Citrus Sinensis ID: 045121
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 224091795 | 291 | predicted protein [Populus trichocarpa] | 0.797 | 0.553 | 0.324 | 2e-17 | |
| 356524790 | 386 | PREDICTED: uncharacterized protein LOC10 | 0.633 | 0.331 | 0.289 | 2e-06 | |
| 357123265 | 399 | PREDICTED: uncharacterized protein LOC10 | 0.529 | 0.268 | 0.293 | 4e-05 | |
| 326517535 | 877 | predicted protein [Hordeum vulgare subsp | 0.762 | 0.175 | 0.275 | 5e-05 | |
| 226532668 | 390 | uncharacterized protein LOC100272432 [Ze | 0.529 | 0.274 | 0.275 | 8e-05 | |
| 413954892 | 497 | hypothetical protein ZEAMMB73_032543 [Ze | 0.529 | 0.215 | 0.275 | 8e-05 | |
| 242096554 | 601 | hypothetical protein SORBIDRAFT_10g02579 | 0.297 | 0.099 | 0.413 | 0.0001 | |
| 297825315 | 456 | predicted protein [Arabidopsis lyrata su | 0.480 | 0.212 | 0.309 | 0.0002 | |
| 308080486 | 321 | uncharacterized protein LOC100502196 [Ze | 0.524 | 0.330 | 0.276 | 0.0002 | |
| 125556299 | 487 | hypothetical protein OsI_23931 [Oryza sa | 0.143 | 0.059 | 0.724 | 0.0003 |
| >gi|224091795|ref|XP_002309354.1| predicted protein [Populus trichocarpa] gi|222855330|gb|EEE92877.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 94.4 bits (233), Expect = 2e-17, Method: Compositional matrix adjust.
Identities = 61/188 (32%), Positives = 99/188 (52%), Gaps = 27/188 (14%)
Query: 2 DWSCALCQVSTTSKRDLDEHLHGKKHKARK-------------KDYLEMRRCATRKWTVV 48
+WSCALCQVS TS+R L+EHL G++HKA++ K L T K T+
Sbjct: 39 EWSCALCQVSATSERGLNEHLQGRRHKAKEAGLRAQKMARNPNKASLPKETTKTAKVTIP 98
Query: 49 KMSILNGANWSSEDVHYLIFNNVKAAHYSSSLVKPRQQKNVGGEEDSENKNEELPK-KKA 107
+ A E + K+ ++S+ ++ ++++ + E KN++L K+
Sbjct: 99 TAGLEMEAKIEDESLQL-----NKSDNFSNKKIENKEERGNRNDVQLEQKNQQLEDLNKS 153
Query: 108 LNTITQKTTNGIPTGGTMRRKLPLRENFEFWCEVFQVGTHSAVVMEGHKRGKKHMARSNG 167
+ Q T P ++ +++ F+FWCE+ Q+G +S +VME HK+GKKH+AR
Sbjct: 154 MAEAVQ-TKERTP-------EIKMKKKFKFWCEMCQIGAYSEMVMEAHKKGKKHLARLQK 205
Query: 168 SRKNNEAV 175
S +N EAV
Sbjct: 206 SSQNGEAV 213
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356524790|ref|XP_003531011.1| PREDICTED: uncharacterized protein LOC100812073 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357123265|ref|XP_003563332.1| PREDICTED: uncharacterized protein LOC100840799 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|326517535|dbj|BAK03686.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|226532668|ref|NP_001140379.1| uncharacterized protein LOC100272432 [Zea mays] gi|194699238|gb|ACF83703.1| unknown [Zea mays] gi|413954891|gb|AFW87540.1| hypothetical protein ZEAMMB73_032543 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|413954892|gb|AFW87541.1| hypothetical protein ZEAMMB73_032543 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242096554|ref|XP_002438767.1| hypothetical protein SORBIDRAFT_10g025790 [Sorghum bicolor] gi|241916990|gb|EER90134.1| hypothetical protein SORBIDRAFT_10g025790 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|297825315|ref|XP_002880540.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297326379|gb|EFH56799.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|308080486|ref|NP_001183602.1| uncharacterized protein LOC100502196 [Zea mays] gi|238013370|gb|ACR37720.1| unknown [Zea mays] gi|413943510|gb|AFW76159.1| hypothetical protein ZEAMMB73_364823 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|125556299|gb|EAZ01905.1| hypothetical protein OsI_23931 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2061486 | 455 | AT2G24030 [Arabidopsis thalian | 0.420 | 0.186 | 0.315 | 0.00032 |
| TAIR|locus:2061486 AT2G24030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 112 (44.5 bits), Expect = 0.00032, P = 0.00032
Identities = 29/92 (31%), Positives = 47/92 (51%)
Query: 90 GGEEDSENKNEELPKK--KALNTITQKTTNG-IPTGGTM----RRKLPLRENFEFWCEVF 142
G ED + K + + KA++ T + + +P G + + + LR N +FWCE+
Sbjct: 240 GLNEDLQVKRPKAKESEAKAMSLETGEIVSSKVPCSGKLGSGKKAEGKLRTNQKFWCEIC 299
Query: 143 QVGTHSAVVMEGHKRGKKHMARSNGSRKNNEA 174
+VGT+ +VM H+ GKKH A + EA
Sbjct: 300 KVGTYCQIVMRDHELGKKHKAAVTQQNETPEA 331
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| pfam12874 | 25 | pfam12874, zf-met, Zinc-finger of C2H2 type | 7e-06 |
| >gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type | Back alignment and domain information |
|---|
Score = 41.0 bits (97), Expect = 7e-06
Identities = 13/25 (52%), Positives = 16/25 (64%)
Query: 3 WSCALCQVSTTSKRDLDEHLHGKKH 27
+ C LC V+ TS+ L HL GKKH
Sbjct: 1 FYCELCNVTFTSESQLKSHLRGKKH 25
|
This is a zinc-finger domain with the CxxCx(12)Hx(6)H motif, found in multiple copies in a wide range of proteins from plants to metazoans. Some member proteins, particularly those from plants, are annotated as being RNA-binding. Length = 25 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.66 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.61 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 98.56 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 98.41 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.27 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 98.08 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 97.47 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 97.44 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 96.68 | |
| PF06220 | 38 | zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi | 96.66 | |
| KOG4727 | 193 | consensus U1-like Zn-finger protein [General funct | 96.1 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 95.66 | |
| PF14968 | 336 | CCDC84: Coiled coil protein 84 | 95.33 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 95.18 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 95.05 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 95.04 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.02 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.96 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 94.91 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 94.75 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 94.63 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 94.55 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 94.19 | |
| smart00586 | 49 | ZnF_DBF Zinc finger in DBF-like proteins. | 94.08 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 94.06 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 93.84 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 93.84 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 93.4 | |
| PF07535 | 49 | zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc | 93.35 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 93.28 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 93.11 | |
| KOG0227 | 222 | consensus Splicing factor 3a, subunit 2 [RNA proce | 93.01 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.93 | |
| KOG2785 | 390 | consensus C2H2-type Zn-finger protein [General fun | 92.92 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 92.72 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 92.71 | |
| COG5188 | 470 | PRP9 Splicing factor 3a, subunit 3 [RNA processing | 91.8 | |
| COG5246 | 222 | PRP11 Splicing factor 3a, subunit 2 [RNA processin | 91.66 | |
| KOG3032 | 264 | consensus Uncharacterized conserved protein [Funct | 90.77 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 90.76 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 90.33 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 90.18 | |
| KOG3408 | 129 | consensus U1-like Zn-finger-containing protein, pr | 89.72 | |
| KOG3454 | 165 | consensus U1 snRNP-specific protein C [RNA process | 89.62 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 89.4 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 88.73 | |
| KOG0150 | 336 | consensus Spliceosomal protein FBP21 [RNA processi | 86.76 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 85.68 | |
| KOG4722 | 672 | consensus Zn-finger protein [General function pred | 85.6 | |
| KOG2837 | 309 | consensus Protein containing a U1-type Zn-finger a | 84.93 | |
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 83.65 | |
| COG5136 | 188 | U1 snRNP-specific protein C [RNA processing and mo | 83.29 | |
| COG5112 | 126 | UFD2 U1-like Zn-finger-containing protein [General | 81.9 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 81.41 | |
| PF04988 | 165 | AKAP95: A-kinase anchoring protein 95 (AKAP95); In | 80.59 |
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
Probab=98.66 E-value=1.2e-08 Score=58.87 Aligned_cols=25 Identities=32% Similarity=0.630 Sum_probs=24.5
Q ss_pred eecccccccCCCHHHHHhhhcchhH
Q 045121 137 FWCEVFQVGTHSAVVMEGHKRGKKH 161 (202)
Q Consensus 137 ~~Ce~C~v~~~se~~~~~Hl~GkKH 161 (202)
|+|++|++.|+++..|.+|++|++|
T Consensus 1 ~~C~~C~~~f~s~~~~~~H~~s~~H 25 (25)
T PF12874_consen 1 FYCDICNKSFSSENSLRQHLRSKKH 25 (25)
T ss_dssp EEETTTTEEESSHHHHHHHHTTHHH
T ss_pred CCCCCCCCCcCCHHHHHHHHCcCCC
Confidence 7999999999999999999999999
|
|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4727 consensus U1-like Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF14968 CCDC84: Coiled coil protein 84 | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >smart00586 ZnF_DBF Zinc finger in DBF-like proteins | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >KOG0227 consensus Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3032 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3454 consensus U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG0150 consensus Spliceosomal protein FBP21 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4722 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2837 consensus Protein containing a U1-type Zn-finger and implicated in RNA splicing or processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
| >COG5136 U1 snRNP-specific protein C [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF04988 AKAP95: A-kinase anchoring protein 95 (AKAP95); InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 3e-04 |
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Length = 127 | Back alignment and structure |
|---|
Score = 38.4 bits (88), Expect = 3e-04
Identities = 15/85 (17%), Positives = 29/85 (34%), Gaps = 9/85 (10%)
Query: 2 DWSCALCQVSTTSKRDLDEHLHGKKHKARKKDYLEMRRCAT------RKWTVVKMSILNG 55
D C +C S+ H +KH + + Y+ + + K ++S
Sbjct: 32 DTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGED 91
Query: 56 ANWSSEDVHYLIFNNVKAA--HYSS 78
+ V + F++ A HY
Sbjct: 92 RSKCC-PVCNMTFSSPVVAESHYIG 115
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 99.63 | |
| 1zu1_A | 127 | DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr | 98.17 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.65 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 97.25 | |
| 1zr9_A | 124 | Zinc finger protein 593; DNA binding, structural g | 97.14 | |
| 3cw1_L | 77 | U1 small nuclear ribonucleoprotein C; PRE-mRNA spl | 96.04 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 95.16 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 95.11 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 94.49 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 92.33 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 92.23 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 92.17 | |
| 2yrk_A | 55 | Zinc finger homeobox protein 4; structure genomics | 92.02 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 91.95 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 91.9 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.54 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 91.47 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.26 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.21 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.04 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 91.02 | |
| 4dgw_A | 402 | PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A | 90.99 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 90.63 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 90.48 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.47 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 89.81 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.24 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 90.2 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.96 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 89.82 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 89.77 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 89.74 | |
| 1fu9_A | 36 | U-shaped transcriptional cofactor; zinc-finger, be | 89.74 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 89.64 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.61 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 89.61 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 89.59 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 89.44 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.38 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 89.37 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.31 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.93 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 88.91 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 88.89 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.88 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.87 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.83 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 88.8 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.8 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 88.79 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.79 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 88.78 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.74 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 88.73 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.72 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 88.71 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 88.69 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.61 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.6 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.59 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 88.57 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.55 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 88.26 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 88.53 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.5 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 88.49 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 88.46 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 88.39 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.39 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 88.37 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 88.11 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.36 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 88.32 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.31 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.31 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.25 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.23 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.22 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.21 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 88.21 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.14 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.14 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.13 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 88.13 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.12 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.06 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 88.06 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 88.03 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 88.03 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.02 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 88.02 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.99 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.97 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.97 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.91 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.89 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.89 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.88 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 87.85 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.84 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.82 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.81 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 87.75 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 87.74 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 87.74 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 87.72 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.66 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.65 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 87.6 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.49 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.46 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.36 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.34 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.32 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.32 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.28 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.26 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.25 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 87.24 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.21 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.18 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.16 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 87.11 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 87.11 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 87.1 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.09 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.01 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 86.97 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 86.94 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 86.84 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.79 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.77 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 86.73 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.72 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 86.72 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.7 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.7 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.67 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 86.65 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 86.62 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 86.6 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.57 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 86.57 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.56 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 86.51 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 86.47 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.44 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.43 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 86.37 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 86.33 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 86.29 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.26 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 86.14 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.14 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.11 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.0 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.0 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 85.95 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 85.93 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 85.9 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 85.81 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 85.72 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 85.63 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 85.55 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.4 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 85.36 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 85.36 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 85.31 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 85.27 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 85.25 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 85.16 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 85.15 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 85.09 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 84.93 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 84.88 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 84.81 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.78 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 84.72 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.67 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 84.62 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 84.57 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 84.88 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 84.48 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 84.47 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 84.37 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 84.35 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 84.31 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 84.19 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 84.15 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 84.09 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 84.09 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 84.5 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 84.02 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.99 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.95 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.91 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.82 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 83.79 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.77 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.71 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.71 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 83.69 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 83.67 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 83.66 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.61 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.61 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 83.52 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.48 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 83.46 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 83.39 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 83.2 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 83.17 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.15 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 83.11 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.11 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 83.08 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.08 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 83.08 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 83.0 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.0 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.95 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 82.81 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.81 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 82.77 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.74 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.66 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.65 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.64 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.62 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 82.43 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 82.37 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 82.35 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 82.26 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 82.24 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 82.22 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 82.19 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.18 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 82.16 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.14 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.13 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 82.12 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 82.11 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 82.11 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 82.09 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 82.09 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 82.06 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 82.05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 82.02 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 82.01 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.96 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 81.95 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.88 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.84 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.83 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.83 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.73 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 81.64 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 81.62 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 81.61 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 81.52 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.52 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 81.52 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 81.49 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 81.48 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 81.45 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 81.45 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 81.41 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 81.39 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 81.38 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 81.36 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 81.3 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.28 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.23 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 81.21 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 81.12 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 81.12 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.94 | |
| 4f9c_B | 144 | Protein DBF4 homolog A; Ser/Thr protein kinase, tr | 80.94 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 80.86 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 80.83 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 80.82 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.77 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.75 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 80.74 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 80.71 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 80.68 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 80.55 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.44 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 80.42 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 80.33 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 80.18 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 80.13 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 80.02 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.01 |
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
Probab=99.63 E-value=5.1e-16 Score=121.61 Aligned_cols=95 Identities=21% Similarity=0.299 Sum_probs=68.0
Q ss_pred ceeccccccccCCHHHHHHhhcCcchHHHHHHHHHHHhhhccccceeeeeeccCCCCCcccchhhhhccccccccccccc
Q 045121 2 DWSCALCQVSTTSKRDLDEHLHGKKHKARKKDYLEMRRCATRKWTVVKMSILNGANWSSEDVHYLIFNNVKAAHYSSSLV 81 (202)
Q Consensus 2 ~w~C~lC~vt~tse~~l~~Hl~GkkHk~~~e~l~~~~~~~~~k~~~~~~~i~~~a~~s~e~~~~~~~~n~~~~~~sss~~ 81 (202)
+|+|.+|+|+|+|+..+..|+.|++|+.++..+.... . .. ...+ .
T Consensus 32 ~~~C~~C~v~~~S~s~~~~H~~gkkH~~~v~~~~~~~-~-~~-------~~~~------~-------------------- 76 (127)
T 1zu1_A 32 DTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAIN-Q-GE-------DSVP------A-------------------- 76 (127)
T ss_dssp SSEETTTTEECCSHHHHHHHHHCHHHHHHHHHHHHHT-T-CC-------CCCS------C--------------------
T ss_pred CCcCcCCCCEeCCHHHHHHHHCcHHHHHHHHHHhccc-C-cc-------cCCC------C--------------------
Confidence 5899999999999999999999999999998666511 0 00 0000 0
Q ss_pred ccccccCCCCccCCccccccccchhhhccccccccccccCCCcccccCCcccCcceecccccccCCCHHHHHhhhcchhH
Q 045121 82 KPRQQKNVGGEEDSENKNEELPKKKALNTITQKTTNGIPTGGTMRRKLPLRENFEFWCEVFQVGTHSAVVMEGHKRGKKH 161 (202)
Q Consensus 82 k~~~qkn~g~~e~~~~k~~~~~k~~~l~~~~k~~~~~~~~G~~~e~~~~k~~~~~~~Ce~C~v~~~se~~~~~Hl~GkKH 161 (202)
+.++. . + .+.. ......|||++|++.|+|+.+|.+|++||+|
T Consensus 77 -----~~~~~----~-------------------------~--~~~~--~~~~~~~~C~~C~~~f~s~~~~~~H~~gk~H 118 (127)
T 1zu1_A 77 -----KKFKA----A-------------------------P--AEIS--DGEDRSKCCPVCNMTFSSPVVAESHYIGKTH 118 (127)
T ss_dssp -----CCCSC----C-------------------------S--SCCS--SCCCTTTEETTTTEECSSHHHHHHHHTSHHH
T ss_pred -----CccCC----C-------------------------c--cccc--cCCCCCeEcCCCCCEeCCHHHHHHHHCCHHH
Confidence 00000 0 0 0000 1234568999999999999999999999999
Q ss_pred HHHhhhhh
Q 045121 162 MARSNGSR 169 (202)
Q Consensus 162 ~~k~~~~~ 169 (202)
++++++++
T Consensus 119 ~~~~~~~~ 126 (127)
T 1zu1_A 119 IKNLRLRE 126 (127)
T ss_dssp HHHHHHHH
T ss_pred HHHHHHhc
Confidence 99999874
|
| >1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 98.44 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 98.16 | |
| d1zu1a2 | 55 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 97.71 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 97.61 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 96.71 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 96.57 | |
| d2vrda1 | 61 | Spliceosomal protein U1C {Human (Homo sapiens) [Ta | 95.34 | |
| d1zu1a1 | 72 | dsRNA-binding protein ZFa (ZNF346, JAZ) {African c | 95.08 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 93.37 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 92.11 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 92.08 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 91.91 | |
| d1fu9a_ | 36 | U-shaped transcription factor, different fingers { | 91.73 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 90.97 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 90.68 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 90.62 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 90.41 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 89.92 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 89.32 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 89.06 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 88.69 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 88.57 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 88.34 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 88.2 | |
| d2yrka1 | 48 | Zinc finger homeobox protein 4, ZFHX4 {Human (Homo | 87.79 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 87.63 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 87.42 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 87.42 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 87.25 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 86.69 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 86.67 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 86.36 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 84.79 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 83.41 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 83.01 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 81.88 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 81.41 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 81.17 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 80.13 |
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: HkH motif-containing C2H2 finger domain: dsRNA-binding protein ZFa (ZNF346, JAZ) species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=98.44 E-value=4.7e-08 Score=65.20 Aligned_cols=32 Identities=31% Similarity=0.395 Sum_probs=30.4
Q ss_pred ecccccccCCCHHHHHhhhcchhHHHHhhhhh
Q 045121 138 WCEVFQVGTHSAVVMEGHKRGKKHMARSNGSR 169 (202)
Q Consensus 138 ~Ce~C~v~~~se~~~~~Hl~GkKH~~k~~~~~ 169 (202)
+|.|||++|+|..+.++|+.||+|.++|+...
T Consensus 23 ~C~lCn~~Fns~~~AqsHY~GK~H~K~lk~~~ 54 (55)
T d1zu1a2 23 CCPVCNMTFSSPVVAESHYIGKTHIKNLRLRE 54 (55)
T ss_dssp EETTTTEECSSHHHHHHHHTSHHHHHHHHHHH
T ss_pred hhhhhhcccCCHHHHHHHhhhhHHHHHHHHhc
Confidence 89999999999999999999999999998754
|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|