Citrus Sinensis ID: 044880

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
ccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEcccccEEEEccccccccHHHHHHHHHHHHHHHHHcc
ccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEccccccEEEccccccccHHHHHHHHHHHHHHHHHcc
tkrtkkagivgkygtRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKavgiwgckdcgkvkaggaytlntASAVTVRSTIRRLREQTES
tkrtkkagivgkygtrygaslrKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKvkaggaytlntasavtvrsTIRRLREQTES
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
********IVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRST**********
***TKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIR*LRE****
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
**RTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQ***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q5QM9992 60S ribosomal protein L37 yes no 1.0 0.989 0.967 5e-45
Q9XHE492 60S ribosomal protein L37 N/A no 1.0 0.989 0.989 6e-45
Q9ZRS892 60S ribosomal protein L37 N/A no 0.989 0.978 0.966 2e-44
Q9SRK692 Putative 60S ribosomal pr yes no 1.0 0.989 0.945 1e-43
Q8RXU592 60S ribosomal protein L37 no no 0.978 0.967 0.943 1e-42
P4320993 60S ribosomal protein L37 N/A no 0.978 0.956 0.933 3e-41
A4S6Z492 60S ribosomal protein L37 yes no 0.978 0.967 0.808 1e-35
Q00VK492 60S ribosomal protein L37 yes no 0.978 0.967 0.797 7e-35
O6146292 60S ribosomal protein L37 N/A no 0.989 0.978 0.744 2e-32
Q54UG491 60S ribosomal protein L37 yes no 0.945 0.945 0.720 4e-30
>sp|Q5QM99|RL37A_ORYSJ 60S ribosomal protein L37a OS=Oryza sativa subsp. japonica GN=Os01g0679700 PE=1 SV=1 Back     alignment and function desciption
 Score =  179 bits (454), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/91 (96%), Positives = 91/91 (100%)

Query: 1  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
          TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGK+AVKRKAVGIWGCKDCG
Sbjct: 2  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCG 61

Query: 61 KVKAGGAYTLNTASAVTVRSTIRRLREQTES 91
          KVKAGGAYT+NTASAVTVRSTIRRLREQTE+
Sbjct: 62 KVKAGGAYTMNTASAVTVRSTIRRLREQTEA 92

Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9XHE4|RL37A_GOSHI 60S ribosomal protein L37a OS=Gossypium hirsutum GN=RPL37A PE=3 SV=1 Back     alignment and function description
>sp|Q9ZRS8|RL37A_PSEMZ 60S ribosomal protein L37a OS=Pseudotsuga menziesii GN=RPL37A PE=3 SV=1 Back     alignment and function description
>sp|Q9SRK6|R37A1_ARATH Putative 60S ribosomal protein L37a-1 OS=Arabidopsis thaliana GN=RPL37AB PE=3 SV=1 Back     alignment and function description
>sp|Q8RXU5|R37A2_ARATH 60S ribosomal protein L37a-2 OS=Arabidopsis thaliana GN=RPL37AC PE=3 SV=1 Back     alignment and function description
>sp|P43209|RL37A_BRARA 60S ribosomal protein L37a OS=Brassica rapa GN=RPL37A PE=3 SV=2 Back     alignment and function description
>sp|A4S6Z4|RL37A_OSTLU 60S ribosomal protein L37a OS=Ostreococcus lucimarinus (strain CCE9901) GN=RPL37a PE=3 SV=1 Back     alignment and function description
>sp|Q00VK4|RL37A_OSTTA 60S ribosomal protein L37a OS=Ostreococcus tauri GN=RPL37a PE=3 SV=2 Back     alignment and function description
>sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 Back     alignment and function description
>sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
22542737792 PREDICTED: 60S ribosomal protein L37a-li 1.0 0.989 1.0 2e-44
297734652141 unnamed protein product [Vitis vinifera] 1.0 0.645 0.989 3e-44
255552928110 60S ribosomal protein L37a, putative [Ri 1.0 0.827 0.989 4e-44
22412641592 predicted protein [Populus trichocarpa] 1.0 0.989 0.989 5e-44
29774219599 unnamed protein product [Vitis vinifera] 1.0 0.919 1.0 5e-44
41396844092 60S ribosomal protein L37a [Solanum tube 1.0 0.989 0.989 6e-44
5857827492 60S ribosomal protein L37a [Capsicum chi 1.0 0.989 0.989 6e-44
22545330592 PREDICTED: 60S ribosomal protein L37a-li 1.0 0.989 0.989 8e-44
29782964692 60S ribosomal protein L37a [Arabidopsis 1.0 0.989 0.978 1e-43
125571576122 hypothetical protein OsJ_03011 [Oryza sa 1.0 0.745 0.967 1e-43
>gi|225427377|ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a-like [Vitis vinifera] gi|449432368|ref|XP_004133971.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449442329|ref|XP_004138934.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449461277|ref|XP_004148368.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449487554|ref|XP_004157684.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449505246|ref|XP_004162415.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449524647|ref|XP_004169333.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/91 (100%), Positives = 91/91 (100%)

Query: 1  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
          TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG
Sbjct: 2  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 61

Query: 61 KVKAGGAYTLNTASAVTVRSTIRRLREQTES 91
          KVKAGGAYTLNTASAVTVRSTIRRLREQTES
Sbjct: 62 KVKAGGAYTLNTASAVTVRSTIRRLREQTES 92

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297734652|emb|CBI16703.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552928|ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|223543518|gb|EEF45049.1| 60S ribosomal protein L37a, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224126415|ref|XP_002329548.1| predicted protein [Populus trichocarpa] gi|224136378|ref|XP_002326845.1| predicted protein [Populus trichocarpa] gi|224138784|ref|XP_002326689.1| predicted protein [Populus trichocarpa] gi|255571073|ref|XP_002526487.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|356504539|ref|XP_003521053.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|356511083|ref|XP_003524259.1| PREDICTED: 60S ribosomal protein L37a [Glycine max] gi|356520742|ref|XP_003529019.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|356563414|ref|XP_003549958.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|357477067|ref|XP_003608819.1| 60S ribosomal protein L37a [Medicago truncatula] gi|118483026|gb|ABK93424.1| unknown [Populus trichocarpa] gi|118484983|gb|ABK94356.1| unknown [Populus trichocarpa] gi|217071074|gb|ACJ83897.1| unknown [Medicago truncatula] gi|222834011|gb|EEE72488.1| predicted protein [Populus trichocarpa] gi|222835160|gb|EEE73595.1| predicted protein [Populus trichocarpa] gi|222870257|gb|EEF07388.1| predicted protein [Populus trichocarpa] gi|223534162|gb|EEF35878.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|355509874|gb|AES91016.1| 60S ribosomal protein L37a [Medicago truncatula] gi|388494042|gb|AFK35087.1| unknown [Medicago truncatula] gi|388514345|gb|AFK45234.1| unknown [Medicago truncatula] gi|388520787|gb|AFK48455.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297742195|emb|CBI33982.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|413968440|gb|AFW90557.1| 60S ribosomal protein L37a [Solanum tuberosum] Back     alignment and taxonomy information
>gi|58578274|emb|CAI48073.1| 60S ribosomal protein L37a [Capsicum chinense] Back     alignment and taxonomy information
>gi|225453305|ref|XP_002268650.1| PREDICTED: 60S ribosomal protein L37a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297829646|ref|XP_002882705.1| 60S ribosomal protein L37a [Arabidopsis lyrata subsp. lyrata] gi|297328545|gb|EFH58964.1| 60S ribosomal protein L37a [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|125571576|gb|EAZ13091.1| hypothetical protein OsJ_03011 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:208553292 AT3G10950 [Arabidopsis thalian 1.0 0.989 0.945 3.5e-43
TAIR|locus:50500640692 AT3G60245 [Arabidopsis thalian 0.978 0.967 0.943 1.9e-42
DICTYBASE|DDB_G028109391 rpl37A "ribosomal protein" [Di 0.945 0.945 0.720 6.9e-31
UNIPROTKB|F1NDE192 RPL37A "60S ribosomal protein 0.945 0.934 0.732 1.1e-30
UNIPROTKB|F2Z4M791 RPL37A "60S ribosomal protein 0.945 0.945 0.732 1.1e-30
UNIPROTKB|P3204692 RPL37A "60S ribosomal protein 0.945 0.934 0.732 1.1e-30
WB|WBGene0000445691 rpl-43 [Caenorhabditis elegans 0.978 0.978 0.719 1.1e-30
UNIPROTKB|Q3MIC092 RPL37A "60S ribosomal protein 0.945 0.934 0.720 2.3e-30
UNIPROTKB|P6151392 RPL37A "60S ribosomal protein 0.945 0.934 0.720 2.3e-30
MGI|MGI:9806892 Rpl37a "ribosomal protein L37a 0.945 0.934 0.720 2.3e-30
TAIR|locus:2085532 AT3G10950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 456 (165.6 bits), Expect = 3.5e-43, P = 3.5e-43
 Identities = 86/91 (94%), Positives = 89/91 (97%)

Query:     1 TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
             TKRTKKA IVGKYGTRYGASLRKQIKKMEVSQH+KYFCEFCGKY+VKRK VGIWGCKDCG
Sbjct:     2 TKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDCG 61

Query:    61 KVKAGGAYTLNTASAVTVRSTIRRLREQTES 91
             KVKAGGAYT+NTASAVTVRSTIRRLREQTES
Sbjct:    62 KVKAGGAYTMNTASAVTVRSTIRRLREQTES 92
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005840 "ribosome" evidence=IEA;ISS
GO:0006412 "translation" evidence=IEA;ISS
GO:0042254 "ribosome biogenesis" evidence=ISS
GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:505006406 AT3G60245 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281093 rpl37A "ribosomal protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDE1 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4M7 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P32046 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00004456 rpl-43 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MIC0 RPL37A "60S ribosomal protein L37a" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61513 RPL37A "60S ribosomal protein L37a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98068 Rpl37a "ribosomal protein L37a" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4S6Z4RL37A_OSTLUNo assigned EC number0.80890.97800.9673yesno
B8D6B7RL37A_DESK1No assigned EC number0.46980.90100.9534yesno
Q8TYC3RL37A_METKANo assigned EC number0.43020.94500.9662yesno
Q23G98RL37A_TETTSNo assigned EC number0.63950.94500.8349N/Ano
O17307RL37A_SCHMANo assigned EC number0.68131.01.0N/Ano
O26777RL37A_METTHNo assigned EC number0.42160.91200.9325yesno
Q9U2A8RL37A_CAEELNo assigned EC number0.71910.97800.9780yesno
A4FZT8RL37A_METM5No assigned EC number0.40470.92300.875yesno
P61513RL37A_HUMANNo assigned EC number0.72090.94500.9347yesno
P61515RL37P_RATNo assigned EC number0.72090.94500.9347yesno
P61514RL37A_MOUSENo assigned EC number0.72090.94500.9347yesno
Q5QM99RL37A_ORYSJNo assigned EC number0.96701.00.9891yesno
O94686RL43B_SCHPONo assigned EC number0.63040.98900.9574yesno
Q8RXU5R37A2_ARATHNo assigned EC number0.94380.97800.9673nono
O61598RL37A_OSTOSNo assigned EC number0.68530.97800.9780N/Ano
O96184RL37A_PLAF7No assigned EC number0.62220.98900.9375yesno
P0CX25RL43A_YEASTNo assigned EC number0.66660.98900.9782yesno
Q90YT0RL37A_ICTPUNo assigned EC number0.68530.97800.9673N/Ano
P0CX26RL43B_YEASTNo assigned EC number0.66660.98900.9782yesno
Q7SZB4RL37A_XENLANo assigned EC number0.72090.94500.9347N/Ano
Q6M0M1RL37A_METMPNo assigned EC number0.40470.92300.875yesno
A9A848RL37A_METM6No assigned EC number0.40470.92300.875yesno
P54051RL37A_METJANo assigned EC number0.40900.96700.9565yesno
A5UNQ7RL37A_METS3No assigned EC number0.40960.91200.9325yesno
Q9Y0H7RL37A_MYXGLNo assigned EC number0.69040.92300.9882N/Ano
Q00VK4RL37A_OSTTANo assigned EC number0.79770.97800.9673yesno
Q9VMU4RL37A_DROMENo assigned EC number0.66290.97800.9673yesno
Q9SRK6R37A1_ARATHNo assigned EC number0.94501.00.9891yesno
A6URN7RL37A_METVSNo assigned EC number0.40470.92300.875yesno
O74106RL37A_PYRHONo assigned EC number0.40500.86810.9518yesno
Q9XHE4RL37A_GOSHINo assigned EC number0.98901.00.9891N/Ano
P32046RL37A_CHICKNo assigned EC number0.73250.94500.9347yesno
A6VIN8RL37A_METM7No assigned EC number0.40470.92300.875yesno
Q6FRG6RL43_CANGANo assigned EC number0.65550.98900.9782yesno
Q8TZI4RL37A_PYRFUNo assigned EC number0.43420.83510.9156yesno
Q54UG4RL37A_DICDINo assigned EC number0.72090.94500.9450yesno
Q9ZRS8RL37A_PSEMZNo assigned EC number0.96660.98900.9782N/Ano
P43209RL37A_BRARANo assigned EC number0.93330.97800.9569N/Ano
O61462RL37A_CRYSTNo assigned EC number0.74440.98900.9782N/Ano
C6A452RL37A_THESMNo assigned EC number0.42460.80210.8588yesno
Q3MIC0RL37A_BOVINNo assigned EC number0.72090.94500.9347yesno
Q751L1RL43_ASHGONo assigned EC number0.68880.98900.9782yesno
Q5RBF9RL37A_PONABNo assigned EC number0.72090.94500.9347yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam0178090 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protei 4e-43
PTZ0025590 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Pr 7e-43
TIGR0028092 TIGR00280, L37a, ribosomal protein L37a 1e-25
COG199789 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Tra 1e-25
PRK0397690 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Re 2e-23
>gnl|CDD|216695 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protein family Back     alignment and domain information 
 Score =  134 bits (340), Expect = 4e-43
 Identities = 63/90 (70%), Positives = 72/90 (80%)

Query: 1  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
           KRTKK GI G++GTRYGASLRK++KK+E+SQH+KY C FCGK AVKRKAVGIW C+ CG
Sbjct: 1  AKRTKKVGIAGRFGTRYGASLRKRVKKIEISQHAKYTCPFCGKDAVKRKAVGIWKCRKCG 60

Query: 61 KVKAGGAYTLNTASAVTVRSTIRRLREQTE 90
          K  AGGAYT  T +  TVR TIRRLRE  E
Sbjct: 61 KTFAGGAYTPETPAGKTVRRTIRRLRELKE 90

This ribosomal protein is found in archaebacteria and eukaryotes. It contains four conserved cysteine residues that may bind to zinc. Length = 90
>gnl|CDD|240332 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>gnl|CDD|232904 TIGR00280, L37a, ribosomal protein L37a Back     alignment and domain information
>gnl|CDD|224908 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235183 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 100.0
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 100.0
PTZ0025590 60S ribosomal protein L37a; Provisional 100.0
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 100.0
KOG040292 consensus 60S ribosomal protein L37 [Translation, 100.0
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 100.0
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 97.28
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 97.21
PRK0971064 lar restriction alleviation and modification prote 96.33
PRK0043250 30S ribosomal protein S27ae; Validated 96.3
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 96.29
PF1435461 Lar_restr_allev: Restriction alleviation protein L 96.22
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 95.93
PHA0062659 hypothetical protein 95.88
PRK00464154 nrdR transcriptional regulator NrdR; Validated 95.57
PF0180797 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin 95.55
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 95.34
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 95.1
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 94.99
smart0066152 RPOL9 RNA polymerase subunit 9. 94.75
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 94.41
smart0040055 ZnF_CHCC zinc finger. 94.4
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 93.6
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 93.1
COG0675364 Transposase and inactivated derivatives [DNA repli 92.84
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 92.65
PF1178136 RRN7: RNA polymerase I-specific transcription init 92.54
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 92.5
PF08646146 Rep_fac-A_C: Replication factor-A C terminal domai 92.25
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 92.2
PRK1489299 putative transcription elongation factor Elf1; Pro 91.94
PRK05667 580 dnaG DNA primase; Validated 91.48
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 91.31
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 91.02
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 90.87
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 90.67
TIGR01391 415 dnaG DNA primase, catalytic core. This protein con 90.63
PHA02942383 putative transposase; Provisional 90.44
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 90.42
PHA02540 337 61 DNA primase; Provisional 90.37
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 90.36
smart00531147 TFIIE Transcription initiation factor IIE. 90.04
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 89.9
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 89.63
PRK11823 446 DNA repair protein RadA; Provisional 89.49
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 89.41
PRK12366637 replication factor A; Reviewed 89.28
PF0381136 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR0 89.2
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 88.92
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 88.89
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 88.86
TIGR00244147 transcriptional regulator NrdR. Members of this al 88.85
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 88.34
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 88.29
KOG3214109 consensus Uncharacterized Zn ribbon-containing pro 87.59
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 87.53
COG3677129 Transposase and inactivated derivatives [DNA repli 87.33
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 87.2
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 87.14
cd04476166 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds cor 86.87
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 86.57
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 86.42
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 86.3
PRK0967872 DNA-binding transcriptional regulator; Provisional 86.02
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 86.01
PF0460647 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I 85.88
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 85.25
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 85.07
COG1405 285 SUA7 Transcription initiation factor TFIIIB, Brf1 84.97
PF1345341 zf-TFIIB: Transcription factor zinc-finger 83.87
PF14353128 CpXC: CpXC protein 83.8
COG1571421 Predicted DNA-binding protein containing a Zn-ribb 83.76
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 83.6
PF0668941 zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IP 83.34
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.1
TIGR02159146 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subu 82.95
COG1779 201 C4-type Zn-finger protein [General function predic 82.4
PRK08402355 replication factor A; Reviewed 81.92
PF1324023 zinc_ribbon_2: zinc-ribbon domain 81.84
COG1327156 Predicted transcriptional regulator, consists of a 81.25
PF01927147 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T 80.93
COG1645131 Uncharacterized Zn-finger containing protein [Gene 80.91
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 80.68
PF1447151 DUF4428: Domain of unknown function (DUF4428) 80.56
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 80.52
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 80.18
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information 
Probab=100.00  E-value=1.2e-52  Score=282.53  Aligned_cols=90  Identities=69%  Similarity=1.130  Sum_probs=83.2

Q ss_pred             CCcceeeeeccCCccccCchhhHHHHHHHHHhhcccccCCCCceeeEEeeeeeeeeCCCCceEecccccccccHHHHHHH
Q 044880            1 TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRS   80 (91)
Q Consensus         1 ~k~tkkvgi~gk~G~RYG~slRK~v~kie~~q~~ky~CpfCGk~~VkR~a~GIW~C~~Cg~~~AGGAy~~~T~~~~t~~~   80 (91)
                      |+||+||||+||||+|||++|||+|++||++||++|+|||||++.|+|+++|||+|++|+++||||||+|+||++.+|++
T Consensus         1 a~rtkkvgi~GkyG~RYG~slRK~vkkie~~q~~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~AGGAy~~~T~~~~t~~~   80 (90)
T PF01780_consen    1 AKRTKKVGIAGKYGTRYGASLRKRVKKIEISQHAKYTCPFCGKTSVKRVATGIWKCKKCGKKFAGGAYTPSTPAAKTVKR   80 (90)
T ss_dssp             -S-SSS-TTGGGGTTSSTHHHHHHHHHHHHHHHS-BEESSSSSSEEEEEETTEEEETTTTEEEE-BSSSSS-HHHHHHHH
T ss_pred             CCCCceeeecCcCcCCcCHHHHHHHHHHHHHHhCCCcCCCCCCceeEEeeeEEeecCCCCCEEeCCCccccchHHHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhc
Q 044880           81 TIRRLREQTE   90 (91)
Q Consensus        81 ~i~rl~e~~~   90 (91)
                      +|+||+|++|
T Consensus        81 ~i~rl~e~~e   90 (90)
T PF01780_consen   81 AIRRLRELKE   90 (90)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHhcC
Confidence            9999999986

The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>smart00400 ZnF_CHCC zinc finger Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PF08646 Rep_fac-A_C: Replication factor-A C terminal domain; InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PRK05667 dnaG DNA primase; Validated Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>TIGR01391 dnaG DNA primase, catalytic core Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PHA02540 61 DNA primase; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70) Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06689 zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit Back     alignment and domain information
>COG1779 C4-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>PF14471 DUF4428: Domain of unknown function (DUF4428) Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3izr_m92 Localization Of The Large Subunit Ribosomal Protein 4e-46
1ysh_D73 Localization And Dynamic Behavior Of Ribosomal Prot 2e-36
2zkr_z92 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-30
3izs_m92 Localization Of The Large Subunit Ribosomal Protein 9e-30
1s1i_991 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-29
3zf7_o93 High-resolution Cryo-electron Microscopy Structure 2e-29
4a17_Y103 T.Thermophila 60s Ribosomal Subunit In Complex With 5e-27
3jyw_972 Structure Of The 60s Proteins For Eukaryotic Riboso 1e-21
3j21_i83 Promiscuous Behavior Of Proteins In Archaeal Riboso 5e-13
3cc2_Z116 The Refined Crystal Structure Of The Haloarcula Mar 7e-10
3cpw_Y92 The Structure Of The Antibiotic Linezolid Bound To 9e-10
2qa4_Z92 A More Complete Structure Of The The L7L12 STALK OF 1e-09
1ffk_W73 Crystal Structure Of The Large Ribosomal Subunit Fr 2e-09
1yhq_Z83 Crystal Structure Of Azithromycin Bound To The G209 4e-09
1jj2_Y73 Fully Refined Crystal Structure Of The Haloarcula M 8e-08
1s72_Z73 Refined Crystal Structure Of The Haloarcula Marismo 8e-08
3g4s_Z73 Co-Crystal Structure Of Tiamulin Bound To The Large 8e-08
>pdb|3IZR|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 92 Back     alignment and structure 
Iteration: 1

 Score =  179 bits (454), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/91 (96%), Positives = 91/91 (100%)
Query: 1  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
          TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGK+AVKRKAVGIWGCKDCG
Sbjct: 2  TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCG 61
Query: 61 KVKAGGAYTLNTASAVTVRSTIRRLREQTES 91
          KVKAGGAYT+NTASAVTVRSTIRRLREQTE+
Sbjct: 62 KVKAGGAYTMNTASAVTVRSTIRRLREQTEA 92
>pdb|1YSH|D Chain D, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 73 Back     alignment and structure
>pdb|2ZKR|ZZ Chain z, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 92 Back     alignment and structure
>pdb|3IZS|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|1S1I|9 Chain 9, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 91 Back     alignment and structure
>pdb|3ZF7|OO Chain o, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 93 Back     alignment and structure
>pdb|4A17|Y Chain Y, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 103 Back     alignment and structure
>pdb|3JYW|9 Chain 9, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 72 Back     alignment and structure
>pdb|3J21|II Chain i, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 83 Back     alignment and structure
>pdb|3CC2|Z Chain Z, The Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution With Rrna Sequence For The 23s Rrna And Genome-Derived Sequences For R-Proteins Length = 116 Back     alignment and structure
>pdb|3CPW|Y Chain Y, The Structure Of The Antibiotic Linezolid Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui Length = 92 Back     alignment and structure
>pdb|2QA4|Z Chain Z, A More Complete Structure Of The The L7L12 STALK OF THE Haloarcula Marismortui 50s Large Ribosomal Subunit Length = 92 Back     alignment and structure
>pdb|1FFK|W Chain W, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|1YHQ|Z Chain Z, Crystal Structure Of Azithromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui Length = 83 Back     alignment and structure
>pdb|1JJ2|Y Chain Y, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|1S72|Z Chain Z, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|3G4S|Z Chain Z, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 2e-38
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 3e-38
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 5e-37
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 5e-36
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 8e-35
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 2e-30
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 1e-28
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-04
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Length = 116 Back     alignment and structure
 Score =  123 bits (309), Expect = 2e-38
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 1   TKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCG 60
             ++ K G  G++G RYG   R+++ ++E   +  + C  CG+  V R+  GIW C  C 
Sbjct: 26  ASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCD 85

Query: 61  KVKAGGAYTLNTASAVTVRSTIRRLREQTE 90
               GG+Y   T    TVR +IR    + E
Sbjct: 86  YKFTGGSYKPETPGGKTVRRSIRAALSEDE 115
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Length = 103 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Length = 83 Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Length = 73 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 72 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 100.0
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 100.0
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 100.0
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 100.0
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 100.0
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 100.0
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 100.0
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 100.0
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 98.74
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 96.23
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 95.87
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 95.59
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 95.55
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 95.4
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 95.26
1d0q_A103 DNA primase; zinc-binding motif, protein, transfer 94.94
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 93.51
3u50_C172 Telomerase-associated protein 82; TEB1, processivi 92.97
1l1o_C181 Replication protein A 70 kDa DNA-binding subunit; 92.95
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 92.5
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 92.33
2au3_A 407 DNA primase; zinc ribbon, toprim, RNA polymerase, 92.16
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 92.15
1vd4_A62 Transcription initiation factor IIE, alpha subunit 92.01
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 91.84
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 91.8
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 91.77
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 91.37
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 90.95
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 90.5
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 90.45
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 89.83
2ds5_A51 CLPX, ATP-dependent CLP protease ATP-binding subun 89.8
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 89.76
2lv2_A85 Insulinoma-associated protein 1; structural genomi 89.53
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 89.17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 88.8
1ovx_A67 ATP-dependent CLP protease ATP-binding subunit CL; 88.58
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 88.56
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 87.92
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 87.89
4gop_C444 Putative uncharacterized protein; OB fold, ssDNA b 87.72
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 87.7
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 87.48
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 87.12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 86.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 86.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 86.7
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 86.32
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 85.91
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 85.71
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 85.3
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 85.2
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 85.14
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 84.78
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 84.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.99
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 83.97
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 83.78
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 83.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 84.13
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 83.5
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 83.49
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 83.36
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 83.28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 83.28
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 83.27
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 83.24
1paa_A30 Yeast transcription factor ADR1; transcription reg 83.07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 82.99
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 82.99
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 82.89
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 82.83
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 82.13
3cng_A 189 Nudix hydrolase; structural genomics, APC7497, PSI 81.66
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 81.55
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 82.29
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 81.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 80.69
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 80.27
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 80.59
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>1l1o_C Replication protein A 70 kDa DNA-binding subunit; eukaryotic SSB, ssDNA binding protein, OB-fold; 2.80A {Homo sapiens} SCOP: b.40.4.3 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transf; HET: DNA; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure
>2ds5_A CLPX, ATP-dependent CLP protease ATP-binding subunit CLPX; treble cleft zinc finger, metal binding protein, protein binding; HET: PG4; 1.50A {Escherichia coli} SCOP: g.39.1.11 PDB: 2ds6_A 2ds8_A 2ds7_A Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ovx_A ATP-dependent CLP protease ATP-binding subunit CL; treble CLEF zinc finger, homodimer, metal binding protein; NMR {Escherichia coli} SCOP: g.39.1.11 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1vqoz173 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archae 3e-31
d1jj2y_73 g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Ha 9e-31
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

 Score =  102 bits (256), Expect = 3e-31
 Identities = 24/71 (33%), Positives = 37/71 (52%)

Query: 11 GKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTL 70
          G++G RYG   R+++ ++E   +  + C  CG+  V R+  GIW C  C     GG+Y  
Sbjct: 3  GRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKP 62

Query: 71 NTASAVTVRST 81
           T    TVR +
Sbjct: 63 ETPGGKTVRRS 73
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1wiia_85 Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m 95.09
d1d0qa_102 Zinc-binding domain of DNA primase {Bacillus stear 94.26
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 91.74
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 91.33
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 91.03
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 90.86
d1l1oc_178 Replication protein A 70 KDa subunit (RPA70) {Huma 89.88
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 89.63
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 89.01
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 88.39
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 88.36
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 88.17
d2ds5a138 ClpX chaperone zinc binding domain {Escherichia co 88.13
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 87.68
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 87.61
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 87.49
d2cota238 Zinc finger and SCAN domain-containing protein 16, 86.58
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 85.96
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 85.11
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 85.09
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 84.86
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 83.06
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.73
d1nuia254 Zinc-binding domain of primase-helicase {Bacteriop 82.66
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.45
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 82.43
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 82.28
d1tfia_50 Transcriptional factor SII, C-terminal domain {Hum 81.38
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 80.7
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

Probab=100.00  E-value=1.6e-44  Score=232.97  Aligned_cols=72  Identities=35%  Similarity=0.755  Sum_probs=70.5

Q ss_pred             ccCCccccCchhhHHHHHHHHHhhcccccCCCCceeeEEeeeeeeeeCCCCceEecccccccccHHHHHHHH
Q 044880           10 VGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRST   81 (91)
Q Consensus        10 ~gk~G~RYG~slRK~v~kie~~q~~ky~CpfCGk~~VkR~a~GIW~C~~Cg~~~AGGAy~~~T~~~~t~~~~   81 (91)
                      +||||+|||++|||+|++||++||++|+|||||++.|+|+++|||+|++|+++||||||+|+||++.+|+++
T Consensus         2 TGrfG~RYG~slRk~v~kie~~q~~ky~Cp~Cgk~~vkR~a~GIW~C~kC~~~~AGgAy~p~T~a~~tv~~~   73 (73)
T d1jj2y_           2 TGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA   73 (73)
T ss_dssp             GGGGTTCSCHHHHHHHHHHHHHHHSCBCCSSSCCSCEEEEETTEEEETTTCCEEECCSSSSSCHHHHHHHHC
T ss_pred             CCccccccCHHHHHHHHHHHHHhcCCccCCCCCCCceEEEEEEEEECCCCCCEEeCccceecchHHhhhccC
Confidence            699999999999999999999999999999999999999999999999999999999999999999999874
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ds5a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure