Citrus Sinensis ID: 044998

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFSSFQARTTNRN
ccHHHHHHHHcccccccccccccEEEEEcHHHHHHHHHcccccEEccccHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccccccc
cHHHHHHHHHHcccEEEEEccccEEEEEcHHHcHEEEEcccccccccccHHHHHHHccHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHHHHccccEEEccccHccccccc
ENGFKIelkeygpisklsllvtptvYIYGQAANKfvytcddnalanqqpslirriygersitglgvdeHKRLRGAlesffkpeVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMksltfnipsslifgiEQGATINAFIELFQDIMDGIvsipincpftrfnrglkihqsssvafrggpwicpgheftrieNLATIHHlvtpfswksfssFQARTTNRN
engfkielkeygpisklslLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRgalesffkpevLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVtpfswksfssfqarttnrn
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFSSFQARTTNRN
*****IELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFS**********
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSV*************FTRIENLATIHHLVTPFSWKSFSSFQ*******
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFSS*********
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFSSF********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQSSSVAFRGGPWICPGHEFTRIENLATIHHLVTPFSWKSFSSFQARTTNRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
Q9AXM6 497 Taxane 10-beta-hydroxylas N/A no 0.742 0.329 0.351 7e-26
Q6WG30 499 Taxadiene 5-alpha hydroxy N/A no 0.755 0.334 0.327 3e-23
Q50EK0 497 Cytochrome P450 716B2 OS= N/A no 0.733 0.325 0.319 6e-22
Q50EK1 493 Cytochrome P450 716B1 OS= N/A no 0.728 0.326 0.320 6e-22
Q84KI1 509 Taxoid 14-beta-hydroxylas N/A no 0.773 0.335 0.296 1e-21
Q8W4T9 485 Taxane 13-alpha-hydroxyla N/A no 0.723 0.329 0.298 5e-21
Q6JTJ0 500 Taxoid 7-beta-hydroxylase N/A no 0.719 0.318 0.327 1e-16
O93323 492 Cytochrome P450 26A1 OS=X N/A no 0.733 0.329 0.273 7e-14
Q69F95 466 Cytochrome P450 85A OS=Ph N/A no 0.764 0.362 0.296 2e-12
Q94IA6 491 3-epi-6-deoxocathasterone no no 0.710 0.319 0.264 4e-12
>sp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 93/165 (56%)

Query: 4   FKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITG 63
           F   LK++GP+   SL+  PTV + G A NK V + +D  +  + P    ++ GE SI  
Sbjct: 79  FDDRLKKFGPVYMTSLIGHPTVVLCGPAGNKLVLSNEDKLVEMEGPKSFMKLIGEDSIVA 138

Query: 64  LGVDEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNI 123
              ++H+ LR AL  F   + L+ Y+G+M  +I  H N  W GK +V V+PL++ L F+I
Sbjct: 139 KRGEDHRILRTALARFLGAQALQNYLGRMSSEIGHHFNEKWKGKDEVKVLPLVRGLIFSI 198

Query: 124 PSSLIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLK 168
            S+L F +  G        L + I+ G +S+P++ P TR+ +GL+
Sbjct: 199 ASTLFFDVNDGHQQKQLHHLLETILVGSLSVPLDFPGTRYRKGLQ 243
Involved in the transformation of a taxadienyl acetate by hydroxylation at C10 to yield taxadien-5-alpha-acetoxy-10-beta-ol.
Taxus cuspidata (taxid: 99806)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 7EC: 6
>sp|Q6WG30|T5H_TAXCU Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 Back     alignment and function description
>sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 Back     alignment and function description
>sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 Back     alignment and function description
>sp|Q84KI1|T14H_TAXCU Taxoid 14-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function description
>sp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 Back     alignment and function description
>sp|Q6JTJ0|T7H_TAXCU Taxoid 7-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function description
>sp|O93323|CP26A_XENLA Cytochrome P450 26A1 OS=Xenopus laevis GN=cyp26a1 PE=2 SV=1 Back     alignment and function description
>sp|Q69F95|C85A_PHAVU Cytochrome P450 85A OS=Phaseolus vulgaris GN=BA13 PE=3 SV=2 Back     alignment and function description
>sp|Q94IA6|C90D1_ARATH 3-epi-6-deoxocathasterone 23-monooxygenase OS=Arabidopsis thaliana GN=CYP90D1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
224115704 490 cytochrome P450 [Populus trichocarpa] gi 0.737 0.332 0.656 2e-58
224115696 478 cytochrome P450 [Populus trichocarpa] gi 0.719 0.332 0.637 3e-56
224076285 475 cytochrome P450 [Populus trichocarpa] gi 0.760 0.353 0.607 3e-55
224076293 476 cytochrome P450 [Populus trichocarpa] gi 0.760 0.352 0.601 2e-53
255563939 478 cytochrome P450, putative [Ricinus commu 0.778 0.359 0.552 8e-50
363814400 474 uncharacterized protein LOC100790001 pre 0.728 0.339 0.565 2e-49
359494123 474 PREDICTED: cytochrome P450 716B1-like [V 0.760 0.354 0.535 1e-47
357494403 485 Taxane 13-alpha-hydroxylase [Medicago tr 0.760 0.346 0.529 1e-46
449446129 478 PREDICTED: cytochrome P450 716B1-like [C 0.719 0.332 0.540 4e-44
449490013 481 PREDICTED: LOW QUALITY PROTEIN: taxadien 0.760 0.349 0.497 7e-44
>gi|224115704|ref|XP_002317101.1| cytochrome P450 [Populus trichocarpa] gi|222860166|gb|EEE97713.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/163 (65%), Positives = 130/163 (79%)

Query: 9   KEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDE 68
           ++YGPISK+SLL  PTV++ GQAANKF+YTCDD+ LANQQPS IRR+ GER+I  L   E
Sbjct: 64  RKYGPISKMSLLGAPTVFVCGQAANKFIYTCDDSILANQQPSSIRRLCGERNILELSGHE 123

Query: 69  HKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLI 128
           HKR+RGAL S  KPEVLKQYVGKMDE++RKH  +HWHGK+KV  MPLMK+LTFN+ SSLI
Sbjct: 124 HKRVRGALVSILKPEVLKQYVGKMDEEVRKHFKIHWHGKKKVLAMPLMKTLTFNVMSSLI 183

Query: 129 FGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQ 171
           FGIEQ A     +ELFQ ++ GI+ +PIN PFT FNR L+  +
Sbjct: 184 FGIEQSAKREILVELFQQLLKGILCVPINFPFTCFNRSLQARE 226

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224115696|ref|XP_002317099.1| cytochrome P450 [Populus trichocarpa] gi|222860164|gb|EEE97711.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224076285|ref|XP_002304920.1| cytochrome P450 [Populus trichocarpa] gi|222847884|gb|EEE85431.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224076293|ref|XP_002304921.1| cytochrome P450 [Populus trichocarpa] gi|222847885|gb|EEE85432.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563939|ref|XP_002522969.1| cytochrome P450, putative [Ricinus communis] gi|223537781|gb|EEF39399.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363814400|ref|NP_001242838.1| uncharacterized protein LOC100790001 precursor [Glycine max] gi|255638849|gb|ACU19728.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359494123|ref|XP_002278616.2| PREDICTED: cytochrome P450 716B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357494403|ref|XP_003617490.1| Taxane 13-alpha-hydroxylase [Medicago truncatula] gi|355518825|gb|AET00449.1| Taxane 13-alpha-hydroxylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446129|ref|XP_004140824.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus] gi|449485575|ref|XP_004157212.1| PREDICTED: cytochrome P450 716B1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449490013|ref|XP_004158484.1| PREDICTED: LOW QUALITY PROTEIN: taxadiene 5-alpha hydroxylase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
TAIR|locus:2158961 477 CYP716A1 ""cytochrome P450, fa 0.696 0.322 0.348 8.3e-30
UNIPROTKB|Q84KI1 509 Q84KI1 "Taxoid 14-beta-hydroxy 0.778 0.337 0.296 1.8e-28
UNIPROTKB|Q6JTJ0 500 Q6JTJ0 "Taxoid 7-beta-hydroxyl 0.719 0.318 0.327 2.5e-22
TAIR|locus:2091571 491 CYP90D1 ""cytochrome P450, fam 0.710 0.319 0.264 9e-21
TAIR|locus:2158916318 CYP716A2 ""cytochrome P450, fa 0.696 0.484 0.329 1.2e-19
UNIPROTKB|Q6F4F5 480 CYP724B1 "Cytochrome P450 724B 0.760 0.35 0.264 1.1e-15
ZFIN|ZDB-GENE-990415-44 492 cyp26a1 "cytochrome P450, subf 0.737 0.331 0.261 1.1e-14
UNIPROTKB|F1MZS4 497 CYP26A1 "Uncharacterized prote 0.737 0.327 0.263 1.7e-13
TAIR|locus:2052396 485 CYP718 ""cytochrome P450, fami 0.705 0.321 0.232 7.4e-13
RGD|1308843 518 Cyp26c1 "cytochrome P450, fami 0.719 0.306 0.228 7.9e-12
TAIR|locus:2158961 CYP716A1 ""cytochrome P450, family 716, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 8.3e-30, Sum P(2) = 8.3e-30
 Identities = 54/155 (34%), Positives = 82/155 (52%)

Query:    14 ISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLR 73
             + K  L  +PT  + G + NKF++T ++  + +  P  + +I+     T    +E ++LR
Sbjct:    77 VFKTHLFGSPTAVVTGASGNKFLFTNENKLVVSWWPDSVNKIFPSSMQTS-SKEEARKLR 135

Query:    74 GALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQ 133
               L  F KPE L++YVG MDE  ++H    W  + +V V PL K  TF+I       +E 
Sbjct:   136 MLLSQFMKPEALRRYVGVMDEIAQRHFETEWANQDQVIVFPLTKKFTFSIACRSFLSMED 195

Query:   134 GATINAFIELFQDIMDGIVSIPINCPFTRFNRGLK 168
              A +    E F  +  GI SIPI+ P TRFNR +K
Sbjct:   196 PARVRQLEEQFNTVAVGIFSIPIDLPGTRFNRAIK 230
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|Q84KI1 Q84KI1 "Taxoid 14-beta-hydroxylase" [Taxus cuspidata (taxid:99806)] Back     alignment and assigned GO terms
UNIPROTKB|Q6JTJ0 Q6JTJ0 "Taxoid 7-beta-hydroxylase" [Taxus cuspidata (taxid:99806)] Back     alignment and assigned GO terms
TAIR|locus:2091571 CYP90D1 ""cytochrome P450, family 90, subfamily D, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158916 CYP716A2 ""cytochrome P450, family 716, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6F4F5 CYP724B1 "Cytochrome P450 724B1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-44 cyp26a1 "cytochrome P450, subfamily XXVIA, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZS4 CYP26A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2052396 CYP718 ""cytochrome P450, family 718"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1308843 Cyp26c1 "cytochrome P450, family 26, subfamily C, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP728D4
cytochrome P450 (490 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
PLN03141 452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 5e-16
PLN02302 490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 5e-14
PLN02774 463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-13
PLN02196 463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-10
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-05
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-05
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 4e-04
PLN02500 490 PLN02500, PLN02500, cytochrome P450 90B1 0.001
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 0.001
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.002
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information 
 Score = 75.5 bits (186), Expect = 5e-16
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 6/161 (3%)

Query: 11  YGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHK 70
           YG + K  +  TPT+       NK V   D NA     P  +  + G+ SI  +     +
Sbjct: 44  YGKVFKSHIFGTPTIVSTDAEVNKVVLQSDGNAFVPAYPKSLTELMGKSSILLINGSLQR 103

Query: 71  RLRGALESFFKPEVLKQYVGKMDEDIRKHLNM---HWHGKQKVAVMPLMKSLTFNIPSSL 127
           R+ G + +F K   LK  + +   D+ ++++     W     V V    K + F +    
Sbjct: 104 RVHGLIGAFLKSPHLKAQITR---DMERYVSESLDSWRDDPPVLVQDETKKIAFEVLVKA 160

Query: 128 IFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLK 168
           +  +E G  +    + FQ+ + G++S+PI  P TR  R L+
Sbjct: 161 LISLEPGEEMEFLKKEFQEFIKGLMSLPIKLPGTRLYRSLQ 201

Length = 452
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
PLN02500 490 cytochrome P450 90B1 100.0
PLN02774 463 brassinosteroid-6-oxidase 100.0
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02196 463 abscisic acid 8'-hydroxylase 100.0
PLN02738 633 carotene beta-ring hydroxylase 100.0
PLN02302 490 ent-kaurenoic acid oxidase 100.0
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PTZ00404 482 cytochrome P450; Provisional 100.0
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02987 472 Cytochrome P450, family 90, subfamily A 100.0
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02290 516 cytokinin trans-hydroxylase 100.0
PLN02687 517 flavonoid 3'-monooxygenase 100.0
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02394 503 trans-cinnamate 4-monooxygenase 100.0
PLN02183 516 ferulate 5-hydroxylase 100.0
PLN03234 499 cytochrome P450 83B1; Provisional 99.98
PLN02971 543 tryptophan N-hydroxylase 99.98
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN02966 502 cytochrome P450 83A1 99.97
PLN02936 489 epsilon-ring hydroxylase 99.97
PLN02648 480 allene oxide synthase 99.97
PLN00168 519 Cytochrome P450; Provisional 99.97
PLN02655 466 ent-kaurene oxidase 99.97
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
PLN03112 514 cytochrome P450 family protein; Provisional 99.97
PLN03018 534 homomethionine N-hydroxylase 99.96
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.95
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.95
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.95
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.94
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information 
Probab=100.00  E-value=1.9e-34  Score=233.59  Aligned_cols=130  Identities=20%  Similarity=0.333  Sum_probs=111.3

Q ss_pred             hhhHHhhhcCCceeeccCCcceEEEECcccchhccccCCCeEeecchhHHHHHcCCCcccccChhHHHHHHHHHHhcCCH
Q 044998            3 GFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFKP   82 (221)
Q Consensus         3 ~~~~~~~~yG~v~~~~~~~~~~v~v~~p~~~~~vl~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~R~~~~~~f~~   82 (221)
                      ++.+++++||++|++++++.++|+++||+++++||.+++..|...++.....++|..+++.++|+.|+++|+++.+.|++
T Consensus        67 ~~~~~~~~yG~v~~~~~g~~~~vvv~~p~~~~~vl~~~~~~f~~~~~~~~~~~~g~~~~~~~~g~~wr~~Rk~~~~~f~~  146 (490)
T PLN02500         67 FMEQHISRYGKIYRSNLFGEPTIVSADAGLNRFILQNEGRLFECSYPRSIGGILGKWSMLVLVGDMHRDMRSISLNFLSH  146 (490)
T ss_pred             HHHHHHHHhcccccccccCCCeEEecCHHHHHHHHhCCCCeEEeeCchHHHHHhCcccccccCCHHHHHHHHHHHHhcCh
Confidence            57788999999999999999999999999999999988777865554444445664467888999999999999999999


Q ss_pred             HHHHH-hHHHHHHHHHHHHhccccCCCeeeeHHHHHHHHHHHHHHHHcCCCC
Q 044998           83 EVLKQ-YVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQ  133 (221)
Q Consensus        83 ~~~~~-~~~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~~g~~~  133 (221)
                      .+++. +.+.+.+.+...++. |..++.+|+.+.+..++++++++++||.+.
T Consensus       147 ~~l~~~~~~~~~~~~~~~~~~-~~~~~~vd~~~~~~~~~~~vi~~~~fg~~~  197 (490)
T PLN02500        147 ARLRTHLLKEVERHTLLVLDS-WKENSTFSAQDEAKKFTFNLMAKHIMSMDP  197 (490)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-hCCCCCEEehHHHHHHHHHHHHHHHhCCCC
Confidence            99887 577888888888887 876777999999999999999999999753

>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
2ve3_A 444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 6e-12
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 2/157 (1%)
Query: 9   KEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDE 68
           +++GPI K  L     ++I G  AN+F++T +        P   R + G  ++     + 
Sbjct: 41  QQFGPIFKTRLFGKNVIFISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEI 100
Query: 69  HKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLI 128
           H+  R  L   F P  L  Y+ KMD  ++ +L   W    +V   P ++ +TF++ ++L 
Sbjct: 101 HRSRRKILYQAFLPRTLDSYLPKMDGIVQGYLE-QWGKANEVIWYPQLRRMTFDVAATLF 159
Query: 129 FGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNR 165
            G E+ +        F+  + G+ S+PI  P T F +
Sbjct: 160 MG-EKVSQNPQLFPWFETYIQGLFSLPIPLPNTLFGK 195

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 2e-43
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 5e-06
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-33
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-31
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-21
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-21
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-19
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-18
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-15
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-13
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-08
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 4e-07
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-05
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-05
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-05
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-04
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
 Score =  150 bits (380), Expect = 2e-43
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 2/160 (1%)

Query: 9   KEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDE 68
           +++GPI K  L     ++I G  AN+F++T +        P   R + G  ++     + 
Sbjct: 41  QQFGPIFKTRLFGKNVIFISGALANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEI 100

Query: 69  HKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLI 128
           H+  R  L   F P  L  Y+ KMD  ++ +L   W    +V   P ++ +TF++ ++L 
Sbjct: 101 HRSRRKILYQAFLPRTLDSYLPKMDGIVQGYLE-QWGKANEVIWYPQLRRMTFDVAATLF 159

Query: 129 FGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLK 168
            G +           F+  + G+ S+PI  P T F +  +
Sbjct: 160 MGEKVSQ-NPQLFPWFETYIQGLFSLPIPLPNTLFGKSQR 198
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.98
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.98
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.98
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.98
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.97
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.97
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.97
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.97
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.97
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.97
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.97
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.97
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.97
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.97
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.97
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.97
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.97
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.97
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.97
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.97
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.97
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.97
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.97
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.97
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.97
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.97
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.97
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.96
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.96
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.96
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.96
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.96
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.96
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.96
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.96
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.96
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.96
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.96
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.96
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.96
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.96
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.96
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.96
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.95
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.95
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.95
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.95
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.95
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.95
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.95
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.95
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.95
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.94
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.93
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.81
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-37  Score=248.06  Aligned_cols=130  Identities=15%  Similarity=0.295  Sum_probs=114.4

Q ss_pred             hhhhHHhhhcCCceeeccCCcceEEEECcccchhccccCCCeEeecch--hHHHHHcCCCcccccChhHHHHHHHHHHhc
Q 044998            2 NGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQP--SLIRRIYGERSITGLGVDEHKRLRGALESF   79 (221)
Q Consensus         2 ~~~~~~~~~yG~v~~~~~~~~~~v~v~~p~~~~~vl~~~~~~~~~~~~--~~~~~~~g~~~~~~~~g~~~~~~R~~~~~~   79 (221)
                      +|+.+++++|||||++++++.++|+++||+++++|+.+++..+..+..  ......+|...++..+|+.|+++|+++.++
T Consensus        35 ~~~~~~~~kYG~i~~~~~~~~~~vvv~~~~~i~~il~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~R~~~~~~  114 (461)
T 3ld6_A           35 EFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSG  114 (461)
T ss_dssp             HHHHHHHHHHCSEEEEEETTEEEEEECSHHHHHHHHHCCTTTEESHHHHHHHHHHHHCTTSGGGSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhCCEEEEEECCccEEEEeCHHHHHHHHhCCccccCCCcchhhhhhccCCCccccCCCcHHHHHHHHhcccc
Confidence            478999999999999999999999999999999999887777765432  233456775455678999999999999999


Q ss_pred             CCHHHHHHhHHHHHHHHHHHHhccccCCCeeeeHHHHHHHHHHHHHHHHcCCC
Q 044998           80 FKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIE  132 (221)
Q Consensus        80 f~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~~g~~  132 (221)
                      |++..++.+.+.+.+.++++++. |...+.+|+.+.+..+++++++.++||.+
T Consensus       115 f~~~~l~~~~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~i~~~~fG~~  166 (461)
T 3ld6_A          115 LNIAHFKQHVSIIEKETKEYFES-WGESGEKNVFEALSELIILTASHCLHGKE  166 (461)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHGGG-GCSEEEEEHHHHHHHHHHHHHHHHHTCHH
T ss_pred             ccHHHHhhhhHHHHHHHHHHHHH-HhhcCCccHHHHHHHHHHHHHHHHHcCcc
Confidence            99999999999999999999998 98888899999999999999999999954
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 221
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 8e-17
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-10
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-08
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 0.004
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-07
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-04
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-07
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 0.002
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 8e-07
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 0.002
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 8e-07
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 0.002
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-05
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.004
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-04
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 152a1 (Bs-beta)
species: Bacillus subtilis [TaxId: 1423]

 Score = 75.8 bits (185), Expect = 8e-17
 Identities = 27/165 (16%), Positives = 54/165 (32%), Gaps = 8/165 (4%)

Query: 9   KEYGP-ISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQP-SLIRRIYGERSITGLGV 66
           + Y   + +  LL    + + G  A K  Y  D     N  P  + + ++G  +I G+  
Sbjct: 25  ERYNSDLFQARLLGKNFICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDG 84

Query: 67  DEHKRLRGALESFFKPEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSS 126
             H   +    S   P   K+    M E+ +  +   W    +V +    K +   +   
Sbjct: 85  SAHIHRKMLFLSLMTPPHQKRLAELMTEEWKAAVT-RWEKADEVVLFEEAKEILCRVACY 143

Query: 127 LIFGIEQGATINAFIELFQDIMDGIVSIPINCPFTRFNRGLKIHQ 171
                 +   +    + F D++D            R  +G +   
Sbjct: 144 WAGVPLKETEVKERADDFIDMVDA-----FGAVGPRHWKGRRARP 183
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.98
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.98
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.97
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.97
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.97
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.97
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.96
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.96
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.96
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.93
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.93
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cyp175a1
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=4.4e-40  Score=256.45  Aligned_cols=210  Identities=17%  Similarity=0.226  Sum_probs=173.7

Q ss_pred             hhhhHHhhhcCCceeeccCCcceEEEECcccchhccccCCCeEeecchhHHHHHcCCCcccccChhHHHHHHHHHHhcCC
Q 044998            2 NGFKIELKEYGPISKLSLLVTPTVYIYGQAANKFVYTCDDNALANQQPSLIRRIYGERSITGLGVDEHKRLRGALESFFK   81 (221)
Q Consensus         2 ~~~~~~~~~yG~v~~~~~~~~~~v~v~~p~~~~~vl~~~~~~~~~~~~~~~~~~~g~~~~~~~~g~~~~~~R~~~~~~f~   81 (221)
                      +++.+++++||++| +++++.|+++++||+++++||.++...+++.....+.+++| +|+++++|+.|+++|+++.++|+
T Consensus        22 ~~~~~~~~kyg~v~-~~~~~~p~v~v~dp~~v~~il~~~~~~~~~~~~~~~~~~~G-~gl~~~~g~~wk~~R~~l~~~f~   99 (385)
T d1n97a_          22 AVLLAWGRAHPRLF-LPLPRFPLALIFDPEGVEGALLAEGTTKATFQYRALSRLTG-RGLLTDWGESWKEARKALKDPFL   99 (385)
T ss_dssp             HHHHHHHHHCSEEE-ECCTTCCEEEECSHHHHHHHHHCTTEECCSHHHHHHHHHHC-SSTTTCCHHHHHHHHHHHCGGGS
T ss_pred             HHHHHHHHHCCCEE-EEeCCEEEEEECCHHHHHHHHcCCCCCcCCccHHHHHHHhC-CceecCCHHHHHHHHHHHhhhhc
Confidence            47889999999988 88899999999999999999988665555555556778888 58889999999999999999999


Q ss_pred             HHHHHHhHHHHHHHHHHHHhccccCCCeeeeHHHHHHHHHHHHHHHHcCCCChhhH-HHHHHHHHHHhccccc----c--
Q 044998           82 PEVLKQYVGKMDEDIRKHLNMHWHGKQKVAVMPLMKSLTFNIPSSLIFGIEQGATI-NAFIELFQDIMDGIVS----I--  154 (221)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~d~~~~~~~~~~~vi~~~~~g~~~~~~~-~~~~~~~~~~~~~~~~----~--  154 (221)
                      ++.++.+.+.+.+.++++++. |. ++++|+.+.+..++++++++++||.+..+.. +...+.+..+......    +  
T Consensus       100 ~~~l~~~~~~~~~~~~~l~~~-l~-~~~vdl~~~l~~~~~~vi~~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (385)
T d1n97a_         100 PKNVRGYREAMEEEARAFFGE-WR-GEERDLDHEMLALSLRLLGRALFGKPLSPSLAEHALKALDRIMAQTRSPLALLDL  177 (385)
T ss_dssp             HHHHHTTHHHHHHHHHHHHHT-CC-SCCEEHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHHHCGGGGGCH
T ss_pred             ccccccchhhHHHHHHHHHhh-cc-ccchhHHHHHHHHhhhhhhhhhhccccccchhhhhhhhhhHHHHHHhhhhhhhhh
Confidence            999999999999999999998 86 5679999999999999999999998754322 1122222111110000    0  


Q ss_pred             --------------------------------------------------------------------------------
Q 044998          155 --------------------------------------------------------------------------------  154 (221)
Q Consensus       155 --------------------------------------------------------------------------------  154 (221)
                                                                                                      
T Consensus       178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ei~~~~~~~l~ag~dTt~~~l~~~l~~L~~~P~v~~~l~~E~~~~~a~  257 (385)
T d1n97a_         178 AAEARFRKDRGALYREAEALIVHPPLSHLPRERALSEAVTLLVAGHETVASALTWSFLLLSHRPDWQKRVAESEEAALAA  257 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGTTSTTGGGSCHHHHHHHHHHHHHHHSHHHHHHHHHHHHHHTTCHHHHHHHHHCHHHHHHH
T ss_pred             HHHHHHHHhhhhhHHHHHHHHhhcccccCCHHHHHHHHHHHHHhhhccchhhhhhhhhHhhhhcccccccccccccccce
Confidence                                                                                            


Q ss_pred             -------------------------------------------------cccCCCccccccccccccceeeecCCccCCc
Q 044998          155 -------------------------------------------------PINCPFTRFNRGLKIHQSSSVAFRGGPWICP  185 (221)
Q Consensus       155 -------------------------------------------------p~~f~p~r~~~~~~~~~~~~~~FG~G~r~C~  185 (221)
                                                                       |..|+|+||.+.....+..++|||+|+|.||
T Consensus       258 i~EtlRl~p~~~~~~r~~~~d~~~~g~~i~~g~~v~~~~~~~~~~~~~dp~~F~PeRf~~~~~~~~~~~lpFG~G~r~C~  337 (385)
T d1n97a_         258 FQEALRLYPPAWILTRRLERPLLLGEDRLPPGTTLVLSPYVTQRLHFPDGEAFRPERFLEERGTPSGRYFPFGLGQRLCL  337 (385)
T ss_dssp             HHHHHHHSCSSCCEEEEESSCEEETTEEECTTCEEEECHHHHHHHSSTTTTSCCTTHHHHSCCCCBTTBCTTCCSTTCCT
T ss_pred             eeccccccccccccccccccccccccccccccccccccccccccccCCCCcccCccccCcccCCCCCCccCCCCCcccCc
Confidence                                                             7799999998766666788999999999999


Q ss_pred             chhHHHHHHHHHHHHhhcccceeecccccc
Q 044998          186 GHEFTRIENLATIHHLVTPFSWKSFSSFQA  215 (221)
Q Consensus       186 G~~~A~~e~~~~l~~ll~~f~~~~~~g~~~  215 (221)
                      |++||++|++++++.||++|+|+++++.+.
T Consensus       338 G~~la~~~~~~~l~~ll~~f~~~~~~~~~~  367 (385)
T d1n97a_         338 GRDFALLEGPIVLRAFFRRFRLDPLPFPRV  367 (385)
T ss_dssp             THHHHHHHHHHHHHHHHTTCBCCCCCCCCE
T ss_pred             hHHHHHHHHHHHHHHHHHhCEEEeCCCCcc
Confidence            999999999999999999999999888544
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure