Citrus Sinensis ID: 044767
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 656 | 2.2.26 [Sep-21-2011] | |||||||
| Q6PDQ2 | 1915 | Chromodomain-helicase-DNA | yes | no | 0.085 | 0.029 | 0.475 | 2e-10 | |
| O97159 | 1982 | Chromodomain-helicase-DNA | yes | no | 0.067 | 0.022 | 0.586 | 2e-10 | |
| Q8TDI0 | 1954 | Chromodomain-helicase-DNA | yes | no | 0.085 | 0.028 | 0.533 | 2e-10 | |
| Q14839 | 1912 | Chromodomain-helicase-DNA | no | no | 0.085 | 0.029 | 0.475 | 2e-10 | |
| O16102 | 892 | Chromodomain-helicase-DNA | no | no | 0.083 | 0.061 | 0.508 | 3e-10 | |
| Q12873 | 2000 | Chromodomain-helicase-DNA | no | no | 0.085 | 0.028 | 0.5 | 1e-09 | |
| Q924W6 | 1242 | Tripartite motif-containi | no | no | 0.102 | 0.053 | 0.405 | 1e-09 | |
| O15016 | 1216 | Tripartite motif-containi | no | no | 0.091 | 0.049 | 0.435 | 9e-09 | |
| Q6E2N3 | 1163 | E3 ubiquitin-protein liga | no | no | 0.064 | 0.036 | 0.545 | 2e-08 | |
| O88491 | 2588 | Histone-lysine N-methyltr | no | no | 0.126 | 0.032 | 0.343 | 2e-08 |
| >sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 68.6 bits (166), Expect = 2e-10, Method: Compositional matrix adjust.
Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 5/61 (8%)
Query: 322 GSNRMKSNSHQVETYDMCVVCLDGGELICCDHCPCMYHSSCLG--LKDIPYGDWFCPLCC 379
G + + + H +E C VC DGGEL+CCD CP YH CL L +IP G+W CP C
Sbjct: 431 GGDPEEEDDHHME---FCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT 487
Query: 380 C 380
C
Sbjct: 488 C 488
|
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Mus musculus (taxid: 10090) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2 |
| >sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q924W6|TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus GN=Trim66 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O15016|TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 656 | ||||||
| 359478537 | 1332 | PREDICTED: uncharacterized protein LOC10 | 0.942 | 0.463 | 0.441 | 1e-138 | |
| 297745878 | 994 | unnamed protein product [Vitis vinifera] | 0.931 | 0.614 | 0.433 | 1e-132 | |
| 224067206 | 923 | predicted protein [Populus trichocarpa] | 0.868 | 0.617 | 0.424 | 1e-126 | |
| 449450934 | 1317 | PREDICTED: uncharacterized protein LOC10 | 0.678 | 0.337 | 0.501 | 1e-121 | |
| 297745879 | 687 | unnamed protein product [Vitis vinifera] | 0.658 | 0.628 | 0.515 | 1e-119 | |
| 356541753 | 1120 | PREDICTED: uncharacterized protein LOC10 | 0.961 | 0.563 | 0.383 | 1e-118 | |
| 224105951 | 978 | predicted protein [Populus trichocarpa] | 0.896 | 0.601 | 0.389 | 1e-113 | |
| 357490843 | 1144 | Chromodomain helicase-DNA-binding protei | 0.635 | 0.364 | 0.474 | 1e-113 | |
| 255571928 | 853 | conserved hypothetical protein [Ricinus | 0.699 | 0.538 | 0.475 | 1e-112 | |
| 297796793 | 1047 | hypothetical protein ARALYDRAFT_358079 [ | 0.957 | 0.599 | 0.375 | 1e-110 |
| >gi|359478537|ref|XP_002278840.2| PREDICTED: uncharacterized protein LOC100243375 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 499 bits (1285), Expect = e-138, Method: Compositional matrix adjust.
Identities = 296/671 (44%), Positives = 391/671 (58%), Gaps = 53/671 (7%)
Query: 1 MRLKARNHLLALNWKLWYAQKGGYKQEIRYTSPNQKTFYSLRTACRSLIDEQ-CSQNLTL 59
++ KA+ HL + W WYA + G K+E+RY SP K +YSLRTAC+ +DE S+ +
Sbjct: 602 LKSKAKKHLSFMGWTFWYAYRRG-KREMRYFSPKGKCYYSLRTACKGCMDEGGASEGTST 660
Query: 60 NLNANPAVNLHAKAESESMDFGDLGQEENHARHAKRACRFDEGSQNLTHNLRANLEEKSV 119
N +N+ A LGQE + A R ++ +L E++V
Sbjct: 661 TWNPVKTMNVSEVA---------LGQELSSALIDMR--------------MQNSLIEQNV 697
Query: 120 MVTPQTSQSSSDDALHSR------KRRKKN----TEVNLHAKAEAESMDFGNLGQEDDNA 169
+SSS L S+ K+R T +L + ++ D +G D
Sbjct: 698 PSAKWPIKSSSISQLKSKEISAVTKKRHDGLHGVTSNSLQSWTQSTGKDGFGIGLVGDRE 757
Query: 170 RRAKPGRRRGKEKRKGIANSMTSRDDQKKSAVKHTHVRISGKQERQKVLPRFSVCNPRAV 229
R + K K N S+ + + + T V S K+ RQ ++P S NPR +
Sbjct: 758 LRHPKDKNVCFSKLK---NGKGSKALMRLNGLDGTRVLRSRKRARQVLIPG-SSNNPRTI 813
Query: 230 VLSKLIENNVVFPGAKVCYGGKKGRVPLAKGSITNGGIKCNCCNEVFTLTGFEVHAGSKN 289
LS LI+NNVV P AKV Y ++ P+A G IT GIKC+CC EVF+L+ FE HAGS
Sbjct: 814 -LSWLIDNNVVLPRAKVHYSSRRDHHPMADGRITRDGIKCSCCQEVFSLSRFEAHAGSSY 872
Query: 290 HRPAANIFLEDGRSLVDCLRHMVS--TDNTAIVKGSNRMKSNSHQVETYDMCVVCLDGGE 347
HR AANIFLEDGRSL++C ++ T + +R KSN E +C VC GG+
Sbjct: 873 HRSAANIFLEDGRSLLECQMQIIRDITGKGFTKESFSRKKSNERHHENDHICSVCHYGGD 932
Query: 348 LICCDHCPCMYHSSCLGLKDIPYGDWFCPLCCCAICGDGKFKQRTLHSVDDDDGLVRTCD 407
L+ CDHCP +H SCLGLK +P GDWFCP CCC ICG+ KF + + D +V +C
Sbjct: 933 LVLCDHCPSSFHKSCLGLKTLPEGDWFCPSCCCGICGENKFDGGS-----EQDNVVFSCY 987
Query: 408 QCEHKFHTGCTRK-SKRELKVKSQNKWFCSDRCEHVFSSLHELIGKPFSISENNLNWRLL 466
QCE + C RK +L WFCS +C+ +F L +L+GK F + +NL W LL
Sbjct: 988 QCERQC---CLRKWGHVKLASYPNGTWFCSKQCKKIFLGLQKLLGKSFPVGVDNLTWTLL 1044
Query: 467 KSLESDHQDVSNPTDGKFLKELQRKLHGAVEVMHECFEPAKEPLTGRDLIEDVIFNRRSE 526
K + S ++ P D + L E+ KL+ A+ VMHECFEP KEP T RD++EDVIF R S+
Sbjct: 1045 KPIRSKGLEIDLP-DIEALTEVYSKLNIALGVMHECFEPVKEPHTRRDVVEDVIFCRGSD 1103
Query: 527 LKHLNYVGFYTVVLEKKRKIISAATVRVY-EKVAEIPFVATMFKYRRNGMCRLLMAELEK 585
L LN+ GFYTV+LE+ ++IS ATVRVY EKVAE+P + T F+YRR GMC +LM ELEK
Sbjct: 1104 LNRLNFQGFYTVLLERNDELISVATVRVYGEKVAEVPLIGTRFQYRRLGMCHILMNELEK 1163
Query: 586 QLIALGVERLVLPSAPSVLNAWTTKFGFSKMTASERLNYLNYTFLDFQGTIMCQKFLMKT 645
+L+ LGVERLVLP+ PSVLN WTT FGFSKMT SERL +L+Y+FLDFQ T+MCQK LMK
Sbjct: 1164 KLMELGVERLVLPAVPSVLNTWTTSFGFSKMTDSERLRFLDYSFLDFQDTVMCQKLLMKI 1223
Query: 646 PSASPCLSQAA 656
P A S A
Sbjct: 1224 PLAKSNQSTGA 1234
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297745878|emb|CBI15934.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224067206|ref|XP_002302408.1| predicted protein [Populus trichocarpa] gi|222844134|gb|EEE81681.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449450934|ref|XP_004143217.1| PREDICTED: uncharacterized protein LOC101206451 [Cucumis sativus] gi|449525537|ref|XP_004169773.1| PREDICTED: uncharacterized LOC101206451 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297745879|emb|CBI15935.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356541753|ref|XP_003539338.1| PREDICTED: uncharacterized protein LOC100814680 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224105951|ref|XP_002313990.1| predicted protein [Populus trichocarpa] gi|222850398|gb|EEE87945.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357490843|ref|XP_003615709.1| Chromodomain helicase-DNA-binding protein [Medicago truncatula] gi|355517044|gb|AES98667.1| Chromodomain helicase-DNA-binding protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255571928|ref|XP_002526906.1| conserved hypothetical protein [Ricinus communis] gi|223533745|gb|EEF35478.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297796793|ref|XP_002866281.1| hypothetical protein ARALYDRAFT_358079 [Arabidopsis lyrata subsp. lyrata] gi|297312116|gb|EFH42540.1| hypothetical protein ARALYDRAFT_358079 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 656 | ||||||
| TAIR|locus:2201021 | 1138 | AT1G05380 "AT1G05380" [Arabido | 0.647 | 0.373 | 0.349 | 1.4e-69 | |
| TAIR|locus:2147391 | 1179 | AT5G36740 [Arabidopsis thalian | 0.621 | 0.346 | 0.339 | 1.6e-65 | |
| TAIR|locus:2086395 | 1189 | ROS4 "AT3G14980" [Arabidopsis | 0.664 | 0.366 | 0.342 | 1.7e-64 | |
| TAIR|locus:2163961 | 557 | AT5G63900 "AT5G63900" [Arabido | 0.338 | 0.398 | 0.438 | 6.2e-64 | |
| TAIR|locus:2832118 | 1193 | AT5G36670 [Arabidopsis thalian | 0.618 | 0.340 | 0.316 | 9.9e-56 | |
| TAIR|locus:2178828 | 1065 | AT5G58610 "AT5G58610" [Arabido | 0.391 | 0.241 | 0.430 | 9.6e-51 | |
| TAIR|locus:2040550 | 1007 | AT2G36720 "AT2G36720" [Arabido | 0.355 | 0.231 | 0.319 | 2.9e-39 | |
| UNIPROTKB|F1NBP6 | 1025 | F1NBP6 "Uncharacterized protei | 0.161 | 0.103 | 0.330 | 3.5e-10 | |
| FB|FBgn0023395 | 892 | Chd3 "Chd3" [Drosophila melano | 0.082 | 0.060 | 0.517 | 7.4e-09 | |
| UNIPROTKB|F2Z2R5 | 1225 | CHD5 "Chromodomain-helicase-DN | 0.085 | 0.045 | 0.533 | 1.1e-08 |
| TAIR|locus:2201021 AT1G05380 "AT1G05380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 712 (255.7 bits), Expect = 1.4e-69, P = 1.4e-69
Identities = 153/438 (34%), Positives = 238/438 (54%)
Query: 209 SGKQERQKVLPRFSVCNPRAVVLSKLIENNVVFPGAKVCYGGKKGRVPLAKGSITNGGIK 268
S K ++ + F+ + + +LS LIE+ VV KV Y ++G + +G IT GI
Sbjct: 499 SSKDKKNPAINGFNPYSGKRTLLSWLIESGVVQLRQKVQYMRRRGAKVMLEGWITREGIH 558
Query: 269 CNCCNEVFTLTGFEVHAGSKNHRPAANIFLEDGRSLVDCLRHMVSTDNTAIVKGSNRMKS 328
C+CC+++ T++ FE+HAGSK+ +P NI+LE G SL+ C + A +++ +
Sbjct: 559 CDCCSKILTVSRFEIHAGSKSCQPFQNIYLESGASLLQCQVRAWNMQKDATNLALHQVDT 618
Query: 329 NSHQVETYDMCVVCLDGGELICCDHCPCMYHSSCLGLKDIPYGDWFCPLCCCAICGDGKF 388
+ D C +C DGG+LICCD CP YH +CLG++ +P GDW CP C C C D
Sbjct: 619 DGDDPND-DACGICGDGGDLICCDGCPSTYHQNCLGMQVLPSGDWHCPNCTCKFC-DA-- 674
Query: 389 KQRTLHSVDDDDGLVR--TCDQCEHKFHTGCTRKSKRELKVKSQNKWFCSDRCEHVFSSL 446
+ S D + +C CE ++H C +++ FC +C +F L
Sbjct: 675 ---AVASGGKDGNFISLLSCGMCERRYHQLCLNDEAHKVQSFGSASSFCGPKCLELFEKL 731
Query: 447 HELIGKPFSISENNLNWRLLKSLESDHQDVSNPTDGKFLKELQRKLHGAVEVMHECFEPA 506
+ +G I E +W L+ +++D D ++ + + E KL + +M ECF P
Sbjct: 732 QKYLGVKTEI-EGGYSWSLIHRVDTD-SDTNSQMSAQRI-ENNSKLAVGLAIMDECFLPI 788
Query: 507 KEPLTGRDLIEDVIFNRRSELKHLNYVGFYTVVLEKKRKIISAATVRVYE-KVAEIPFVA 565
+ +G DLI +V++N S +NY GFYT +LE+ +IISAA++R + ++AE+PF+
Sbjct: 789 VDRRSGVDLIRNVLYNCGSNFNRINYTGFYTAILERGDEIISAASLRFHGMQLAEMPFIG 848
Query: 566 TMFKYRRNGMCRLLMAELEKQLIALGVERLVLPSAPSVLNAWTTKFGFSKMTASERLNYL 625
T YRR GMCR L +E + +L VE+LV+P+ P L+AWT FGF+ + S R
Sbjct: 849 TRHIYRRQGMCRRLFDAIESAMRSLKVEKLVIPAIPDFLHAWTGNFGFTPLDDSVRKEMR 908
Query: 626 NYTFLDFQGTIMCQKFLM 643
+ L F G M QK L+
Sbjct: 909 SLNTLVFPGIDMLQKPLL 926
|
|
| TAIR|locus:2147391 AT5G36740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086395 ROS4 "AT3G14980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163961 AT5G63900 "AT5G63900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2832118 AT5G36670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178828 AT5G58610 "AT5G58610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040550 AT2G36720 "AT2G36720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBP6 F1NBP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0023395 Chd3 "Chd3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z2R5 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00024076001 | SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (1186 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 656 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 6e-09 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 8e-08 | |
| COG5141 | 669 | COG5141, COG5141, PHD zinc finger-containing prote | 2e-06 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 2e-04 | |
| pfam13508 | 79 | pfam13508, Acetyltransf_7, Acetyltransferase (GNAT | 5e-04 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 0.003 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 51.7 bits (124), Expect = 6e-09
Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 7/50 (14%)
Query: 339 CVVCL---DGGELICCDHCPCMYHSSCLGL----KDIPYGDWFCPLCCCA 381
C VC D GEL+ CD C +H +CLG ++IP G+W+CP C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKPK 51
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 656 | |||
| PRK10314 | 153 | putative acyltransferase; Provisional | 99.44 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.35 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.27 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.24 | |
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 99.23 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.2 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 99.18 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.17 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 99.16 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.14 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.11 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 99.1 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.07 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 99.02 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 99.01 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.01 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.0 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 98.99 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.98 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.95 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 98.95 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 98.92 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 98.92 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 98.9 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 98.85 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 98.82 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 98.82 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 98.81 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.8 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 98.76 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.75 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.73 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.73 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 98.7 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 98.69 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 98.69 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 98.68 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 98.68 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 98.67 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.65 | |
| KOG3396 | 150 | consensus Glucosamine-phosphate N-acetyltransferas | 98.6 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 98.58 | |
| PHA01807 | 153 | hypothetical protein | 98.54 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 98.52 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 98.52 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 98.44 | |
| smart00258 | 73 | SAND SAND domain. | 98.38 | |
| KOG3397 | 225 | consensus Acetyltransferases [General function pre | 98.36 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.36 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 98.35 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 98.34 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 98.33 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 98.25 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 98.23 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 98.22 | |
| PF01342 | 82 | SAND: SAND domain; InterPro: IPR000770 The SAND do | 98.17 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 98.15 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.14 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 98.14 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 98.1 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 98.1 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.08 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 98.04 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 98.02 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 97.99 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.9 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 97.89 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.86 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.85 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.84 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.81 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.81 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.81 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 97.8 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 97.78 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.71 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 97.61 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.56 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 97.55 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 97.54 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.51 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 97.5 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 97.48 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 97.46 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.4 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.2 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 97.19 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 97.03 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.85 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 96.83 | |
| KOG4144 | 190 | consensus Arylalkylamine N-acetyltransferase [Gene | 96.79 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 96.77 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 96.68 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 96.62 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 96.61 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 96.52 | |
| KOG3234 | 173 | consensus Acetyltransferase, (GNAT) family [Genera | 96.5 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 96.49 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 96.48 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 96.47 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 96.33 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 96.2 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 96.13 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.07 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 96.03 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 95.98 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 95.66 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 95.51 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.04 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 95.02 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 94.95 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 94.72 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 93.85 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 93.75 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 93.17 | |
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 92.59 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 92.53 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 91.78 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 91.58 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 91.27 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 90.66 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 89.72 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 89.55 | |
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 88.44 | |
| COG5628 | 143 | Predicted acetyltransferase [General function pred | 88.0 | |
| PF07227 | 446 | DUF1423: Protein of unknown function (DUF1423); In | 87.85 | |
| KOG4135 | 185 | consensus Predicted phosphoglucosamine acetyltrans | 87.23 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 87.12 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 86.08 | |
| KOG2535 | 554 | consensus RNA polymerase II elongator complex, sub | 85.99 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 85.76 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 81.62 | |
| PF13444 | 101 | Acetyltransf_5: Acetyltransferase (GNAT) domain | 81.61 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 81.05 | |
| KOG1081 | 463 | consensus Transcription factor NSD1 and related SE | 81.0 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 80.68 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 80.65 |
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
Probab=99.44 E-value=5.7e-13 Score=127.64 Aligned_cols=96 Identities=14% Similarity=0.070 Sum_probs=85.3
Q ss_pred eEEEEEeeCCeEEEEEEEEEe-C--ceeeEeEEEeccCcccCChHHHHHHHHHHHHHHc-CCcEEEEcCccchHHHhHhc
Q 044767 535 FYTVVLEKKRKIISAATVRVY-E--KVAEIPFVATMFKYRRNGMCRLLMAELEKQLIAL-GVERLVLPSAPSVLNAWTTK 610 (656)
Q Consensus 535 ~y~~VLe~dg~iVg~a~lr~~-~--~~AEI~~VAv~~~yRgqG~Gr~Lm~~lE~~l~~~-gv~~l~L~A~~~a~~fw~~k 610 (656)
.+|+++..++++||+++++.. . ..++|.+|+|+|+|||+|+|+.||+++++.++.. +...+.|.|+..|.+||+ +
T Consensus 48 ~~h~~~~~~~~~vg~~r~~~~~~~~~~~~i~rv~V~~~~rG~GiG~~Lm~~~~~~~~~~~~~~~i~L~a~~~a~~fY~-k 126 (153)
T PRK10314 48 NRHILGWKNDELVAYARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLESCTRHWPDKPVYLGAQAHLQNFYQ-S 126 (153)
T ss_pred cEEEEEEECCEEEEEEEEecCCCCCCCEEEEEEEECHHHhCCCHHHHHHHHHHHHHHHHCCCCcEEEehHHHHHHHHH-H
Confidence 677888889999999998765 2 2578999999999999999999999999998875 788999999999999999 7
Q ss_pred CCceecChHHHhccccceeEe
Q 044767 611 FGFSKMTASERLNYLNYTFLD 631 (656)
Q Consensus 611 fGF~~~~~~~~~~~~~~~~m~ 631 (656)
|||..+++......+.|..|.
T Consensus 127 ~GF~~~g~~f~~~Gi~h~~M~ 147 (153)
T PRK10314 127 FGFIPVTEVYEEDGIPHIGMA 147 (153)
T ss_pred CCCEECCCccccCCCCcHhhh
Confidence 999999998888888877665
|
|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00258 SAND SAND domain | Back alignment and domain information |
|---|
| >KOG3397 consensus Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF01342 SAND: SAND domain; InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG5628 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] | Back alignment and domain information |
|---|
| >KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
| >PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 656 | ||||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 3e-08 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 7e-07 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 9e-07 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 1e-06 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 2e-06 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 3e-06 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 4e-06 | ||
| 4gnd_A | 107 | Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains | 7e-05 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 9e-04 |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
|
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
Score = 80.1 bits (198), Expect = 5e-19
Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
Query: 337 DMCVVCLDGGELICCDHCPCMYHSSCLG--LKDIPYGDWFCPLCCCAIC 383
+ C VC DGGEL+CCD CP YH CL L +IP G+W CP C C
Sbjct: 10 EFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPAL 58
|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140 | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Length = 147 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 656 | |||
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.8 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.76 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.71 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.7 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.44 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.43 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.37 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.36 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.36 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.36 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.36 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.35 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.34 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.34 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.34 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.33 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.32 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.31 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.31 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.3 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.3 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.3 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.29 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.29 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.29 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.28 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.27 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.27 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 99.27 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.27 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.27 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.26 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.25 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.24 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.24 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.24 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.24 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.24 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.24 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.24 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.24 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.23 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.23 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.22 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.22 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.22 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.21 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.21 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 99.2 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.19 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.19 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.19 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.18 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.18 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.18 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.17 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.17 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.17 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.17 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.17 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 99.17 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.16 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 99.16 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.16 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.16 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 99.16 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.16 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.16 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.15 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.14 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.14 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.14 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.13 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.13 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.13 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 99.13 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.12 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.12 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.12 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 99.12 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 99.12 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.12 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.12 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.11 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.11 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.1 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.1 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.1 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.1 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.08 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.08 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 99.08 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.07 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.06 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.05 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 99.05 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.05 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.05 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.05 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 99.04 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.04 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.02 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.02 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.02 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 99.02 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.01 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.01 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.0 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.0 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.0 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 99.0 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.99 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 98.99 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 98.99 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.97 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 98.97 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 98.97 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 98.97 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 98.96 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 98.96 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 98.96 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 98.95 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 98.95 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.95 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 98.94 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 98.94 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 98.92 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.92 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 98.92 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 98.91 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 98.9 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.9 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.9 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 98.89 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 98.89 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 98.89 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 98.88 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 98.88 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 98.88 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 98.88 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 98.87 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 98.87 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.87 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 98.87 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 98.86 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 98.85 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 98.85 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 98.85 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 98.84 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 98.84 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 98.83 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.82 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 98.82 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 98.82 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.82 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 98.81 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 98.81 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 98.81 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.78 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.78 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 98.78 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.77 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 98.74 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 98.74 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 98.72 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 98.72 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.71 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 98.71 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 98.7 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 98.7 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 98.7 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.7 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.69 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.68 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.66 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 98.63 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 98.62 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.61 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.6 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.59 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.55 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.53 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 98.52 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.51 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.49 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.48 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.48 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.47 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.46 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.46 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.45 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.45 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 98.44 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.42 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 98.42 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.42 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.38 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.38 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.36 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.34 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.34 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.34 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.33 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.33 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.28 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.23 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 98.21 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 98.19 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.17 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.14 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.1 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.07 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.06 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.04 | |
| 1ufn_A | 94 | Putative nuclear protein homolog 5830484A20RIK; SA | 97.99 | |
| 1h5p_A | 95 | Nuclear autoantigen SP100-B; transcription, DNA bi | 97.98 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.94 | |
| 1oqj_A | 97 | Glucocorticoid modulatory element binding protein- | 97.86 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.83 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.8 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.65 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.56 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 97.54 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.49 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 97.48 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.43 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.39 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.39 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.34 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.34 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.34 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.3 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.28 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.27 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.25 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.23 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 97.21 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.14 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.14 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 97.12 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.05 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 97.05 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.0 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 97.0 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.99 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 96.92 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 96.87 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 96.87 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.75 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.73 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 96.61 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 96.55 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.34 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.33 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.21 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 96.16 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 96.1 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 96.09 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 96.05 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 95.77 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 95.53 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 95.5 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.23 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 95.13 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 95.01 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 94.87 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 94.71 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 94.53 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 93.33 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 92.91 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 92.84 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 92.79 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 91.95 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 89.59 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 87.21 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 87.07 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 86.93 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 86.73 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 85.18 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 85.12 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 84.91 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 84.27 | |
| 3s6g_A | 460 | N-acetylglutamate kinase / N-acetylglutamate SYNT; | 83.02 | |
| 1iyk_A | 392 | Myristoyl-COA:protein N-myristoyltransferase; HET: | 82.86 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 81.78 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 80.96 |
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.80 E-value=3.4e-20 Score=167.28 Aligned_cols=96 Identities=30% Similarity=0.779 Sum_probs=84.4
Q ss_pred CCccccccccccccCCce---EeecCCCCccCCCCcCCC--CCCCCCCcCCCCC-ccccCCCCCCCCccccccCCCCccc
Q 044767 331 HQVETYDMCVVCLDGGEL---ICCDHCPCMYHSSCLGLK--DIPYGDWFCPLCC-CAICGDGKFKQRTLHSVDDDDGLVR 404 (656)
Q Consensus 331 ~~~~ndd~C~vC~dgGeL---l~Cd~CprafH~~Cl~l~--~~p~g~W~C~~C~-C~iCg~~~~~~~~~~~v~~~~~~ll 404 (656)
+...|+++|.+|+++|++ ++|+.|+++||..|+++. .++.+.|+|+.|. |.+|+..+ ++..++
T Consensus 2 s~~~~~~~C~~C~~~g~~~~ll~C~~C~~~~H~~Cl~~~~~~~~~~~W~C~~C~~C~~C~~~~-----------~~~~ll 70 (111)
T 2ysm_A 2 SSGSSGANCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSG-----------EDSKML 70 (111)
T ss_dssp CCCCCCSCBTTTCCCCCTTTSEECSSSCCEECTTTTTCCCCTTTSTTCCCTTTCCCTTTCCCS-----------CCTTEE
T ss_pred CCCCCCCCCcCCCCCCCCcCCeECCCCCCCcChHHhCCccccccccCccCCcCCcccccCccC-----------CCCCee
Confidence 356799999999999886 999999999999999954 4567999999995 99999865 456799
Q ss_pred cccccccccccccccccccceeeccCCcccccchhhh
Q 044767 405 TCDQCEHKFHTGCTRKSKRELKVKSQNKWFCSDRCEH 441 (656)
Q Consensus 405 ~CdqC~r~yH~~Cl~~~~~~l~~~p~g~WfC~~~C~~ 441 (656)
.|+.|+++||..|++| ++.++|.+.|||+. |..
T Consensus 71 ~Cd~C~~~yH~~Cl~p---pl~~~P~g~W~C~~-C~~ 103 (111)
T 2ysm_A 71 VCDTCDKGYHTFCLQP---VMKSVPTNGWKCKN-CRI 103 (111)
T ss_dssp ECSSSCCEEEGGGSSS---CCSSCCSSCCCCHH-HHC
T ss_pred ECCCCCcHHhHHhcCC---ccccCCCCCcCCcC-CcC
Confidence 9999999999999998 78889999999996 864
|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufn_A Putative nuclear protein homolog 5830484A20RIK; SAND domain, KDWK motif, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >1h5p_A Nuclear autoantigen SP100-B; transcription, DNA binding, SAND domain, KDWK, nuclear protein, alternative splicing; NMR {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oqj_A Glucocorticoid modulatory element binding protein-1; SAND domain, alpha-beta fold, KDWK motif, zinc-binding motif, DNA binding protein; 1.55A {Homo sapiens} SCOP: d.217.1.1 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* | Back alignment and structure |
|---|
| >1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 656 | ||||
| d1ygha_ | 164 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 6e-15 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 6e-13 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 1e-12 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 1e-10 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 2e-10 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 1e-09 | |
| d1qsra_ | 162 | d.108.1.1 (A:) Catalytic domain of GCN5 histone ac | 7e-09 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 1e-08 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 0.003 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 9e-08 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 1e-07 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 3e-07 | |
| d2atra1 | 137 | d.108.1.1 (A:1-137) Probable acetyltransferase SP0 | 6e-06 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 2e-05 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 0.001 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 6e-05 |
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 70.5 bits (172), Expect = 6e-15
Identities = 29/153 (18%), Positives = 54/153 (35%), Gaps = 16/153 (10%)
Query: 492 LHGAVEVMHECFEPAKEPLTGRDLIEDVIFNRRSELKHLNYVGFYTVVLEKKRKIISAAT 551
L G + + P ++ I ++++R V+ K ++ T
Sbjct: 19 LTGLKNIFQKQL-----PKMPKEYIARLVYDRSHL---------SMAVIRKPLTVVGGIT 64
Query: 552 VRVY--EKVAEIPFVATMFKYRRNGMCRLLMAELEKQLIALGVERLVLPSAPSVLNAWTT 609
R + + AEI F A + G LM L+ + + L A + +
Sbjct: 65 YRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFK 124
Query: 610 KFGFSKMTASERLNYLNYTFLDFQGTIMCQKFL 642
K GF+K ++ ++ Y GT+M L
Sbjct: 125 KQGFTKEITLDKSIWMGYIKDYEGGTLMQCSML 157
|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 656 | |||
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.64 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.62 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.62 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.6 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.59 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.54 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.46 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.45 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.43 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.38 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.35 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.34 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.31 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.3 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.27 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.26 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.25 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.24 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.23 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.21 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.21 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.19 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.18 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.16 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 99.16 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.15 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.15 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.13 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.11 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.11 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.11 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.11 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.1 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.09 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.08 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.05 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.05 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.02 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.0 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 98.97 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 98.95 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.94 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.92 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 98.9 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 98.9 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.85 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.83 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 98.83 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 98.81 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.77 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 98.75 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.64 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 98.59 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.42 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 98.41 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 98.35 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 98.22 | |
| d1ufna_ | 94 | Putative nuclear protein homolog 5830484a20rik {Mo | 98.21 | |
| d1oqja_ | 90 | Glucocorticoid modulatory element binding protein- | 98.21 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.2 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.18 | |
| d1h5pa_ | 95 | Nuclear autoantigen Sp100b {Human (Homo sapiens) [ | 98.12 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 98.09 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.07 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.04 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 98.03 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.0 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.92 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 97.75 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 97.58 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.54 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 97.51 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.44 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.37 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.3 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.3 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 97.19 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.06 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 96.98 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 96.97 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.95 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.77 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 96.58 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.95 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 95.21 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 94.59 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 93.72 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 92.31 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 91.11 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 90.68 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 88.96 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 87.56 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 87.42 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 87.01 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 83.93 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 82.83 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 80.98 |
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Catalytic domain of GCN5 histone acetyltransferase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.64 E-value=9.9e-16 Score=144.61 Aligned_cols=137 Identities=23% Similarity=0.344 Sum_probs=107.2
Q ss_pred HHHHhhHHHHHhhhcCCCCCCCchhhhHHHHHhhhccccccccccceEEEEEeeCCeEEEEEEEEEe--CceeeEeEEEe
Q 044767 489 QRKLHGAVEVMHECFEPAKEPLTGRDLIEDVIFNRRSELKHLNYVGFYTVVLEKKRKIISAATVRVY--EKVAEIPFVAT 566 (656)
Q Consensus 489 ~~kl~~al~I~~e~F~Pi~dp~s~~dl~~~~v~n~~s~~~r~~~~g~y~~VLe~dg~iVg~a~lr~~--~~~AEI~~VAv 566 (656)
...|..+..++...| |-...++++.++++.. ..++|+.++|+|||++.++.+ .+.|||.++||
T Consensus 21 ~~~L~~~~~iF~~~l-----p~m~~~yi~r~~~d~~----------~~~~v~~~~~~iIG~i~~~~~~~~~~aeI~~laV 85 (162)
T d1z4ra1 21 LLWLVGLQNVFSHQL-----PRMPKEYIARLVFDPK----------HKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAV 85 (162)
T ss_dssp HHHHHHHHHHHHHHC-----TTSCHHHHHHHHTCTT----------CEEEEEEETTEEEEEEEEEEETTTTEEEEEEEEE
T ss_pred HHHHHHHHHHHHHhC-----CCCcHHHHHHHhcCCC----------ceEEEEEECCEEEEEEEEEEECCCCEEEEEEEEE
Confidence 345555667777776 2234678888887653 556788899999999999988 56899999999
Q ss_pred ccCcccCChHHHHHHHHHHHHHHcCCcEEEEcCccchHHHhHhcCCceecChHHHhccccceeEeeCCceeeeecc
Q 044767 567 MFKYRRNGMCRLLMAELEKQLIALGVERLVLPSAPSVLNAWTTKFGFSKMTASERLNYLNYTFLDFQGTIMCQKFL 642 (656)
Q Consensus 567 ~~~yRgqG~Gr~Lm~~lE~~l~~~gv~~l~L~A~~~a~~fw~~kfGF~~~~~~~~~~~~~~~~m~F~gt~mlqK~l 642 (656)
+|+|||+|+|+.||+.+++.++..|+..+++.|...|.+||+ |+||+.....+......+ +-.|.|.+++|=.|
T Consensus 86 ~~~~qgkGiG~~Lm~~l~~~~~~~g~~~i~~~~~~~A~~fY~-k~GF~~~~~~~~~~~~~~-ikdy~~~~lm~~~~ 159 (162)
T d1z4ra1 86 TSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFK-KQGFSKDIKVPKSRYLGY-IKDYEGATLMECEL 159 (162)
T ss_dssp CGGGCSSSHHHHHHHHHHHHHHHTTCCEEEEEECGGGHHHHH-HTTEESCCCSCHHHHTTT-SCCCTTCEEEEEEC
T ss_pred ChhhhhhhHHHHHHHHHHHHHHHCCCcEEEEecCcchHHHHH-hCCCeEeccCchhHhcCC-ccCCCCeEEEEEec
Confidence 999999999999999999999999999999999999999999 799977543333222222 23467877776444
|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ufna_ d.217.1.1 (A:) Putative nuclear protein homolog 5830484a20rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oqja_ d.217.1.1 (A:) Glucocorticoid modulatory element binding protein-1 (Gmeb1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5pa_ d.217.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|