Citrus Sinensis ID: 045120
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 374 | ||||||
| 224083434 | 1144 | cc-nbs-lrr resistance protein [Populus t | 0.807 | 0.263 | 0.400 | 9e-52 | |
| 359488027 | 1520 | PREDICTED: disease resistance protein At | 0.804 | 0.198 | 0.382 | 3e-51 | |
| 147802546 | 1409 | hypothetical protein VITISV_007222 [Viti | 0.804 | 0.213 | 0.379 | 7e-51 | |
| 224111296 | 1315 | cc-nbs-lrr resistance protein [Populus t | 0.818 | 0.232 | 0.377 | 3e-47 | |
| 147782989 | 1351 | hypothetical protein VITISV_012099 [Viti | 0.826 | 0.228 | 0.369 | 6e-47 | |
| 224147195 | 554 | cc-nbs resistance protein [Populus trich | 0.820 | 0.554 | 0.361 | 8e-46 | |
| 147865073 | 1694 | hypothetical protein VITISV_021876 [Viti | 0.935 | 0.206 | 0.334 | 9e-46 | |
| 147866716 | 454 | hypothetical protein VITISV_025268 [Viti | 0.933 | 0.768 | 0.328 | 3e-45 | |
| 147772601 | 1392 | hypothetical protein VITISV_013427 [Viti | 0.810 | 0.217 | 0.357 | 3e-45 | |
| 296087869 | 1711 | unnamed protein product [Vitis vinifera] | 0.812 | 0.177 | 0.351 | 5e-45 |
| >gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 210 bits (535), Expect = 9e-52, Method: Compositional matrix adjust.
Identities = 143/357 (40%), Positives = 196/357 (54%), Gaps = 55/357 (15%)
Query: 1 MLEVIVTLVLELVKWLAPPTERQLVYLRKRNYNANLENLKAELEKLKVERTSIQLRVSEA 60
+LE I++ + + + P R++ + K YN N ENLK E++KLK + +Q V +A
Sbjct: 2 VLESIISTIGVVSQHTVVPIAREINHCLK--YNHNFENLKREVKKLKSAQLRVQHLVDDA 59
Query: 61 KEKGEEIEEKVEKWLT----------------------------------RYQLSKKAKT 86
+ GE I E V KWL+ RYQ SKKAK
Sbjct: 60 RNNGEAILEDVIKWLSLVEEASEKVEREILEDEDRARKKCFIGLCPDLKARYQCSKKAKA 119
Query: 87 EVKALIELGEEVKKFDIVSHCTIPEEIWLKSNKVYEAFESRVSNLKSTQNALTNAN---- 142
E + + L +E F VSH P+ + S + Y+A SR LK NALT A+
Sbjct: 120 ETRFVASLLDERDGFSTVSHRAAPKGMEAISIRSYDAMPSRTPVLKEIMNALTTADVNMV 179
Query: 143 -----GGIGKTTLAKEFAKQAREDKLFDRVVFSEVSQTSDIKKIQGDIAEKLGLELSEEA 197
GG+GKTTL KE A+QA ++KLF++VVF+ ++QT DIKKIQG IA++L L+ EE+
Sbjct: 180 GVYGMGGMGKTTLVKEAARQAIQEKLFNQVVFATITQTQDIKKIQGQIADQLSLKFDEES 239
Query: 198 EYRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRND---------SRDNNVVLLS 248
E RA RL +RLK E KIL+IL ++WK LDLE V IP +++ SR+ +V+
Sbjct: 240 ECGRAGRLRQRLKQEQKILIILDDLWKSLDLEAVGIPLKDEHEGCKMLVTSREFDVLSCG 299
Query: 249 MGSKDNFLIANITEEEAWRLFKIMNGDDVENCKFKSTAINVAKACGAGLFCTLTTNA 305
M + NF I ++EEE W LFK M GD VE+ +S AI VAK C AGL + T A
Sbjct: 300 MDIQKNFPINALSEEETWELFKKMAGDHVEHPDLQSLAIEVAKMC-AGLPVAIVTVA 355
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147802546|emb|CAN77665.1| hypothetical protein VITISV_007222 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147782989|emb|CAN68563.1| hypothetical protein VITISV_012099 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224147195|ref|XP_002336426.1| cc-nbs resistance protein [Populus trichocarpa] gi|222834979|gb|EEE73428.1| cc-nbs resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147866716|emb|CAN80506.1| hypothetical protein VITISV_025268 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147772601|emb|CAN62857.1| hypothetical protein VITISV_013427 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 374 | ||||||
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.542 | 0.206 | 0.285 | 1.4e-15 | |
| TAIR|locus:2131689 | 919 | AT4G27220 [Arabidopsis thalian | 0.465 | 0.189 | 0.307 | 4.7e-12 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.438 | 0.169 | 0.336 | 2e-10 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.395 | 0.166 | 0.323 | 3e-10 | |
| TAIR|locus:2197739 | 762 | AT1G61300 [Arabidopsis thalian | 0.435 | 0.213 | 0.329 | 8.9e-10 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.521 | 0.216 | 0.301 | 6.8e-09 | |
| TAIR|locus:2093192 | 375 | AT3G15700 [Arabidopsis thalian | 0.422 | 0.421 | 0.274 | 6.2e-08 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.462 | 0.194 | 0.292 | 8.9e-08 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.411 | 0.172 | 0.3 | 1.5e-07 | |
| TAIR|locus:2171589 | 948 | AT5G47260 [Arabidopsis thalian | 0.513 | 0.202 | 0.261 | 1.6e-07 |
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 222 (83.2 bits), Expect = 1.4e-15, P = 1.4e-15
Identities = 64/224 (28%), Positives = 116/224 (51%)
Query: 143 GGIGKTTLAKEFAKQARED---KLFDRVVFSEVSQTSDIKKIQGDIAEKLGLELS-EEAE 198
GG+GKTTL + + RE+ + F V+F VS+ D +++Q IAE+L ++ EE+E
Sbjct: 173 GGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESE 232
Query: 199 YRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRNDSRDNNVVLLS--------MG 250
+ A R+Y L E K L+IL ++WK +DL+ + IP +++ + V+L S M
Sbjct: 233 EKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMK 292
Query: 251 SKDNFLIANITEEEAWRLFKIMNGDDVENCKFKSTAINVAKACGAGLFCTLTTNAS---- 306
+ + + + EE+AW LF GD V + + A V++ CG +T +
Sbjct: 293 TDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGK 352
Query: 307 KSSSIYSHVSNDYQSIYKPKPYLAVFQD--LEPTIVKTAFVDPK 348
K+ +++HV + + K P++ ++ +P + F++ K
Sbjct: 353 KNVKLWNHVLS---KLSKSVPWIKSIEEKIFQPLKLSYDFLEDK 393
|
|
| TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093192 AT3G15700 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 374 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 9e-16 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 2e-06 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 76.6 bits (189), Expect = 9e-16
Identities = 40/140 (28%), Positives = 69/140 (49%), Gaps = 13/140 (9%)
Query: 143 GGIGKTTLAKEFAKQAREDKLFDRVVFSEVSQTSDIKKIQGDIAEKLGLE---LSEEAEY 199
GG+GKTTLAK+ FD V + VS+T ++Q DI ++LGL+ E+ E
Sbjct: 28 GGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNES 87
Query: 200 RRASRLYERLKNENKILVILANIWKLLDLETVKIPFRN---------DSRDNNVVLLSMG 250
A ++ E L + L++L ++W+ D + + +PF + +R +V G
Sbjct: 88 ELAVKIKEALL-RKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGG 146
Query: 251 SKDNFLIANITEEEAWRLFK 270
+ + ++ EE+W LF
Sbjct: 147 TSKPHEVESLEPEESWELFS 166
|
Length = 285 |
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 374 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.96 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.93 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.9 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.85 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.68 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.63 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.49 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.48 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.4 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.39 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.33 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.28 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.26 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.1 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.06 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.0 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 98.0 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.93 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 97.92 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.91 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.85 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.84 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.83 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.79 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.76 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 97.76 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 97.74 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.73 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.72 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.72 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.69 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.68 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.67 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.64 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.64 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.61 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.6 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.56 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.56 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.55 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.49 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.48 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.48 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 97.48 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.46 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.44 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.43 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.43 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 97.43 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.43 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.42 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.34 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.32 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.3 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.29 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.29 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.25 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.23 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.23 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.21 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.18 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.17 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 97.15 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.13 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.13 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.06 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.98 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.98 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.97 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.97 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.92 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.88 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.87 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.82 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.78 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.77 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.74 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.71 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.67 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.63 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.63 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.63 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 96.62 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 96.57 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.57 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.56 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.55 | |
| PRK08181 | 269 | transposase; Validated | 96.53 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.48 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.45 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.44 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.43 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.41 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 96.38 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.35 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.34 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.32 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.32 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.31 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.31 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.29 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.27 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.26 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.21 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.16 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.08 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.06 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.98 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.92 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 95.92 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 95.86 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.79 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.77 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 95.76 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.72 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 95.68 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.67 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.63 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 95.61 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.57 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.55 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.55 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.54 | |
| PRK06526 | 254 | transposase; Provisional | 95.52 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 95.52 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.5 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.49 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.48 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.45 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.44 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.29 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.27 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 95.26 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 95.21 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.18 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 95.1 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 95.05 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.03 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.01 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.95 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 94.95 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 94.94 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 94.93 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.91 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 94.89 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 94.84 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.84 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 94.82 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 94.8 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.79 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 94.79 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 94.74 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 94.73 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.6 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.6 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.58 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 94.58 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 94.58 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 94.54 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 94.52 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 94.48 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.48 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 94.46 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.45 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 94.42 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 94.37 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.27 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 94.26 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.25 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 94.25 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.25 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 94.21 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.16 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 94.14 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 94.07 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 94.05 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 94.04 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.01 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 93.98 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 93.97 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 93.9 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 93.88 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 93.87 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 93.6 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 93.57 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 93.55 | |
| PRK06620 | 214 | hypothetical protein; Validated | 93.53 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 93.52 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 93.5 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 93.38 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 93.37 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 93.36 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 93.22 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 93.19 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 93.17 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 93.08 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 93.02 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.01 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 92.98 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 92.83 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 92.8 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 92.78 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 92.74 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 92.61 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.61 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 92.55 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 92.48 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 92.45 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 92.43 | |
| PRK06696 | 223 | uridine kinase; Validated | 92.37 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 92.21 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 92.19 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.17 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 92.16 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 92.04 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 92.03 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 92.03 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 91.95 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 91.9 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 91.89 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 91.86 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 91.84 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 91.84 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 91.82 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 91.62 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 91.58 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 91.58 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 91.46 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 91.39 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.34 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 91.34 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.34 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 91.31 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 91.15 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 91.09 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 91.03 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 91.0 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 90.99 | |
| PF10923 | 416 | DUF2791: P-loop Domain of unknown function (DUF279 | 90.93 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 90.89 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 90.84 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 90.79 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 90.78 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 90.77 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 90.72 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.64 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 90.64 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 90.55 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 90.49 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 90.48 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 90.37 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 90.33 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 90.3 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.29 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 90.26 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 90.22 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 90.2 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 90.18 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 90.18 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.13 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 90.06 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 90.04 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 90.03 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 89.99 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 89.87 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 89.85 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 89.83 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 89.83 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 89.79 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 89.76 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 89.69 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 89.55 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 89.36 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 89.25 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 89.21 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 89.21 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 89.18 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 89.18 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 89.17 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 89.12 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 89.02 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 88.96 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 88.95 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 88.93 | |
| PRK07667 | 193 | uridine kinase; Provisional | 88.82 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 88.64 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 88.62 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 88.59 | |
| PF05659 | 147 | RPW8: Arabidopsis broad-spectrum mildew resistance | 88.58 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 88.57 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 88.49 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 88.43 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 88.28 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 88.26 | |
| PRK03839 | 180 | putative kinase; Provisional | 88.21 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 88.14 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 88.13 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 88.07 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 88.05 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 87.95 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 87.8 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 87.78 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 87.73 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 87.71 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 87.7 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 87.7 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 87.6 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 87.47 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 87.47 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 87.46 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 87.43 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 87.43 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 87.34 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 87.29 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 87.25 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 87.2 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 87.19 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 86.99 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 86.99 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 86.91 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 86.88 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 86.86 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 86.85 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 86.72 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 86.7 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 86.69 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 86.63 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 86.58 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 86.53 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 86.35 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 86.22 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 86.16 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 86.15 | |
| PLN02924 | 220 | thymidylate kinase | 86.15 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 86.14 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 86.08 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 86.06 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 86.05 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 86.05 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 85.98 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 85.9 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 85.89 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 85.88 | |
| PRK06217 | 183 | hypothetical protein; Validated | 85.86 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 85.82 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 85.81 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 85.8 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 85.79 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 85.75 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 85.74 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 85.74 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 85.73 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 85.69 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 85.67 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 85.64 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 85.56 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 85.54 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 85.54 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 85.47 | |
| PHA02244 | 383 | ATPase-like protein | 85.33 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 85.28 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 85.23 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 85.22 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 85.2 | |
| PRK13695 | 174 | putative NTPase; Provisional | 85.14 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 85.14 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 85.13 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 85.09 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 85.0 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 84.93 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 84.76 | |
| PRK10037 | 250 | cell division protein; Provisional | 84.7 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 84.44 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 84.33 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 84.31 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 84.28 | |
| KOG2859 | 293 | consensus DNA repair protein, member of the recA/R | 84.26 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 84.2 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 84.19 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 84.12 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 84.1 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 83.99 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 83.95 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 83.94 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 83.92 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 83.89 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 83.86 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 83.74 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 83.73 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 83.73 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 83.71 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 83.7 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 83.67 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 83.64 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 83.63 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 83.6 | |
| COG0305 | 435 | DnaB Replicative DNA helicase [DNA replication, re | 83.53 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 83.52 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 83.45 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 83.2 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 83.16 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 83.15 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 83.14 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 83.02 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 83.01 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 82.97 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 82.97 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 82.94 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 82.9 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 82.87 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 82.63 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 82.58 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 82.58 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 82.49 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 82.49 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 82.43 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 82.37 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 82.31 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 82.28 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 82.16 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 82.05 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 81.99 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 81.82 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 81.76 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 81.66 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 81.56 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 81.55 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 81.46 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 81.44 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 81.42 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 81.29 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 81.26 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 81.18 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 81.14 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 81.09 | |
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 81.02 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 80.79 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 80.78 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 80.77 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 80.71 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 80.41 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 80.28 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 80.15 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 80.15 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 80.07 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 80.04 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.4e-51 Score=419.91 Aligned_cols=347 Identities=23% Similarity=0.298 Sum_probs=261.2
Q ss_pred HhhhhHHHhhhhhhhccchHHHHHHHHHHHHHHHHHHHHH----------HHHHHHHHhchhhHHHHHHHH---------
Q 045120 15 WLAPPTERQLVYLRKRNYNANLENLKAELEKLKVERTSIQ----------LRVSEAKEKGEEIEEKVEKWL--------- 75 (374)
Q Consensus 15 ~l~~~~~~~~~~~~~~~~~~~~~~l~~~l~~L~~~l~~v~----------~~i~~a~~~~~~~~~~v~~wl--------- 75 (374)
++.+.+.+....+ .+....+..+++++..|+..+.++. .|.++.++.+++.++.+..+.
T Consensus 11 ~~~~~l~~~~~~~--~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~ 88 (889)
T KOG4658|consen 11 KLDQLLNRESECL--DGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN 88 (889)
T ss_pred hHHHHHHHHHHHH--hchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 3445555555556 6666666777777777777666533 356666666665555544333
Q ss_pred -----------------Hhhhh-------HHHHHHHHHHHHHHHHhccCCccccccC-CCcccccccccccccccccHHH
Q 045120 76 -----------------TRYQL-------SKKAKTEVKALIELGEEVKKFDIVSHCT-IPEEIWLKSNKVYEAFESRVSN 130 (374)
Q Consensus 76 -----------------~r~~~-------~~~i~~~~~~l~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~vGr~~~ 130 (374)
++++. ++++-++.+.++.+ .....|....... +.......|...... ||.+..
T Consensus 89 ~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l-~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~ 166 (889)
T KOG4658|consen 89 DLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESL-GSKGVFEVVGESLDPREKVETRPIQSESD-VGLETM 166 (889)
T ss_pred HHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHh-ccccceecccccccchhhcccCCCCcccc-ccHHHH
Confidence 12222 33333333333433 2233344433321 112223333333334 999999
Q ss_pred HHHHHHHhhcC---------CCCccHHHHHHHHHHHhh-hcCCCCeEEEEEeCCCCCHHHHHHHHHHHhCcCCch---hh
Q 045120 131 LKSTQNALTNA---------NGGIGKTTLAKEFAKQAR-EDKLFDRVVFSEVSQTSDIKKIQGDIAEKLGLELSE---EA 197 (374)
Q Consensus 131 ~~~i~~~L~~~---------~gGiGKTtLA~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~~~~~i~~~l~~~~~~---~~ 197 (374)
++++++.|.++ |||+||||||++++|+.. +.++||.++||+||+.++...++++|++.++..... .+
T Consensus 167 ~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~ 246 (889)
T KOG4658|consen 167 LEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKE 246 (889)
T ss_pred HHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhh
Confidence 99999999876 999999999999999988 999999999999999999999999999999874333 33
Q ss_pred HHHHHHHHHHHHhcCCeEEEEEeCCCCccccccccCcCCCC---------CcchhHhhhhcCCCCceecCCCCHHHHHHH
Q 045120 198 EYRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRND---------SRDNNVVLLSMGSKDNFLIANITEEEAWRL 268 (374)
Q Consensus 198 ~~~~~~~l~~~L~~~kr~LlVlDdv~~~~~~~~l~~~~~~~---------TR~~~va~~~~~~~~~~~l~~L~~~~s~~L 268 (374)
..+.+..|.+.|.+ |||||||||||+..+|+.++.|+|.. ||+..|+...|+....+++++|+.+|||+|
T Consensus 247 ~~~~~~~i~~~L~~-krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~L 325 (889)
T KOG4658|consen 247 EDELASKLLNLLEG-KRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDL 325 (889)
T ss_pred HHHHHHHHHHHhcc-CceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHH
Confidence 46788999999998 99999999999999999999999876 999999765588888999999999999999
Q ss_pred HHHhcCCC--CCCcchHHHHHHHHHHccCCchHHHHHHhc--CCC-cccccccccc----------cCCC-Ccccchhh-
Q 045120 269 FKIMNGDD--VENCKFKSTAINVAKACGAGLFCTLTTNAS--KSS-SIYSHVSNDY----------QSIY-KPKPYLAV- 331 (374)
Q Consensus 269 f~~~a~~~--~~~~~l~~~~~~I~~~c~~GlPLai~~ig~--~~~-~~~~W~~~~~----------~~~~-~~~~~~~l- 331 (374)
|++.+|.. ...+.++.+|++|+++| +|+|||++++|+ +.| +.++|++... +++. .+.+.+.+
T Consensus 326 F~~~v~~~~~~~~~~i~~lak~v~~kC-~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklS 404 (889)
T KOG4658|consen 326 FQKKVGPNTLGSHPDIEELAKEVAEKC-GGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLS 404 (889)
T ss_pred HHHhhccccccccccHHHHHHHHHHHh-CChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhcc
Confidence 99999844 33456899999999999 999999999999 555 8889944322 1222 33356666
Q ss_pred cccCCchhhhhhhc----CchhhhhcHHHHHHHHHhCCcce
Q 045120 332 FQDLEPTIVKTAFV----DPKWYLALKEEFEALQRNQTWSL 368 (374)
Q Consensus 332 y~~Lp~~~lk~cfL----fp~~~~i~~~~Li~~W~~~~~~~ 368 (374)
|++||+ ++|+||| ||+||.|++++||..|+|+||.-
T Consensus 405 yd~L~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~ 444 (889)
T KOG4658|consen 405 YDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFID 444 (889)
T ss_pred HhhhhH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcC
Confidence 999995 5999996 99999999999999999999753
|
|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG2859 consensus DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 374 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-20 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 1e-15 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-09 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 91.1 bits (225), Expect = 6e-20
Identities = 58/396 (14%), Positives = 131/396 (33%), Gaps = 92/396 (23%)
Query: 40 KAELEKLKVERTSIQ--LRVSEA-KEKGEEIEEK-VE-------KWL-TRYQLSKKAKT- 86
K E++ + + + ++ LR+ K EE+ +K VE K+L + + ++ +
Sbjct: 48 KEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSM 107
Query: 87 -------EVKALIELGEEVKKFDIVSHCTIPEEIWLKSNKVYEAFESRVSNLKSTQNALT 139
+ L + K+++ + + + E L+ +N L
Sbjct: 108 MTRMYIEQRDRLYNDNQVFAKYNV----SRLQPYLKLRQALLE--------LRPAKNVLI 155
Query: 140 NANGGIGKTTLAKEFAKQAREDKLFDRVVF----SEVSQTSDIKKIQGDIAEKLGLELSE 195
+ G GKT +A + + D +F + + ++ + ++ +
Sbjct: 156 DGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTS 215
Query: 196 EAEY-----RRASRLYERL------KNENKILVILANIWKLLDLETVKIPFRND------ 238
+++ R + L K L++L N+ + + F
Sbjct: 216 RSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQ---NAKAWN-AFNLSCKILLT 271
Query: 239 SRDNNV--VLLSMGSKDNFLI---ANITEEEAWRLF-KIMNGDD----VENCKFKSTAIN 288
+R V L + + L +T +E L K ++ E ++
Sbjct: 272 TRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLS 331
Query: 289 VAKACGAGL---FCT----LTTNASK-----SSSIYSHVSNDYQSIYKPKPYLAVFQD-- 334
+ + T N K SS+ +Y+ ++ L+VF
Sbjct: 332 I---IAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFD---RLSVFPPSA 385
Query: 335 LEPTIVKTAFVDPKWYLALKEEFEA-LQRNQTWSLV 369
PTI+ + W+ +K + + + +SLV
Sbjct: 386 HIPTILLSLI----WFDVIKSDVMVVVNKLHKYSLV 417
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 374 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 100.0 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.96 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.96 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.93 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 99.32 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.17 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 99.1 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.91 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.89 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.88 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.78 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.71 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.51 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.38 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 98.26 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.07 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.06 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.02 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.85 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.81 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.72 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.63 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.63 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.52 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.44 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.19 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.17 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.14 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.04 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.99 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.91 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 96.91 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.89 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 96.88 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.78 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.76 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.76 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.69 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.69 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.63 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.59 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.57 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.55 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.54 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.5 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.47 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.43 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.38 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.36 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.3 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.3 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.26 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.25 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.2 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.2 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.85 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 95.82 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.81 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.71 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 95.71 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 95.6 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.56 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.53 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.42 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.42 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.35 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.28 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.27 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.23 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.12 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.11 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.01 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.94 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 94.87 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.86 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.85 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 94.77 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 94.74 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 94.72 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 94.42 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.38 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 94.3 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 94.23 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 94.21 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 94.19 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.93 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 93.91 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 93.71 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 93.6 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 93.46 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.13 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 93.04 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.03 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 92.76 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 92.74 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.71 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 92.63 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 92.31 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 92.27 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 92.27 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.15 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 91.78 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 91.73 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 91.37 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 91.36 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 91.15 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 91.04 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 90.64 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 90.43 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 90.4 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 90.37 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 90.32 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 90.25 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 90.11 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 90.09 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 90.03 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 89.92 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 89.53 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 89.48 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 89.45 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 88.99 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.87 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.76 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 88.76 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 88.49 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.32 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 88.32 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 88.19 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 88.14 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 87.83 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 87.8 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 87.69 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 87.56 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 87.41 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 87.36 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 87.32 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 87.23 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 87.12 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 87.08 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 86.98 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 86.75 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 86.61 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 86.35 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 85.73 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 85.7 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 85.57 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 85.21 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 85.12 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 85.1 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 85.1 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 84.87 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 84.85 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 84.65 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 84.36 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 84.32 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 84.31 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 84.28 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 84.15 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 84.07 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 83.85 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 83.84 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 83.8 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 83.78 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 83.46 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 83.39 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 82.88 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 82.69 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 82.67 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 82.66 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 82.15 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 82.12 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 82.08 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 82.08 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 81.92 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 81.82 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 81.81 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 81.73 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 81.68 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 81.64 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 81.62 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 81.52 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 81.45 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 81.44 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 81.35 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 81.18 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 80.89 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 80.8 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 80.79 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 80.63 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 80.2 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 80.1 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 80.04 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 80.03 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-36 Score=303.94 Aligned_cols=234 Identities=11% Similarity=0.049 Sum_probs=181.4
Q ss_pred cccHHHHHHHHHHhhcC------------CCCccHHHHHHHHHH--HhhhcCCCCeEEEEEeCCCC--CHHHHHHHHHHH
Q 045120 125 ESRVSNLKSTQNALTNA------------NGGIGKTTLAKEFAK--QAREDKLFDRVVFSEVSQTS--DIKKIQGDIAEK 188 (374)
Q Consensus 125 vGr~~~~~~i~~~L~~~------------~gGiGKTtLA~~v~~--~~~~~~~F~~~~wv~vs~~~--~~~~~~~~i~~~ 188 (374)
+||+.++++|.++|..+ |||+||||||+++|+ +.++..+|++++||++++.+ ++..++..|+.+
T Consensus 131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~ 210 (549)
T 2a5y_B 131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM 210 (549)
T ss_dssp CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence 49999999999999632 999999999999999 67888999999999999985 899999999999
Q ss_pred hCcCCc--------hhhHHHHHHHHHHHHhcCCeEEEEEeCCCCccccccccCcCCCC-----CcchhHhhhhcC-CCCc
Q 045120 189 LGLELS--------EEAEYRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRND-----SRDNNVVLLSMG-SKDN 254 (374)
Q Consensus 189 l~~~~~--------~~~~~~~~~~l~~~L~~~kr~LlVlDdv~~~~~~~~l~~~~~~~-----TR~~~va~~~~~-~~~~ 254 (374)
++.... ..+...+...+++.|.++|||||||||||+..++ .+. ..+.+ ||+..++. .++ ...+
T Consensus 211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~-~~~gs~ilvTTR~~~v~~-~~~~~~~~ 287 (549)
T 2a5y_B 211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RWA-QELRLRCLVTTRDVEISN-AASQTCEF 287 (549)
T ss_dssp HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HHH-HHTTCEEEEEESBGGGGG-GCCSCEEE
T ss_pred HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-ccc-ccCCCEEEEEcCCHHHHH-HcCCCCeE
Confidence 986521 1234567789999999833999999999998754 221 11333 99999974 444 3467
Q ss_pred eecCCCCHHHHHHHHHHhcCCCCCCcchHHHHHHHHHHccCCchHHHHHHhc--CCCccccccccccc-----CCCCccc
Q 045120 255 FLIANITEEEAWRLFKIMNGDDVENCKFKSTAINVAKACGAGLFCTLTTNAS--KSSSIYSHVSNDYQ-----SIYKPKP 327 (374)
Q Consensus 255 ~~l~~L~~~~s~~Lf~~~a~~~~~~~~l~~~~~~I~~~c~~GlPLai~~ig~--~~~~~~~W~~~~~~-----~~~~~~~ 327 (374)
|+|++|+.++||+||.+.++....++.+.+++++|+++| +|+||||+++|+ +.++ .+|...... ...++.+
T Consensus 288 ~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c-~GlPLAl~~~g~~l~~~~-w~~~~~l~~~l~~~~~~~i~~ 365 (549)
T 2a5y_B 288 IEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELS-SGNPATLMMFFKSCEPKT-FEKMAQLNNKLESRGLVGVEC 365 (549)
T ss_dssp EECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHH-TTCHHHHHHHHTTCCSSS-HHHHHHHHHHHHHHCSSTTCC
T ss_pred EECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHh-CCChHHHHHHHHHhccch-HHHHHHhHHHhhcccHHHHHH
Confidence 999999999999999999986554578889999999999 999999999999 4432 223111110 1233334
Q ss_pred chhh-cccCCchhhhhhhc---------------CchhhhhcHHHHHHHHHhC--Ccce
Q 045120 328 YLAV-FQDLEPTIVKTAFV---------------DPKWYLALKEEFEALQRNQ--TWSL 368 (374)
Q Consensus 328 ~~~l-y~~Lp~~~lk~cfL---------------fp~~~~i~~~~Li~~W~~~--~~~~ 368 (374)
.+.+ |++||++ +|.||+ ||+++.|+ |++|+|+ ||..
T Consensus 366 ~l~~Sy~~L~~~-lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~ 419 (549)
T 2a5y_B 366 ITPYSYKSLAMA-LQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDIC 419 (549)
T ss_dssp CSSSSSSSHHHH-HHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC---
T ss_pred HHhcccccccHH-HHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceec
Confidence 5666 9999885 999973 99999999 8999999 7764
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 374 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-11 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 62.5 bits (151), Expect = 1e-11
Identities = 16/167 (9%), Positives = 49/167 (29%), Gaps = 15/167 (8%)
Query: 143 GGIGKTTLAKEFAKQARE--DKLFDRVVFSEVSQTSDIKKIQGDIAEKLGL--------- 191
G GK+ +A + ++ + +D +V+ + S T+ L L
Sbjct: 53 AGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNF 112
Query: 192 -ELSEEAEYRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRN---DSRDNNVVLL 247
+ + L + L + ++ + + + +RD +
Sbjct: 113 PSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNA 172
Query: 248 SMGSKDNFLIANITEEEAWRLFKIMNGDDVENCKFKSTAINVAKACG 294
+ + + + ++ +E + + K + +
Sbjct: 173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSS 219
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 374 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.87 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.13 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.08 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.05 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.89 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.88 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.85 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.79 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.68 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.64 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.6 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.22 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.15 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.15 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.15 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.95 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.92 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.68 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.62 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.44 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.39 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.19 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.96 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.25 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.92 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.48 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.66 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 93.48 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.02 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.85 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.7 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.68 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.63 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.57 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.56 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 92.3 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.13 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 91.78 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.71 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.59 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.44 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.4 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.17 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 91.1 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 91.01 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 90.91 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 90.6 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 90.44 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 90.44 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.03 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.6 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 89.28 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 89.25 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 89.15 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 89.04 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 88.96 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.87 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 88.71 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 88.6 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 88.52 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 88.5 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 87.84 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 87.76 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 87.58 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 87.48 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.41 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 87.08 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 87.01 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 87.01 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 86.79 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 86.63 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 86.58 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 86.54 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 86.41 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 86.39 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 86.38 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 86.25 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 86.1 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 85.94 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 85.67 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 85.65 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 85.38 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 85.34 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.27 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 84.98 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 84.82 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 84.73 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 84.73 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 84.54 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 84.22 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 83.92 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 83.51 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 83.34 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 82.98 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 82.96 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 81.6 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 81.27 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 80.42 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=2.9e-38 Score=287.84 Aligned_cols=221 Identities=9% Similarity=0.029 Sum_probs=169.5
Q ss_pred cccccccHHHHHHHHHHhhcC------------CCCccHHHHHHHHHHHhh--hcCCCCeEEEEEeCCCCCHHHHHHHHH
Q 045120 121 YEAFESRVSNLKSTQNALTNA------------NGGIGKTTLAKEFAKQAR--EDKLFDRVVFSEVSQTSDIKKIQGDIA 186 (374)
Q Consensus 121 ~~~~vGr~~~~~~i~~~L~~~------------~gGiGKTtLA~~v~~~~~--~~~~F~~~~wv~vs~~~~~~~~~~~i~ 186 (374)
...++||+.++++|+++|... |||+||||||+++|++.. ...+|++++||++++.++...+...+.
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~ 98 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHH
Confidence 345789999999999999641 999999999999999754 667899999999999998777766654
Q ss_pred HHh---CcCCc--------hhhHHHHHHHHHHHHhcCCeEEEEEeCCCCccccccccCcCCCC---CcchhHhhhhcCCC
Q 045120 187 EKL---GLELS--------EEAEYRRASRLYERLKNENKILVILANIWKLLDLETVKIPFRND---SRDNNVVLLSMGSK 252 (374)
Q Consensus 187 ~~l---~~~~~--------~~~~~~~~~~l~~~L~~~kr~LlVlDdv~~~~~~~~l~~~~~~~---TR~~~va~~~~~~~ 252 (374)
..+ +.... ..........+.+.|.+ +|+|+||||||+..+|+.+...-... ||+..++.......
T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~-kr~LlVLDDv~~~~~~~~~~~~~srilvTTR~~~v~~~~~~~~ 177 (277)
T d2a5yb3 99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDR-PNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTC 177 (277)
T ss_dssp HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTS-TTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCE
T ss_pred HHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhcc-CCeeEecchhhHHhhhhhhcccCceEEEEeehHHHHHhcCCCC
Confidence 443 22111 11233344567778887 89999999999998887664321111 99999975333344
Q ss_pred CceecCCCCHHHHHHHHHHhcCCCCCCcchHHHHHHHHHHccCCchHHHHHHhc--CCCcccccccc----cccCCCCcc
Q 045120 253 DNFLIANITEEEAWRLFKIMNGDDVENCKFKSTAINVAKACGAGLFCTLTTNAS--KSSSIYSHVSN----DYQSIYKPK 326 (374)
Q Consensus 253 ~~~~l~~L~~~~s~~Lf~~~a~~~~~~~~l~~~~~~I~~~c~~GlPLai~~ig~--~~~~~~~W~~~----~~~~~~~~~ 326 (374)
+.|+|++|+.++||+||+++++.....+...+++++|+++| ||+||||+++|+ +.++.+.|.+. ...+..++.
T Consensus 178 ~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c-~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~ 256 (277)
T d2a5yb3 178 EFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELS-SGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVE 256 (277)
T ss_dssp EEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHH-TTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTC
T ss_pred ceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHh-CCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHH
Confidence 68999999999999999999986666677789999999999 999999999999 77788888442 223344444
Q ss_pred cchhh-cccCCchhhhhhh
Q 045120 327 PYLAV-FQDLEPTIVKTAF 344 (374)
Q Consensus 327 ~~~~l-y~~Lp~~~lk~cf 344 (374)
+.+.+ |++||++ +|+||
T Consensus 257 ~il~~sY~~L~~~-lk~c~ 274 (277)
T d2a5yb3 257 CITPYSYKSLAMA-LQRCV 274 (277)
T ss_dssp CCSSSSSSSHHHH-HHHHH
T ss_pred HHHHHHHhcccHH-HHHHH
Confidence 46677 9999986 99998
|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|