Citrus Sinensis ID: 045109
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 423 | ||||||
| 255552906 | 441 | electron transporter, putative [Ricinus | 0.940 | 0.902 | 0.595 | 1e-127 | |
| 225452759 | 429 | PREDICTED: uncharacterized protein At5g3 | 0.940 | 0.927 | 0.562 | 1e-124 | |
| 356567038 | 448 | PREDICTED: uncharacterized protein At5g3 | 0.924 | 0.872 | 0.552 | 1e-114 | |
| 356529943 | 458 | PREDICTED: uncharacterized protein At5g3 | 0.931 | 0.860 | 0.534 | 1e-109 | |
| 357501775 | 433 | hypothetical protein MTR_7g010090 [Medic | 0.884 | 0.863 | 0.520 | 1e-105 | |
| 449505871 | 393 | PREDICTED: uncharacterized protein At3g2 | 0.853 | 0.918 | 0.517 | 1e-100 | |
| 297801614 | 414 | glutaredoxin family protein [Arabidopsis | 0.851 | 0.869 | 0.489 | 1e-98 | |
| 449461955 | 391 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.848 | 0.918 | 0.510 | 1e-98 | |
| 22327469 | 390 | glutaredoxin-like protein [Arabidopsis t | 0.836 | 0.907 | 0.489 | 6e-98 | |
| 224141375 | 383 | hypothetical protein POPTRDRAFT_259048 [ | 0.822 | 0.908 | 0.501 | 4e-97 |
| >gi|255552906|ref|XP_002517496.1| electron transporter, putative [Ricinus communis] gi|223543507|gb|EEF45038.1| electron transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 460 bits (1184), Expect = e-127, Method: Compositional matrix adjust.
Identities = 261/438 (59%), Positives = 302/438 (68%), Gaps = 40/438 (9%)
Query: 1 HVHHPPQTKGDSYHVVALRSSTLGSLKLDFK-------NQSSLVDIDLDADHHQQHDDDQ 53
HV HPPQ KGDSYHVVAL S+TLGSL LD N ++ +DI A+ + D
Sbjct: 29 HVVHPPQQKGDSYHVVALTSTTLGSLPLDSTSNCKDSININTAIDIFAAAEGNNDQGDTS 88
Query: 54 KVSDNQCNGDLLDKFDKSKRKSEEFSTGLIRAKEWSNMIQEKIPKVVPKTPVRTPPGEPE 113
G+ DK KR S+EFS GLI AK WSNMIQ+KIPK+VPKTP+RTPPGEPE
Sbjct: 89 DCDVRNGIGN-----DKEKR-SKEFSVGLIEAKTWSNMIQDKIPKIVPKTPIRTPPGEPE 142
Query: 114 TINAWELMEGLEDVSPLRSPNHFRSFSFDFARGPSSLLDSDPPMSKLCEDVSAERKTMSM 173
TIN WELM GLE+ L P+ +RSFSFD +R PS + DS KL + + K
Sbjct: 143 TINTWELMAGLEEDDSLSVPHRYRSFSFDVSRDPSPVQDS----PKLNPTLLSPNKNKPF 198
Query: 174 WLQMANGDDHGDSESNSKPFALEFDPDVIKTFRKSFQELSPRHPFHLRPLEN-DKLPAAL 232
WLQ+A D ++NSK EFDP VI TFRKS QELSP HPF+L+ EN +K P +
Sbjct: 199 WLQIA------DEDTNSK--CPEFDPQVISTFRKSLQELSPDHPFYLKSSENGEKQPPSS 250
Query: 233 DSLDVKKSNGAVLDH-KCGKEKLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLS 291
D SN D+ K GKEKLVVYFTSLRG+RKTYEDCCHVRVILKGLGVRVDERD+S
Sbjct: 251 DP-----SNVVAKDYCKGGKEKLVVYFTSLRGVRKTYEDCCHVRVILKGLGVRVDERDVS 305
Query: 292 MHSGFKNELKELLGDGFSGGGLPRVFVGKKYIGGAEEIRRMHEEGQLEKVVEGCEMIDDG 351
MHSGFK ELKELLG+GF GGGLPRVF+G KY+GGAEEIRRMHEEGQLEKVVEGCEM++D
Sbjct: 306 MHSGFKEELKELLGEGFCGGGLPRVFIGTKYLGGAEEIRRMHEEGQLEKVVEGCEMLEDD 365
Query: 352 GRGNVGACEACGDVRFVPCETCSGSCKIYYEKE------EEVEEDSEGGWVGEEADFGFQ 405
G DVRF+PCETC+GSCKIYYE+ E+ E + EE ++GFQ
Sbjct: 366 SGGGGCEGCG--DVRFIPCETCNGSCKIYYERHEEEEEEEDGEAAAAAEEELEEGEYGFQ 423
Query: 406 RCPDCNENGLTRCPICCF 423
RCPDCNENGL RCPICC+
Sbjct: 424 RCPDCNENGLIRCPICCY 441
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452759|ref|XP_002277734.1| PREDICTED: uncharacterized protein At5g39865-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356567038|ref|XP_003551730.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356529943|ref|XP_003533545.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357501775|ref|XP_003621176.1| hypothetical protein MTR_7g010090 [Medicago truncatula] gi|87240364|gb|ABD32222.1| Thioredoxin fold [Medicago truncatula] gi|355496191|gb|AES77394.1| hypothetical protein MTR_7g010090 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449505871|ref|XP_004162591.1| PREDICTED: uncharacterized protein At3g28850-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297801614|ref|XP_002868691.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] gi|297314527|gb|EFH44950.1| glutaredoxin family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449461955|ref|XP_004148707.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At3g28850-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|22327469|ref|NP_680368.1| glutaredoxin-like protein [Arabidopsis thaliana] gi|75171457|sp|Q9FLE8.1|Y5986_ARATH RecName: Full=Uncharacterized protein At5g39865 gi|10176979|dbj|BAB10211.1| unnamed protein product [Arabidopsis thaliana] gi|19347749|gb|AAL86299.1| unknown protein [Arabidopsis thaliana] gi|22136720|gb|AAM91679.1| unknown protein [Arabidopsis thaliana] gi|332007102|gb|AED94485.1| glutaredoxin-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224141375|ref|XP_002324048.1| hypothetical protein POPTRDRAFT_259048 [Populus trichocarpa] gi|222867050|gb|EEF04181.1| hypothetical protein POPTRDRAFT_259048 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 423 | ||||||
| TAIR|locus:2098408 | 428 | AT3G28850 [Arabidopsis thalian | 0.557 | 0.551 | 0.535 | 5.5e-92 | |
| TAIR|locus:504954828 | 390 | AT5G39865 [Arabidopsis thalian | 0.569 | 0.617 | 0.484 | 9.1e-88 | |
| TAIR|locus:2080635 | 417 | AT3G57070 [Arabidopsis thalian | 0.437 | 0.443 | 0.371 | 1.6e-53 | |
| TAIR|locus:2040267 | 402 | AT2G41330 [Arabidopsis thalian | 0.439 | 0.462 | 0.376 | 6.4e-51 | |
| TAIR|locus:2150640 | 384 | AT5G03870 [Arabidopsis thalian | 0.420 | 0.463 | 0.348 | 4.8e-43 | |
| TAIR|locus:2139252 | 334 | AT4G10630 [Arabidopsis thalian | 0.439 | 0.556 | 0.370 | 8.6e-37 | |
| TAIR|locus:2171223 | 273 | AT5G58530 [Arabidopsis thalian | 0.295 | 0.457 | 0.467 | 6.2e-33 | |
| TAIR|locus:2035589 | 314 | AT1G32760 [Arabidopsis thalian | 0.359 | 0.484 | 0.418 | 1.6e-32 | |
| TAIR|locus:2019479 | 368 | AT1G64500 [Arabidopsis thalian | 0.373 | 0.429 | 0.440 | 2.9e-32 | |
| TAIR|locus:2159038 | 274 | AT5G13810 [Arabidopsis thalian | 0.373 | 0.576 | 0.397 | 8.2e-28 |
| TAIR|locus:2098408 AT3G28850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 688 (247.2 bits), Expect = 5.5e-92, Sum P(2) = 5.5e-92
Identities = 137/256 (53%), Positives = 175/256 (68%)
Query: 173 MWLQMANGDDHGDSESNSKPFALEFDPDVIKTFRKSFQELSPRHPFHLRPLENDKLPAAL 232
+WLQM E + F +FDP++I +FRKS QEL HPFH+ + + P
Sbjct: 186 VWLQM---------EEEEEGFE-DFDPEIISSFRKSLQELPSDHPFHISNHDFELKPRFN 235
Query: 233 DSLDVKKSNGAVLDHKCGKEKLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLSM 292
S + K+ + GKE++++YFTSLRGIRKTYE+ C VRVILK LG+RVDERD+SM
Sbjct: 236 FSDEEKEEE----EQSVGKERVILYFTSLRGIRKTYEESCDVRVILKSLGIRVDERDVSM 291
Query: 293 HSGFKNELKELLGDGFSGG-G--LPRVFVGKKYIGGAEEIRRMHEEGQLEKVVEGCEMID 349
HSGFK+ELKELLG+ F+ G G LPRVF+G+KYIGGAEEIR+++E+G+LEK++ GCE ++
Sbjct: 292 HSGFKDELKELLGEKFNKGVGITLPRVFLGRKYIGGAEEIRKLNEDGKLEKLLGGCERVE 351
Query: 350 DGGRGNVGACEACGDVRFVPCETCSGSCKIYYXXXXXXXXXXXXXXXXXXAD---FGFQR 406
+ GN CEACGDVRFVPCETCSGSCK+YY + +GFQ
Sbjct: 352 ENQNGNGLECEACGDVRFVPCETCSGSCKVYYEYEDDDDDDDEGDDDESVKEEREYGFQT 411
Query: 407 CPDCNENGLTRCPICC 422
CPDCNENGL RCP+CC
Sbjct: 412 CPDCNENGLIRCPVCC 427
|
|
| TAIR|locus:504954828 AT5G39865 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080635 AT3G57070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040267 AT2G41330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150640 AT5G03870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139252 AT4G10630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171223 AT5G58530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035589 AT1G32760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019479 AT1G64500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159038 AT5G13810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 423 | |||
| cd03031 | 147 | cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, | 4e-72 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 3e-16 | |
| pfam00462 | 60 | pfam00462, Glutaredoxin, Glutaredoxin | 2e-09 | |
| cd03419 | 82 | cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam | 4e-08 | |
| cd03027 | 73 | cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishe | 2e-05 | |
| TIGR02180 | 84 | TIGR02180, GRX_euk, Glutaredoxin | 3e-05 | |
| TIGR02189 | 99 | TIGR02189, GlrX-like_plant, Glutaredoxin-like fami | 1e-04 |
| >gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
Score = 222 bits (569), Expect = 4e-72
Identities = 82/166 (49%), Positives = 106/166 (63%), Gaps = 19/166 (11%)
Query: 253 KLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLSMHSGFKNELKELLGDGFSGGG 312
++V+Y TSLRG+RKT+EDC +VR IL+ V+ DERD+SM SGF+ EL+ELLG
Sbjct: 1 RVVLYTTSLRGVRKTFEDCNNVRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVS 60
Query: 313 LPRVFVGKKYIGGAEEIRRMHEEGQLEKVVEGCEMIDDGGRGNVGACEACGDVRFVPCET 372
LPRVFV +Y+GGAEE+ R++E G+L K+++G G G CE CG RFVPC
Sbjct: 61 LPRVFVDGRYLGGAEEVLRLNESGELRKLLKGIRARAGG-----GVCEGCGGARFVPCSE 115
Query: 373 CSGSCKIYYEKEEEVEEDSEGGWVGEEADFGFQRCPDCNENGLTRC 418
C+GSCK++ E A GF RCP+CNENGL RC
Sbjct: 116 CNGSCKVFAE--------------NATAAGGFLRCPECNENGLVRC 147
|
This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive. Length = 147 |
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239325 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 423 | |||
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 100.0 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 100.0 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.9 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.85 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.85 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.82 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.82 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 99.82 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.78 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.73 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.72 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.7 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.68 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.63 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.6 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.6 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.57 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.56 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.55 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 99.5 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.48 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.45 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.45 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.45 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.45 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.36 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.28 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 98.95 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 98.89 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.61 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.53 | |
| KOG4023 | 108 | consensus Uncharacterized conserved protein [Funct | 98.16 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.03 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 97.93 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 97.58 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 97.46 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 97.38 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 97.27 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 96.96 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 96.93 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 96.86 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 96.77 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 96.63 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 96.43 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 96.2 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 96.19 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 96.13 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 96.08 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 96.06 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 96.05 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 95.89 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 95.79 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 95.76 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 95.67 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 95.65 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 95.56 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 95.49 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 95.35 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 95.34 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 95.2 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 95.05 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 94.83 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 94.8 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 94.69 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 94.53 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 94.4 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 94.08 | |
| PHA02125 | 75 | thioredoxin-like protein | 93.88 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 93.2 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 92.91 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 92.89 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 92.7 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 92.68 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 92.28 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 92.26 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 92.17 | |
| PRK10853 | 118 | putative reductase; Provisional | 92.0 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 91.85 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 91.8 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 91.72 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 91.61 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 91.57 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 91.02 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 90.29 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 90.2 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 89.77 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 88.81 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 88.7 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 88.66 | |
| PHA02278 | 103 | thioredoxin-like protein | 88.65 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 88.5 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 88.32 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 87.71 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 87.68 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 87.55 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 87.39 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 87.2 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 86.55 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 86.49 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 86.24 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 86.16 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 86.12 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 86.03 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 85.86 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 85.51 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 85.04 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 84.8 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 84.51 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 84.05 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 83.97 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 83.94 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 83.87 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 83.78 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 83.75 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 83.67 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 83.65 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 83.63 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 83.56 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 83.56 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 83.49 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 83.4 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 83.35 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 83.21 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 83.16 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 83.13 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 83.11 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 83.02 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 82.87 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 82.86 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 82.86 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 82.73 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 82.68 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 82.66 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 82.53 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 82.33 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 82.21 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 82.2 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 82.1 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 82.09 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 82.09 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 82.03 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 81.87 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 81.56 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 81.52 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 81.33 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 81.31 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 81.29 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 81.07 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 80.9 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 80.7 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 80.65 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 80.62 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 80.16 |
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-64 Score=489.30 Aligned_cols=254 Identities=42% Similarity=0.721 Sum_probs=190.1
Q ss_pred hhhhhhhhhcCCcccCCCCCCCCCCCCCcchHHhhccCCCCCCCC--CCCCCCCCccccccCCCCCCCCCCCCccccccc
Q 045109 86 KEWSNMIQEKIPKVVPKTPVRTPPGEPETINAWELMEGLEDVSPL--RSPNHFRSFSFDFARGPSSLLDSDPPMSKLCED 163 (423)
Q Consensus 86 ~~~~~~~~~~~~~~~~~tp~~tp~~epe~IN~WELM~GLed~~~~--~~p~~~~~fs~~~~~~~~~~~~~~~~~~~~~~~ 163 (423)
+.|.++...+++.+ ....+|..||+||+||||.||++..++ ++|....++|+....... .++
T Consensus 22 ~~~~~~k~~~~~~~----~~~~~~~~~~~i~s~e~~~~l~~~~~~~~~~p~~~~~~~~~~~~~~~----~~~-------- 85 (281)
T KOG2824|consen 22 RVTVSGKESKIAPI----RDSSSPTGPEVINSWELMLDLDDELHRSCKTPITPTSVSLRVKALNL----LGK-------- 85 (281)
T ss_pred ceeccccccccccc----ccCCCCCchhhhhhhhhccCccccccccccCCCCCcccccccccccc----ccc--------
Confidence 34444444444433 334667799999999999999999885 777665555443222211 000
Q ss_pred hhhhhhhhhhHhhhcCCCCCCCCCCCCCCCCCCCCHH---HHHHHHHHhhhcCCCCCCcCCCCccCcchhhhchhhhccC
Q 045109 164 VSAERKTMSMWLQMANGDDHGDSESNSKPFALEFDPD---VIKTFRKSFQELSPRHPFHLRPLENDKLPAALDSLDVKKS 240 (423)
Q Consensus 164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fdp~---~is~frkal~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 240 (423)
...+.+|+|+... . ...+.++...+|++ ++..|++
T Consensus 86 --s~~~~~p~~~~~~------~-~~~~~~~l~~~~~~~~~~~~e~~~--------------------------------- 123 (281)
T KOG2824|consen 86 --SKGSWPPVILKPE------K-RLSSESGLKELDKSPNKLLLEFKE--------------------------------- 123 (281)
T ss_pred --ccCcCCccccccc------c-cccccccccccccccccchhhhhh---------------------------------
Confidence 0012244444332 0 00112345555554 1111111
Q ss_pred hhHHHhhhcCCCcEEEEEeCCCCCCCCCCcHHHHHHHHHhCCCcEEEEECCCChhhHHHHHHHHcCCCCCCCCCceEeCC
Q 045109 241 NGAVLDHKCGKEKLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLSMHSGFKNELKELLGDGFSGGGLPRVFVGK 320 (423)
Q Consensus 241 ~~~~v~~li~~~kVVIYtTSLrGIRKT~c~Cc~VK~LL~~~gV~yeErDVsmd~~~reEL~~lLg~~tg~~TVPQVFVdG 320 (423)
+-.+.++++||||||||||||+||++|+.||+||++++|.|+||||+||..|++||+++|+......++|||||+|
T Consensus 124 ----~~~Pgge~~VVvY~TsLRgvRkTfE~C~~VR~ilesf~V~v~ERDVSMd~~fr~EL~~~lg~~~~~~~LPrVFV~G 199 (281)
T KOG2824|consen 124 ----VCPPGGEDRVVVYTTSLRGVRKTFEDCNAVRAILESFRVKVDERDVSMDSEFREELQELLGEDEKAVSLPRVFVKG 199 (281)
T ss_pred ----cCCCCCCceEEEEEcccchhhhhHHHHHHHHHHHHhCceEEEEecccccHHHHHHHHHHHhcccccCccCeEEEcc
Confidence 0125678899999999999999999999999999999999999999999999999999999855567999999999
Q ss_pred EEEcchHHHHHHHHcCchHHHHcccccccCCCCCCCccccccCccceEeCCCCCCcceeccccchhhhcccCCCCccccC
Q 045109 321 KYIGGAEEIRRMHEEGQLEKVVEGCEMIDDGGRGNVGACEACGDVRFVPCETCSGSCKIYYEKEEEVEEDSEGGWVGEEA 400 (423)
Q Consensus 321 e~IGGaDEV~~LhEsGeL~kLL~~~~~~~~~~~g~~~~C~~CGG~rfVpC~~C~GS~Kv~~~~~~~~~~~~~~~~~~~~~ 400 (423)
+||||+++|++|||.|+|.+||++++.. ..+.|++|||.||+||..||||||++.+. ..
T Consensus 200 ryIGgaeeV~~LnE~GkL~~lL~~~p~~------~~~~C~~CGg~rFlpC~~C~GS~kv~~~~---------------~~ 258 (281)
T KOG2824|consen 200 RYIGGAEEVVRLNEEGKLGKLLKGIPCE------GGGVCESCGGARFLPCSNCHGSCKVHEEE---------------ED 258 (281)
T ss_pred EEeccHHHhhhhhhcchHHHHHhcCCCC------CCCcCCCcCCcceEecCCCCCceeeeeec---------------cC
Confidence 9999999999999999999999999932 25789999999999999999999999851 12
Q ss_pred ccceeeCCCCCCCCcccCCCCC
Q 045109 401 DFGFQRCPDCNENGLTRCPICC 422 (423)
Q Consensus 401 ~~~~~RC~~CNENGLirCp~C~ 422 (423)
+++|+||++||||||||||+|+
T Consensus 259 ~~~~~rC~~CNENGLvrCp~Cs 280 (281)
T KOG2824|consen 259 DGGVLRCLECNENGLVRCPVCS 280 (281)
T ss_pred CCcEEECcccCCCCceeCCccC
Confidence 4579999999999999999997
|
|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >KOG4023 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 423 | |||
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 2e-24 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 1e-20 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 3e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 8e-07 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 9e-07 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 4e-06 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 8e-06 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 2e-05 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 2e-05 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 2e-05 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 4e-05 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 5e-05 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 7e-05 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 9e-05 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 1e-04 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 2e-04 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 3e-04 |
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
Score = 95.2 bits (237), Expect = 2e-24
Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 2/88 (2%)
Query: 253 KLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLSMHSGFKNELKELLGDGFSGGG 312
L VY TS+ G R+ V IL G ++ D+S + ++E++ L G+
Sbjct: 3 GLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNP--KAT 60
Query: 313 LPRVFVGKKYIGGAEEIRRMHEEGQLEK 340
P++ G Y G E E+ L++
Sbjct: 61 PPQIVNGNHYCGDYELFVEAVEQDTLQE 88
|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 423 | |||
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.86 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.84 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.83 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.82 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.82 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.82 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.79 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.79 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.77 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.77 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.76 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.76 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.75 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.74 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.72 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.68 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.67 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.63 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.6 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.59 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.56 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.54 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.54 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.53 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.52 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.51 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.39 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.36 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.26 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.19 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.15 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.13 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.1 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 98.98 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.84 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.71 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.53 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.35 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.16 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 97.9 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 97.88 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 97.69 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 97.49 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 97.41 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.02 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 96.74 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 96.73 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 96.65 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 96.64 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 96.54 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 96.17 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 96.08 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 96.08 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 96.02 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 95.82 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 95.67 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 95.4 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 95.07 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 94.48 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 94.4 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 94.1 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 93.85 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 93.75 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 93.73 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 93.68 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 93.64 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 93.43 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 93.29 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 93.28 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 93.25 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 93.09 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 93.08 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 93.06 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 93.04 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 93.0 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 92.99 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 92.98 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 92.98 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 92.82 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 92.81 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 92.8 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 92.77 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 92.68 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 92.65 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 92.63 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 92.62 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 92.57 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 92.55 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 92.48 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 92.43 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 92.38 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 92.36 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 92.28 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 92.23 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 92.21 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 92.21 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 92.12 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 92.07 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 92.06 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 92.04 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 91.99 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 91.92 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 91.8 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 91.78 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 91.74 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 91.56 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 91.5 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 91.47 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 91.38 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 91.31 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 91.3 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 91.19 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 91.16 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 91.15 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 91.12 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 91.06 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 91.01 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 91.01 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 91.01 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 90.92 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 90.86 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 90.82 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 90.79 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 90.78 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 90.74 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 90.74 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 90.72 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 90.66 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 90.58 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 90.45 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 90.44 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 90.43 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 90.38 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 90.33 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 90.3 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 90.19 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 90.15 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 90.14 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 90.13 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 90.1 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 90.06 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 89.97 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 89.89 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 89.85 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 89.82 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 89.81 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 89.78 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 89.69 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 89.65 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 89.63 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 89.62 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 89.62 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 89.5 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 89.43 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 89.38 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 89.36 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 89.08 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 88.95 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 88.81 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 88.75 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 88.72 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 88.67 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 88.65 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 88.41 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 88.3 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 88.28 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 88.18 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 88.13 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 88.03 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 88.02 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 87.89 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 87.75 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 87.74 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 87.73 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 87.72 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 87.71 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 87.6 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 87.46 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 87.35 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 87.35 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 87.12 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 87.07 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 86.59 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 86.4 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 86.33 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 86.33 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 86.26 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 86.21 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 86.18 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 86.13 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 86.01 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 85.99 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 85.96 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 85.78 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 85.74 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 85.63 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 85.48 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 85.34 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 85.32 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 84.85 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 84.54 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 84.35 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 84.27 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 84.2 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 84.1 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 83.99 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 83.83 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 83.41 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 83.38 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 83.15 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 82.88 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 82.86 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 82.68 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 82.57 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 82.56 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 81.83 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 81.7 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 81.52 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 81.39 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 81.06 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 80.81 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 80.62 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 80.61 |
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.86 E-value=5.1e-22 Score=171.60 Aligned_cols=101 Identities=22% Similarity=0.398 Sum_probs=88.0
Q ss_pred hhHHHhhhcCCCcEEEEEeCCCCCC-CCCCcHHH-HHHHHHhCCC-cEEEEECCCChhhHHHHHHHHcCCCCCCCCCceE
Q 045109 241 NGAVLDHKCGKEKLVVYFTSLRGIR-KTYEDCCH-VRVILKGLGV-RVDERDLSMHSGFKNELKELLGDGFSGGGLPRVF 317 (423)
Q Consensus 241 ~~~~v~~li~~~kVVIYtTSLrGIR-KT~c~Cc~-VK~LL~~~gV-~yeErDVsmd~~~reEL~~lLg~~tg~~TVPQVF 317 (423)
....|+.+|.+++|||| ++|.. .++|+||. |+++|+.++| .|.++||..+.+.+++|.++. +|+||||||
T Consensus 9 ~~e~i~~~i~~~~VvvF---~Kgt~~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~s----g~~TvPqIF 81 (118)
T 2wul_A 9 SAEQLDALVKKDKVVVF---LKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYS----NWPTIPQVY 81 (118)
T ss_dssp CHHHHHHHHHHSSEEEE---ESBCSSSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHH----TCCSSCEEE
T ss_pred hHHHHHHHHhcCCEEEE---EcCCCCCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhc----cCCCCCeEe
Confidence 45678889999999999 34432 36899998 8999999999 599999999988888888876 478999999
Q ss_pred eCCEEEcchHHHHHHHHcCchHHHHcccccc
Q 045109 318 VGKKYIGGAEEIRRMHEEGQLEKVVEGCEMI 348 (423)
Q Consensus 318 VdGe~IGGaDEV~~LhEsGeL~kLL~~~~~~ 348 (423)
|||+||||+|+|++|+++|+|.++|+.++..
T Consensus 82 I~g~~IGG~Ddl~~l~~~GeL~~lL~~~Gi~ 112 (118)
T 2wul_A 82 LNGEFVGGCDILLQMHQNGDLVEELKKLGIH 112 (118)
T ss_dssp ETTEEEECHHHHHHHHHHTHHHHHHHHTTCC
T ss_pred ECCEEECCHHHHHHHHHCCCHHHHHHHcCCc
Confidence 9999999999999999999999999987753
|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 423 | ||||
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 2e-20 | |
| d1fova_ | 82 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 7e-09 | |
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 7e-08 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 8e-06 |
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: SH3BGR (SH3-binding, glutamic acid-rich protein-like) domain: SH3BGRL3 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 83.0 bits (205), Expect = 2e-20
Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 2/88 (2%)
Query: 253 KLVVYFTSLRGIRKTYEDCCHVRVILKGLGVRVDERDLSMHSGFKNELKELLGDGFSGGG 312
L VY TS+ G R+ V IL G ++ D+S + ++E++ L G+
Sbjct: 3 GLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNP--KAT 60
Query: 313 LPRVFVGKKYIGGAEEIRRMHEEGQLEK 340
P++ G Y G E E+ L++
Sbjct: 61 PPQIVNGNHYCGDYELFVEAVEQDTLQE 88
|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 423 | |||
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.85 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.85 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.84 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.8 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.56 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.56 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.46 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.46 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.44 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.03 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 97.38 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 97.36 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 96.95 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 96.7 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 96.58 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 96.38 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 96.26 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 96.26 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 96.12 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 95.82 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 95.63 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 95.36 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 95.29 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 94.73 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 94.65 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 94.31 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 93.52 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 93.37 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 92.53 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 92.28 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 92.19 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 91.7 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 90.69 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 89.52 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 89.03 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 88.77 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 87.99 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 87.81 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 87.8 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 87.79 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 87.16 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 87.02 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 86.11 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 85.72 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 84.25 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 83.51 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 82.22 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 82.07 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 81.56 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 81.48 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 80.93 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.85 E-value=7.9e-22 Score=165.25 Aligned_cols=99 Identities=17% Similarity=0.354 Sum_probs=86.8
Q ss_pred hHHHhhhcCCCcEEEEEeCCCCCCC-CCCcHHH-HHHHHHhCCCcEEEEECCCChhhHHHHHHHHcCCCCCCCCCceEeC
Q 045109 242 GAVLDHKCGKEKLVVYFTSLRGIRK-TYEDCCH-VRVILKGLGVRVDERDLSMHSGFKNELKELLGDGFSGGGLPRVFVG 319 (423)
Q Consensus 242 ~~~v~~li~~~kVVIYtTSLrGIRK-T~c~Cc~-VK~LL~~~gV~yeErDVsmd~~~reEL~~lLg~~tg~~TVPQVFVd 319 (423)
+..|+.++.+++|||| ++|.+. ++|++|. ||+||+.++|.|.++||+.+.+.+++|.+..+ ++|||||||+
T Consensus 5 ~~~i~~~i~~~~VvvF---~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~~~~~~~l~~~t~----~~TvPqIFi~ 77 (109)
T d1wika_ 5 SSGLKVLTNKASVMLF---MKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSN----WPTYPQLYVR 77 (109)
T ss_dssp CCCHHHHHTTSSEEEE---ESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSCHHHHHHHHHHHS----CCSSCEEECS
T ss_pred HHHHHHHHhcCCEEEE---eCCCCCCCCChHHHHHHHHHHhcCCCceEEEecccHHHHHHHHHhcC----CCCCCeEEEC
Confidence 3456789999999999 455432 7899998 89999999999999999988888888877654 6799999999
Q ss_pred CEEEcchHHHHHHHHcCchHHHHccccc
Q 045109 320 KKYIGGAEEIRRMHEEGQLEKVVEGCEM 347 (423)
Q Consensus 320 Ge~IGGaDEV~~LhEsGeL~kLL~~~~~ 347 (423)
|++|||+|+|++|+++|+|.++|+..++
T Consensus 78 g~~IGG~ddl~~l~~~G~L~~lL~~~~~ 105 (109)
T d1wika_ 78 GDLVGGLDIVKELKDNGELLPILKGESG 105 (109)
T ss_dssp SSEEECHHHHHHHHHHTCSHHHHHTCCS
T ss_pred CEEEcCHHHHHHHHHCCCHHHHHHhcCC
Confidence 9999999999999999999999998765
|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|