e-06

>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249

Back alignment and structure

Iteration: 1

Score = 53.9 bits (128), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 64/273 (23%), Positives = 118/273 (43%), Gaps = 48/273 (17%) Query: 157 FESRLCALKSVQNALTDVN--VSIVGVYGMGGIGKTTLVKEVARQ--------------- 199 F +R + ++Q L +N V +YGM G GK+ L E R Sbjct: 126 FVTRKKLVHAIQQKLWKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEGCFSGGVHWV 185 Query: 200 --AREDKLFDLVVFSEVSQTLDIKKIQQEIAEKLGLVLEEETGSRRASRLYERLKKEEKI 257 ++DK L+ + LD ++ +++L L +EE R L+K + Sbjct: 186 SIGKQDKSGLLMKLQNLCMRLD---QEESFSQRLPLNIEEAKDRLRVL----MLRKHPRS 238 Query: 258 LIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFR-MGSQKNFSIDI-LNEEEA 315 L+ILD++W L+A C++LLT RD++V MG + ++ L E+ Sbjct: 239 LLILDDVWDPWVLKAFD-------NQCQILLTTRDKSVTDSVMGPKHVVPVESGLGREKG 291 Query: 316 WRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPE-WKSALQEL-- 372 + L + ++ +L + A + + CKG P+ ++ I LR+ P W L++L Sbjct: 292 LEILSLFVN--MKKEDLPAEAHSIIKECKGSPLVVSLIGALLRD--FPNRWAYYLRQLQN 347 Query: 373 ------RMPSEVNFEGVPAEAYSTIELSFKNLK 399 R S ++E + ++E+ +++K Sbjct: 348 KQFKRIRKSSSYDYEALDEAMSISVEMLREDIK 380

PyMOL of 3sfz

>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591

Back alignment and structure

>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1079
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-49
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	2e-47
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	3e-32
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	1e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-17
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-16
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-12
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-11
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-12
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	9e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-12
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-06
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-11
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-11
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-10
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	5e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-10
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	9e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	4e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	8e-09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	6e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-08
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	9e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-06
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	5e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	4e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	5e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score =  189 bits (480), Expect = 4e-49
 Identities = 100/626 (15%), Positives = 194/626 (30%), Gaps = 145/626 (23%)

Query: 76  VKKIIDEAAKFIQDEETATNKRCLKGLCPNFKTRY---QLSKKAETEVKAAIVELREEAG 132
            K + D     +  EE       +        T      L  K E  V+  + E+     
Sbjct: 35  CKDVQDMPKSILSKEEI---DHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINY 91

Query: 133 RF--DRISYRTI-PEEIWLKSRKGYEAFESRLC---------------ALKSVQNALTDV 174
           +F    I      P  +     + Y     RL                    ++ AL ++
Sbjct: 92  KFLMSPIKTEQRQPSMM----TRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLEL 147

Query: 175 NVS-IVGVYGMGGIGKTTLVKEVARQAREDKLFDLVVF----SEVSQTLDIKKIQQEIAE 229
             +  V + G+ G GKT +  +V    +     D  +F       +    + ++ Q++  
Sbjct: 148 RPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLY 207

Query: 230 KL------------GLVLEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPF 277
           ++             + L   +      RL  + K  E  L++L N+       A  +  
Sbjct: 208 QIDPNWTSRSDHSSNIKLRIHSIQAELRRLL-KSKPYENCLLVLLNVQNAKAWNAFNL-- 264

Query: 278 GDDHKGCKLLLTARDRNVLFRMGSQKNFSIDI------LNEEEAWRLFKLMADDHVENRE 331
                 CK+LLT R + V   + +     I +      L  +E   L     D     ++
Sbjct: 265 -----SCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD--CRPQD 317

Query: 332 LQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYST- 390
           L        +     P  L+ IA ++R+  +  W             N++ V  +  +T 
Sbjct: 318 LPR------EVLTTNPRRLSIIAESIRDG-LATWD------------NWKHVNCDKLTTI 358

Query: 391 IELSFKNLKGEQLKKFFMLCSLLGNS--ICTSYLFQCCMGLGILQKANKLEDARNKLYAL 448
           IE S   L+  + +K F   S+   S  I  + L      L ++       D       +
Sbjct: 359 IESSLNVLEPAEYRKMFDRLSVFPPSAHI-PTIL------LSLIWFDVIKSDVMV----V 407

Query: 449 VHELRDSCLLLEGDSNQQLSMHDVIRDVAISIACRDQ-HAVLV---RNEDVWEWPDDIAL 504
           V++L    L+ +      +S+  +  ++ + +      H  +V        ++  D I  
Sbjct: 408 VNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPP 467

Query: 505 KE-CYAIS-----LRGCSIHELPEGLECLRLEFLHINPKDSFFEINNPCNFFTGMRKLRV 558
               Y  S     L+     E       + L+F        F E           +K+R 
Sbjct: 468 YLDQYFYSHIGHHLKNIEHPERMTLFRMVFLDF-------RFLE-----------QKIR- 508

Query: 559 VDFTRMQLLLLPSSIDLLVNLQT----LC----LVECMLDDI--------AIIGKLKNLE 602
                       S ++ L  L+     +C      E +++ I          +   K  +
Sbjct: 509 --HDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTD 566

Query: 603 ILSFWGSVIVMLPEELGHLTKLRQLD 628
           +L       +M  +E       +Q+ 
Sbjct: 567 LLRI----ALMAEDEAIFEEAHKQVQ 588

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1079
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	100.0
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	100.0
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	100.0
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.97
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.96
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.96
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.95
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.94
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.94
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.94
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.94
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.93
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.93
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.93
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.93
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.92
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.92
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.91
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.91
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.91
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.91
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.89
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.89
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.86
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.86
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.86
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.86
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.84
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.82
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.8
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.79
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.78
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.78
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.77
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.76
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.75
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.75
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.74
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.73
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.73
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.72
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.71
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.7
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.7
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.69
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.69
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.68
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.65
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.65
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.64
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.64
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.63
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.63
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.61
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.61
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.59
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.59
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.59
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.58
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.57
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.57
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.57
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	99.56
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.56
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.55
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.55
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.55
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.55
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.55
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.54
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.53
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.52
2fna_A		357	Conserved hypothetical protein; structural genomic	99.52
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.51
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.51
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	99.48
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.48
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.46
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.46
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.45
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.45
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.44
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.44
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.44
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.43
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.43
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.41
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.4
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.4
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.4
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.39
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.39
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.39
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.37
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	99.34
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.34
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.31
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.31
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.3
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.29
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.29
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.29
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.28
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.28
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.27
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.26
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.26
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.26
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.25
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.24
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.24
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	99.24
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.19
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	99.18
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	99.18
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.16
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.16
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	99.16
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.13
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.12
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	99.12
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.09
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.09
2chg_A		226	Replication factor C small subunit; DNA-binding pr	99.08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.03
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.01
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.0
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.99
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.99
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.95
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	98.87
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	98.74
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.72
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.71
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	98.69
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	98.66
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.65
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.63
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.57
2chq_A		319	Replication factor C small subunit; DNA-binding pr	98.52
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.49
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.47
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	98.47
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.4
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	98.36
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.31
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	98.27
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	98.23
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.23
3bos_A		242	Putative DNA replication factor; P-loop containing	98.18
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.18
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	98.18
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	98.16
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.14
3pvs_A		447	Replication-associated recombination protein A; ma	98.14
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	98.13
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.12
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.06
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	98.04
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	98.03
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	98.03
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	98.02
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	98.02
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	98.01
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.0
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	97.99
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	97.98
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	97.96
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	97.89
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	97.89
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	97.89
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	97.86
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	97.85
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	97.84
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	97.8
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	97.79
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	97.76
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	97.75
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	97.68
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	97.68
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	97.68
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.66
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	97.65
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	97.64
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	97.62
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	97.52
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.5
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	97.43
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	97.42
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.42
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.41
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	97.4
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	97.32
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	97.32
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	97.29
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	97.27
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.26
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	97.22
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	97.18
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	97.09
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	97.08
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	97.08
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.07
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.99
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	96.92
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	96.89
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	96.86
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	96.77
3co5_A		143	Putative two-component system transcriptional RES	96.76
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	96.74
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	96.73
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	96.71
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	96.71
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	96.6
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	96.58
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	96.54
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	96.48
3io5_A		333	Recombination and repair protein; storage dimer, i	96.29
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	96.22
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	96.1
2r44_A		331	Uncharacterized protein; putative ATPase, structur	96.08
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	96.06
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	95.96
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	95.91
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.9
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	95.72
2z43_A		324	DNA repair and recombination protein RADA; archaea	95.72
2cvh_A		220	DNA repair and recombination protein RADB; filamen	95.62
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	95.54
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	95.4
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	95.4
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	95.37
1xp8_A		366	RECA protein, recombinase A; recombination, radior	95.25
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	95.23
1u94_A		356	RECA protein, recombinase A; homologous recombinat	95.21
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	95.2
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	95.17
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	95.15
2qgz_A		308	Helicase loader, putative primosome component; str	95.02
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	94.88
1sky_E		473	F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp	94.79
1fx0_B		498	ATP synthase beta chain; latent ATPase, thermal st	94.79
4a74_A		231	DNA repair and recombination protein RADA; hydrola	94.73
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	94.68
3ice_A		422	Transcription termination factor RHO; transcriptio	94.68
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	94.63
2ck3_D		482	ATP synthase subunit beta\, mitochondrial; hydrola	94.63
2xxa_A		433	Signal recognition particle protein; protein trans	94.58
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	94.21
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	94.16
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	93.99
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	93.99
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	93.77
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	93.69
2hf9_A		226	Probable hydrogenase nickel incorporation protein	93.69
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	93.63
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	93.6
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	93.58
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	93.49
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	93.44
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	93.35
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	93.3
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	93.29
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	93.06
2ga8_A		359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	92.99
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	92.97
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	92.96
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	92.94
3l0o_A		427	Transcription termination factor RHO; helicase, RH	92.91
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.82
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	92.79
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	92.74
2c61_A		469	A-type ATP synthase non-catalytic subunit B; hydro	92.73
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	92.72
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	92.71
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	92.7
3fwy_A		314	Light-independent protochlorophyllide reductase I	92.69
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	92.68
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	92.65
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	92.64
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.55
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	92.55
3vr4_D		465	V-type sodium ATPase subunit D; V-ATPase, rotary m	92.55
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	92.5
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	92.42
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	92.42
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	92.41
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	92.38
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	92.31
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	92.3
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	92.3
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	92.28
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	92.25
1via_A		175	Shikimate kinase; structural genomics, transferase	92.21
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	92.18
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	92.15
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	92.1
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	92.08
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	92.05
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	91.93
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	91.9
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	91.89
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	91.78
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	91.77
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	91.73
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	91.7
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	91.68
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	91.67
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	91.66
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	91.61
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	91.6
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	91.55
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	91.5
3gqb_B		464	V-type ATP synthase beta chain; A3B3, V-ATPase, AT	91.44
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	91.41
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	91.4
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	91.37
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	91.37
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	91.36
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	91.36
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	91.31
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	91.3
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	91.3
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	91.25
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	91.25
3nbx_X		500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	91.17
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	91.14
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	91.12
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	91.09
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	91.09
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	91.09
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	91.08
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	91.04
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	91.0
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	90.9
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	90.81
3gmt_A		230	Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle	90.8
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	90.75
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	90.75
1tue_A		212	Replication protein E1; helicase, replication, E1E	90.72
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	90.69
2vli_A		183	Antibiotic resistance protein; transferase, tunica	90.68
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	90.64
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	90.64
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	90.61
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.54
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	90.54
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	90.52
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	90.52
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	90.48
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	90.42
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	90.34
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	90.26
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	90.18
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	90.12
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	90.12
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	90.09
3end_A		307	Light-independent protochlorophyllide reductase ir	90.08
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	90.07
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	90.06
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	90.02
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	90.0
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	89.86
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	89.76
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	89.75
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	89.74
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	89.71
3vr4_A		600	V-type sodium ATPase catalytic subunit A; V-ATPase	89.68
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	89.67
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	89.66
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	89.65
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	89.64
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	89.57
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	89.44
3mfy_A		588	V-type ATP synthase alpha chain; A-type ATP syntha	89.36
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	89.32
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	89.29
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	89.29
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	89.28
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	89.26
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	89.22
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	89.22
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	89.12
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	89.1
1g41_A		444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	89.09
2r9v_A		515	ATP synthase subunit alpha; TM1612, structural gen	88.95
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	88.89
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	88.88
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	88.85
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	88.83
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	88.75
2r6a_A		454	DNAB helicase, replicative helicase; replication,	88.69
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	88.69
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	88.68
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	88.68
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	88.67
3cmw_A		1706	Protein RECA, recombinase A; homologous recombinat	88.66
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	88.63
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	88.41
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	88.36
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	88.29
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	88.22
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	88.12
2og2_A		359	Putative signal recognition particle receptor; nuc	88.07
2qe7_A		502	ATP synthase subunit alpha; blockage of ATP hydrol	88.03
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	87.92
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	87.9
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	87.9
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	87.89
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	87.88
2ck3_A		510	ATP synthase subunit alpha\, mitochondrial; hydrol	87.88
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	87.84
3exa_A		322	TRNA delta(2)-isopentenylpyrophosphate transferase	87.78
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	87.68
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	87.53
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	87.51
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	87.43
1cp2_A		269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	87.4
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	87.37
3iqw_A		334	Tail-anchored protein targeting factor GET3; ATPas	87.35
3io3_A		348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	87.31
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	87.22
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	87.22
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	87.16
2wji_A		165	Ferrous iron transport protein B homolog; membrane	87.09
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	87.08
1fx0_A		507	ATP synthase alpha chain; latent ATPase, thermal s	87.07
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	86.96
3ld9_A		223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	86.78
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	86.67
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	86.67
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	86.66
2afh_E		289	Nitrogenase iron protein 1; nitrogen fixation, iro	86.6
2zej_A		184	Dardarin, leucine-rich repeat kinase 2; parkinson'	86.6
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	86.48
1b0u_A		262	Histidine permease; ABC transporter, transport pro	86.48
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	86.47
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	86.33
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	86.28
3oaa_A		513	ATP synthase subunit alpha; rossmann fold, hydrola	86.2
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	86.17
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	86.17
3cwq_A		209	Para family chromosome partitioning protein; alpha	86.15
1sgw_A		214	Putative ABC transporter; structural genomics, P p	86.14
1ji0_A		240	ABC transporter; ATP binding protein, structural g	86.13
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	86.12
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	86.11
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	86.1
1g6h_A		257	High-affinity branched-chain amino acid transport	86.01
2ged_A		193	SR-beta, signal recognition particle receptor beta	85.99
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	85.93
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	85.92
1z2a_A		168	RAS-related protein RAB-23; RAB GTPase, vesicular	85.83
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	85.75
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	85.69
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	85.56
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	85.54
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	85.54
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	85.53
3eph_A		409	TRNA isopentenyltransferase; transferase, alternat	85.51
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	85.44
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	85.41
3kjh_A		254	CO dehydrogenase/acetyl-COA synthase complex, acce	85.4
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	85.34
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	85.31
2eyu_A		261	Twitching motility protein PILT; pilus retraction	85.26
1r8s_A		164	ADP-ribosylation factor 1; protein transport/excha	85.24
2ghi_A		260	Transport protein; multidrug resistance protein, M	85.2
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	85.17
2wjg_A		188	FEOB, ferrous iron transport protein B homolog; me	85.09
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	85.04
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	84.99
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	84.98
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	84.93
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	84.91
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	84.91
3gqb_A		578	V-type ATP synthase alpha chain; A3B3, V-ATPase, A	84.88
1u8z_A		168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	84.86
1c1y_A		167	RAS-related protein RAP-1A; GTP-binding proteins,	84.79
2nzj_A		175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	84.75

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=100.00  E-value=9.9e-46  Score=439.14  Aligned_cols=308  Identities=12%  Similarity=0.136  Sum_probs=239.6

Q ss_pred             cccHHHHHHHHHHHhcCC---CceEEEEEcCCCCcHHHHHHHHHH--HhhhcCCCCEEEEEEeCCcc--CHHHHHHHHHH
Q 044755          157 FESRLCALKSVQNALTDV---NVSIVGVYGMGGIGKTTLVKEVAR--QAREDKLFDLVVFSEVSQTL--DIKKIQQEIAE  229 (1079)
Q Consensus       157 ~~gr~~~~~~l~~~l~~~---~~~vi~I~G~gGiGKTtLa~~v~~--~~~~~~~F~~~~wv~~~~~~--~~~~~~~~i~~  229 (1079)
                      | ||+.++++|.++|...   +.+||+|+||||+||||||+++|+  +.+++.+|++++||++++..  ++..++..|+.
T Consensus       131 ~-GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~  209 (549)
T 2a5y_B          131 Y-IREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILL  209 (549)
T ss_dssp             C-CCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHH
T ss_pred             C-CchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHH
Confidence            5 9999999999999733   689999999999999999999998  46777899999999999885  89999999999


Q ss_pred             HhCCCcc--------ccchHHHHHHHHHHHHcCCcEEEEEeCCCCccccccccCCCCCCCCCcEEEEEecChhhhhhcC-
Q 044755          230 KLGLVLE--------EETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMG-  300 (1079)
Q Consensus       230 ~l~~~~~--------~~~~~~~~~~l~~~l~~~~~~LlvlDdv~~~~~~~~l~~~l~~~~~gs~iivTtR~~~v~~~~~-  300 (1079)
                      +++....        ..........+.+.+...|||||||||||+..++ .+.     ..+||+||||||++.++..++ 
T Consensus       210 ~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~-----~~~gs~ilvTTR~~~v~~~~~~  283 (549)
T 2a5y_B          210 MLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWA-----QELRLRCLVTTRDVEISNAASQ  283 (549)
T ss_dssp             HHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHH-----HHTTCEEEEEESBGGGGGGCCS
T ss_pred             HHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-ccc-----ccCCCEEEEEcCCHHHHHHcCC
Confidence            9986421        0112223566667776324999999999998754 221     126999999999999998876 


Q ss_pred             CCceEeCCCCCHHHHHHHHHHHhcCCCCChhhHHHHHHHHHHcCCCchHHHHHHHHHhcCChhHHHHHHHHhcCCCcCCC
Q 044755          301 SQKNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNF  380 (1079)
Q Consensus       301 ~~~~~~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~i~~~~~glPlai~~~~~~l~~~~~~~w~~~~~~l~~~~~~~~  380 (1079)
                      ...+|+|++|+.++||+||.+++.....++.+.+++++|+++|+|+||||+++|+.|+.++   |+.+ +.+........
T Consensus       284 ~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~---w~~~-~~l~~~l~~~~  359 (549)
T 2a5y_B          284 TCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT---FEKM-AQLNNKLESRG  359 (549)
T ss_dssp             CEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS---HHHH-HHHHHHHHHHC
T ss_pred             CCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccch---HHHH-HHhHHHhhccc
Confidence            4468999999999999999999854433477888999999999999999999999997663   4333 22211100000


Q ss_pred             CCCchhhhhhHHHhhccCChHHHHHHHH-----------HhcccCCCcchhHHHHHHHhh--ccccccC---CHHHHHHH
Q 044755          381 EGVPAEAYSTIELSFKNLKGEQLKKFFM-----------LCSLLGNSICTSYLFQCCMGL--GILQKAN---KLEDARNK  444 (1079)
Q Consensus       381 ~~~~~~~~~~l~~sy~~L~~~~lk~cf~-----------~~s~fp~~~~~~~li~~w~ae--g~i~~~~---~~~~~~~~  444 (1079)
                         ..++.+++.+||++||++ +|.||+           |||+||.++.++  ++.|+|+  ||+.+..   +.+++.+ 
T Consensus       360 ---~~~i~~~l~~Sy~~L~~~-lk~~f~~Ls~~er~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~-  432 (549)
T 2a5y_B          360 ---LVGVECITPYSYKSLAMA-LQRCVEVLSDEDRSALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVAD-  432 (549)
T ss_dssp             ---SSTTCCCSSSSSSSHHHH-HHHHHHTSCHHHHHHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHH-
T ss_pred             ---HHHHHHHHhcccccccHH-HHHHHhccchhhhhHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHH-
Confidence               235888999999999997 999999           999999777777  8999999  9997532   3444433 


Q ss_pred             HHHHHHHHHhhccccccC--CCCcEeehHHHHHHHHHHhhccC
Q 044755          445 LYALVHELRDSCLLLEGD--SNQQLSMHDVIRDVAISIACRDQ  485 (1079)
Q Consensus       445 ~~~~~~~L~~~~l~~~~~--~~~~~~~Hdlv~~~~~~~~~~~~  485 (1079)
                         ++++|+++||++...  ...+|+|||+||++|++++.+++
T Consensus       433 ---~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          433 ---RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             ---HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             ---HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence               599999999998653  33579999999999999887654

PyMOL of 2a5y

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11	Back alignment and structure

>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ...	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A*	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D*	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D*	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*	Back alignment and structure

>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8}	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A*	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ...	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A*	Back alignment and structure

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii}	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A*	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A	Back alignment and structure

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP}	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C	Back alignment and structure

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*	Back alignment and structure

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*	Back alignment and structure

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1079
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	3e-30
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	5e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	9e-05
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	2e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	6e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.001
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	0.003
d2i3ba1		189	c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57	0.004

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  119 bits (298), Expect = 3e-30
 Identities = 33/252 (13%), Positives = 78/252 (30%), Gaps = 27/252 (10%)

Query: 171 LTDVNVSIVGVYGMGGIGKTTLVKEVARQARE--DKLFDLVVFSEVSQTLDIKKIQQEIA 228
           + D++   + ++G  G GK+ +  +   ++ +     +D +V+ + S T           
Sbjct: 39  MCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98

Query: 229 EKLGLV----------LEEETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFG 278
             L L           +E  T       +   L      L + D++ +   +        
Sbjct: 99  ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW------ 152

Query: 279 DDHKGCKLLLTARDRNVLFRMGSQKN-FSIDILNEEEAWRLFKLMADDHVENRELQSTAT 337
                 + L+T RD  +            +  L  +E +   +          + +    
Sbjct: 153 AQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLN 212

Query: 338 EVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVNFEGVPAEAYSTIELSFKN 397
           +  +   G P  L    ++   K+  +      +L     V  E +          S+K+
Sbjct: 213 KTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECI-------TPYSYKS 265

Query: 398 LKGEQLKKFFML 409
           L    L++   +
Sbjct: 266 L-AMALQRCVEV 276

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1079
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	100.0
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.76
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.58
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.58
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.54
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.53
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.49
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.49
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.46
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.46
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.42
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.42
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.41
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.39
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.38
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.38
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.37
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.34
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.32
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.29
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.23
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.22
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.22
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.2
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.19
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.07
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.06
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.03
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.01
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	99.0
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.92
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.87
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.81
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.64
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	98.61
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	98.58
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	98.54
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	98.53
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	98.51
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.5
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	98.5
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	98.4
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	98.31
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	98.29
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.23
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	98.23
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	98.21
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.2
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	98.13
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	98.09
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	97.99
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	97.93
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	97.92
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	97.92
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.8
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.68
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	97.67
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.61
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.52
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.29
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	96.8
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	96.13
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	95.94
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	95.93
d2qy9a2		211	GTPase domain of the signal recognition particle r	95.84
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.78
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	95.77
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	95.74
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	95.72
d1okkd2		207	GTPase domain of the signal recognition particle r	95.7
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.7
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	95.69
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	95.64
d1ls1a2		207	GTPase domain of the signal sequence recognition p	95.61
d1j8yf2		211	GTPase domain of the signal sequence recognition p	95.55
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	95.54
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	95.44
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.42
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	95.39
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	95.33
d1vmaa2		213	GTPase domain of the signal recognition particle r	95.28
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	95.28
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	95.25
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	95.2
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	95.2
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	95.12
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	95.1
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	94.96
d1xpua3		289	Transcription termination factor Rho, ATPase domai	94.93
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	94.87
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	94.79
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	94.79
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	94.75
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	94.72
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	94.66
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	94.6
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	94.6
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	94.55
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	94.45
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	94.39
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	94.35
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	94.19
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.18
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	94.08
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	93.86
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	93.84
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	93.77
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	93.68
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	93.65
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	93.63
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	93.6
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	93.55
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	93.42
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	93.34
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	93.29
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	92.88
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	92.79
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	92.76
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	92.73
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	92.72
d1fx0a3		276	Central domain of alpha subunit of F1 ATP synthase	92.58
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	92.56
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	92.55
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	92.38
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	92.21
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	92.16
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	92.11
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	92.03
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	92.02
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	91.81
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	91.48
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	91.47
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	91.15
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	91.11
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	91.05
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	90.94
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	90.86
d2jdia3		285	Central domain of alpha subunit of F1 ATP synthase	90.83
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	90.51
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	90.47
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	90.24
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	90.18
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	89.63
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	89.51
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	89.45
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	89.14
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	89.08
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	88.98
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	88.94
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	88.86
d1g2912		240	Maltose transport protein MalK, N-terminal domain	88.76
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	88.75
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	88.68
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	88.51
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	88.38
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	88.35
d2awna2		232	Maltose transport protein MalK, N-terminal domain	88.33
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	88.31
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	88.25
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	88.23
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	88.19
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	88.12
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	88.12
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	88.11
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	88.07
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	87.94
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	87.91
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	87.69
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	87.66
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	87.47
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	87.47
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	87.36
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	87.31
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	87.28
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	87.27
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	87.26
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	87.14
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	87.1
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	87.04
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	86.98
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	86.9
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	86.8
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	86.71
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	86.7
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	86.65
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	86.65
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	86.64
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	86.58
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	86.54
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	86.51
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	86.49
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	86.44
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	86.21
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	86.21
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	86.17
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	86.09
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	86.04
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	86.04
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	85.96
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	85.89
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	85.85
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	85.84
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	85.83
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	85.79
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	85.52
d1nrjb_		209	Signal recognition particle receptor beta-subunit	85.5
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	85.5
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	85.42
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	85.4
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	85.28
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	85.24
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	85.13
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	85.07
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	84.95
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	84.91
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	84.88
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	84.8
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	84.78
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	84.78
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	84.74
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	84.66
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	84.5
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	84.49
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	84.13
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	84.07
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	83.96
d2fh5b1		207	Signal recognition particle receptor beta-subunit	83.95
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	83.93
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	83.8
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	83.8
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	83.7
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	83.5
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	83.4
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	83.38
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	83.24
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	83.21
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	82.94
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	82.88
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	82.83
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	82.67
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	82.6
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	82.39
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	82.23
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	82.2
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	81.62
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	81.49
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	81.28
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	81.24
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	81.21
d2fu5c1		173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	80.74
d1puia_		188	Probable GTPase EngB {Escherichia coli [TaxId: 562	80.63
d1azta2		221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	80.47

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=2.5e-38  Score=336.40  Aligned_cols=241  Identities=13%  Similarity=0.115  Sum_probs=192.4

Q ss_pred             ccccHHHHHHHHHHHhc---CCCceEEEEEcCCCCcHHHHHHHHHHHhh--hcCCCCEEEEEEeCCccCHHHHHHHHHHH
Q 044755          156 AFESRLCALKSVQNALT---DVNVSIVGVYGMGGIGKTTLVKEVARQAR--EDKLFDLVVFSEVSQTLDIKKIQQEIAEK  230 (1079)
Q Consensus       156 ~~~gr~~~~~~l~~~l~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~~~~~~~~~~~~~~i~~~  230 (1079)
                      .++||+.++++|+++|.   +.+.++|+|+||||+||||||+++|++..  .+.+|++++||++++.++...+...+...
T Consensus        21 ~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~  100 (277)
T d2a5yb3          21 TCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDIL  100 (277)
T ss_dssp             CSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHH
T ss_pred             ceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHH
Confidence            46699999999999986   45688999999999999999999999854  56789999999999998877777666443


Q ss_pred             h---CCCcc-------ccchHHHHHHHHHHHHcCCcEEEEEeCCCCccccccccCCCCCCCCCcEEEEEecChhhhhhcC
Q 044755          231 L---GLVLE-------EETGSRRASRLYERLKKEEKILIILDNIWKCVDLEAVGIPFGDDHKGCKLLLTARDRNVLFRMG  300 (1079)
Q Consensus       231 l---~~~~~-------~~~~~~~~~~l~~~l~~~~~~LlvlDdv~~~~~~~~l~~~l~~~~~gs~iivTtR~~~v~~~~~  300 (1079)
                      +   +....       ..........+......++|+|+||||||+..+|+.+..      .|||||||||+..++..+.
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~  174 (277)
T d2a5yb3         101 LMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAAS  174 (277)
T ss_dssp             HHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCC
T ss_pred             HHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcC
Confidence            3   22111       111122222233333457999999999999988876532      4899999999999998865


Q ss_pred             CC-ceEeCCCCCHHHHHHHHHHHhcCCCCChhhHHHHHHHHHHcCCCchHHHHHHHHHhcCChhHHHHHHHHhcCCCcCC
Q 044755          301 SQ-KNFSIDILNEEEAWRLFKLMADDHVENRELQSTATEVAQACKGLPIALTTIARALRNKSVPEWKSALQELRMPSEVN  379 (1079)
Q Consensus       301 ~~-~~~~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~i~~~~~glPlai~~~~~~l~~~~~~~w~~~~~~l~~~~~~~  379 (1079)
                      .. ..|++++|+.+|||+||.+++......+..++++++|+++|+|+||||+++|+.|+.++.++|....+.|....   
T Consensus       175 ~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~---  251 (277)
T d2a5yb3         175 QTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG---  251 (277)
T ss_dssp             SCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC---
T ss_pred             CCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCc---
Confidence            54 68999999999999999998865455566788999999999999999999999999889999999888774321   


Q ss_pred             CCCCchhhhhhHHHhhccCChHHHHHHHHHh
Q 044755          380 FEGVPAEAYSTIELSFKNLKGEQLKKFFMLC  410 (1079)
Q Consensus       380 ~~~~~~~~~~~l~~sy~~L~~~~lk~cf~~~  410 (1079)
                          ..++.+++.+||++||++ +|+||.++
T Consensus       252 ----~~~v~~il~~sY~~L~~~-lk~c~~~l  277 (277)
T d2a5yb3         252 ----LVGVECITPYSYKSLAMA-LQRCVEVL  277 (277)
T ss_dssp             ----SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             ----HHHHHHHHHHHHhcccHH-HHHHHHhC
Confidence                234888999999999998 99999874

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure