Citrus Sinensis ID: 045124

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MPPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYASAEGGAGAF
cccccccccccccHHHHHHHHccccHHHHHHHHHHccccHHHHcccccccEEEccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEEEEcccccHHHHHcccccccEEEEEccccccccEEEEEEEccccEEEEEcccccccccccccccEEEEEEcccEEEEEEEccccccEEEccccccEEEEEEEEcEEEccccccccccccHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHcccccccEEEEEEEccccccc
cccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccccEEEcccEEEEEEccEEEcccccccccccHHHcEEEEEEEEEccHHHHHHHHHcccHHHEEEEEEccccccEEEEEEEEEcccEEEEEEEEcccccccccccccEEEEEcccEEEEEEEccccccEEEEccccEEEEEEEEEEcEccccccccccHHHHHHHHHHHccccccccEEEEEcEccccccccccccccccccccccHHHHHHEEEEEEEcccccHHHHHHHHHHHHHcHHHEEEEEEEccccccccc
mpprrrnffyglpDDILRHIIAClptknavgtsLISRQWIDLWTEVEfhqlalddsdllepdlspdtIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVrgwtnnvvEVDIRVdninednfldlpsnlcTSTALEVLKLqgnitldpdpdqrvifpslrILHMDViqlgvsghhrdlyrccpvlddlyvrgniaeplpfqfDVVSTSVRnlnsefyledkhfdnednvsLTFEINTQNLVCLELRENFFAQYILRNLNLlekadigiggvfmcprgggfdfdhwsderisflpevynvnslalsgctvgeakgefpdcvqrweerdvpadcLRNClrgisvrgfggklHELQVIEYLLKNARVLRRMDIyasaeggagaf
MPPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQgnitldpdpdQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVrgfggklheLQVIEYLLKNARVLRRMDIYASAEGGAGAF
MPPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQlalddsdllepdlspdTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYASAEGGAGAF
******NFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYA*********
***RRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIY**********
MPPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYASAEGGAGAF
******NFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYASA*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYASAEGGAGAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
Q9SCQ5427 Putative FBD-associated F yes no 0.882 0.805 0.266 4e-18
Q9LXR4454 Putative F-box/LRR-repeat no no 0.638 0.548 0.293 5e-17
Q9LX51 520 F-box/LRR-repeat protein no no 0.643 0.482 0.306 1e-16
Q84X02405 FBD-associated F-box prot no no 0.638 0.614 0.294 9e-16
Q9SV82409 FBD-associated F-box prot no no 0.874 0.833 0.259 1e-15
P0C2F8444 Putative F-box protein At no no 0.597 0.524 0.276 1e-14
Q9LXR6457 Putative F-box protein At no no 0.923 0.787 0.242 1e-14
Q9FJ30 540 Putative F-box/LRR-repeat no no 0.671 0.485 0.247 3e-14
Q8H1R7419 F-box/FBD/LRR-repeat prot no no 0.856 0.797 0.267 8e-14
Q9FF58388 FBD-associated F-box prot no no 0.9 0.904 0.250 1e-13
>sp|Q9SCQ5|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 112/421 (26%), Positives = 170/421 (40%), Gaps = 77/421 (18%)

Query: 11  GLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAW 70
            L DD+L  I++ LPTK+ V T L+S++W  LW  V   +L  DD   LEP     +   
Sbjct: 6   NLSDDLLLKIVSSLPTKDVVVTMLLSKRWKFLWMMVP--KLRFDDEFELEP-----SYYG 58

Query: 71  SFQEFV--SDILDRVNLLVIRRFYL-HCLQSYDAEVLRDWVVRGWTNNVVEVDIR--VDN 125
            F ++V  S +L+R  +L   +F +  C  S D   +  W+  G   N+ E++I      
Sbjct: 59  RFLKYVDKSMVLNRAQVLETVKFNVGPCCSSED---IATWIRIGMVRNMRELEISHCEGY 115

Query: 126 INEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHR 185
             E   + LP +L T   LEVLKL   + L+   D  V FPSL+ LH+  ++      HR
Sbjct: 116 FREHRSIKLPKSLYTYEKLEVLKLASTVVLNVPID--VCFPSLKSLHLVCVEYKTKKSHR 173

Query: 186 DLYRCCPVLDDL---------YVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNED 236
            L   CPVL++L         +VR    E    Q    S S+ + + E Y +        
Sbjct: 174 RLLSGCPVLEELVLDKSYNSFHVRSFYVEIPTLQ----SLSILDTSGELYGD-------- 221

Query: 237 NVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSD 296
               TF +N   L       +F+    LR+ N+ E  D+ I  ++  P+           
Sbjct: 222 ---FTFVVNAPALKYFNFV-DFYGDLCLRD-NMPEVVDVNIKVIYRNPKKLLGPLKSVKR 276

Query: 297 ERISFLP--------EVYNVNSLALSG---------------------CTVGEAKGEFPD 327
             +   P        E Y +  L L G                       + E K E  D
Sbjct: 277 LSLCLSPSTTLHNHMEFYQLVHLELCGDALMWWDLLTWMLQSSPKLQVLKIYECKCEEHD 336

Query: 328 CV-----QRWEERDVPADCLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYAS 382
            +     + WEE      CL   L     + +     E +V+ Y+LKNAR L+     A+
Sbjct: 337 YLDDPIEEHWEEPSSVPQCLLFHLNIFEWKYYNAGDEEKKVVAYILKNARQLKTATFSAA 396

Query: 383 A 383
           +
Sbjct: 397 S 397

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LXR4|FBL56_ARATH Putative F-box/LRR-repeat protein At3g58880 OS=Arabidopsis thaliana GN=At3g58880 PE=4 SV=1 Back     alignment and function description
>sp|Q9LX51|FBL64_ARATH F-box/LRR-repeat protein At3g59200 OS=Arabidopsis thaliana GN=At3g59200 PE=2 SV=1 Back     alignment and function description
>sp|Q84X02|FBD7_ARATH FBD-associated F-box protein At2g26860 OS=Arabidopsis thaliana GN=At2g26860 PE=2 SV=2 Back     alignment and function description
>sp|Q9SV82|FBD40_ARATH FBD-associated F-box protein At4g10400 OS=Arabidopsis thaliana GN=At4g10400 PE=2 SV=2 Back     alignment and function description
>sp|P0C2F8|FB71_ARATH Putative F-box protein At1g64540 OS=Arabidopsis thaliana GN=At1g64540 PE=4 SV=1 Back     alignment and function description
>sp|Q9LXR6|FB207_ARATH Putative F-box protein At3g58860 OS=Arabidopsis thaliana GN=At3g58860 PE=4 SV=1 Back     alignment and function description
>sp|Q9FJ30|FBL88_ARATH Putative F-box/LRR-repeat protein At5g41840 OS=Arabidopsis thaliana GN=At5g41840 PE=4 SV=1 Back     alignment and function description
>sp|Q8H1R7|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340 OS=Arabidopsis thaliana GN=At4g26340 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF58|FBD30_ARATH FBD-associated F-box protein At5g60610 OS=Arabidopsis thaliana GN=At5g60610 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
357466395387 FBD-associated F-box protein [Medicago t 0.810 0.816 0.241 1e-16
15229834427 putative FBD-associated F-box protein [A 0.882 0.805 0.266 3e-16
147812093 607 hypothetical protein VITISV_040899 [Viti 0.920 0.591 0.259 1e-15
15231588454 putative F-box/LRR-repeat protein [Arabi 0.638 0.548 0.293 4e-15
15231646 520 F-box/LRR-repeat protein [Arabidopsis th 0.643 0.482 0.306 6e-15
297817218478 predicted protein [Arabidopsis lyrata su 0.641 0.523 0.327 7e-15
91806275403 F-box family protein [Arabidopsis thalia 0.638 0.617 0.294 5e-14
15225804405 FBD-associated F-box protein [Arabidopsi 0.638 0.614 0.294 6e-14
28207108405 hypothetical protein [Arabidopsis thalia 0.633 0.609 0.291 8e-14
42566399409 F-box protein [Arabidopsis thaliana] gi| 0.874 0.833 0.259 8e-14
>gi|357466395|ref|XP_003603482.1| FBD-associated F-box protein [Medicago truncatula] gi|355492530|gb|AES73733.1| FBD-associated F-box protein [Medicago truncatula] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 96/397 (24%), Positives = 164/397 (41%), Gaps = 81/397 (20%)

Query: 11  GLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQLALDDSDLLEPDLSPDTIAW 70
            LPD +L H+++ L TK++  TS++S++W  LW      QL L   D       P   A 
Sbjct: 17  ALPDSLLYHVLSFLTTKDSAATSILSKKWKPLW----LSQLILRFDD------QPFQEAL 66

Query: 71  SFQEFVSDIL-DRVNLLVIRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINED 129
           +F  FV+ ++ +R   L IR F+L C   +    + D++     + V  + I + N +  
Sbjct: 67  TFSNFVNSVIANRDKTLPIRSFHLKC--CFLNRDIHDFLYTAVKSGVENLTIDLCN-SGY 123

Query: 130 NFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHRDLYR 189
           + + LPS + ++  L VLKL   ITL+  P      PSL++LH+++++     +   L  
Sbjct: 124 SIMTLPSFILSTKTLSVLKL-NRITLNEIP--YFYLPSLKVLHLNIVKFTYYEYLLKLLS 180

Query: 190 CCPVLDDL-----------------------YVRGNIAEP-LPFQFDVVSTSVRNLNSEF 225
            CP+L DL                        +  NI    +P +FD    +V  L  E 
Sbjct: 181 GCPILQDLETDCLSVYSPYSKEERQIISLSNLITANICNVFIPTEFDWFH-NVERLRVEL 239

Query: 226 YLEDKHFDNEDNVSLTFEINTQNLVCLELRENFFAQYILRNLNLLEKADIGIGGVFMCPR 285
            +++K  +  DN+ +   +    L+          + +++ L    K  I I    + PR
Sbjct: 240 MVDEKVPNTLDNIVMFHNLTYMELIFRAQNPLLIFKCLMKLLQYCPKLQILIIDKVITPR 299

Query: 286 GGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRNC 345
               D D                                       WEE+++   CL + 
Sbjct: 300 EYFHDKD---------------------------------------WEEQEIVPKCLLSY 320

Query: 346 LRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYAS 382
           L   S+R + G   EL   +Y++KN+RVL  M I ++
Sbjct: 321 LSTCSLRNYWGITCELHFAKYIMKNSRVLSAMKIQSA 357

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|15229834|ref|NP_190640.1| putative FBD-associated F-box protein [Arabidopsis thaliana] gi|75265626|sp|Q9SCQ5.1|FBD10_ARATH RecName: Full=Putative FBD-associated F-box protein At3g50710 gi|6561974|emb|CAB62440.1| putative protein [Arabidopsis thaliana] gi|332645179|gb|AEE78700.1| putative FBD-associated F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15231588|ref|NP_191447.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264354|sp|Q9LXR4.1|FBL56_ARATH RecName: Full=Putative F-box/LRR-repeat protein At3g58880 gi|7630083|emb|CAB88305.1| putative protein [Arabidopsis thaliana] gi|332646322|gb|AEE79843.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15231646|ref|NP_191479.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264308|sp|Q9LX51.1|FBL64_ARATH RecName: Full=F-box/LRR-repeat protein At3g59200 gi|7801670|emb|CAB91590.1| putative protein [Arabidopsis thaliana] gi|26450835|dbj|BAC42525.1| unknown protein [Arabidopsis thaliana] gi|29028916|gb|AAO64837.1| At3g59200 [Arabidopsis thaliana] gi|332646367|gb|AEE79888.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817218|ref|XP_002876492.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322330|gb|EFH52751.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|91806275|gb|ABE65865.1| F-box family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15225804|ref|NP_180254.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|142993877|sp|Q84X02.2|FBD7_ARATH RecName: Full=FBD-associated F-box protein At2g26860 gi|3426040|gb|AAC32239.1| hypothetical protein [Arabidopsis thaliana] gi|330252805|gb|AEC07899.1| FBD-associated F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28207108|gb|AAO37194.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42566399|ref|NP_192778.2| F-box protein [Arabidopsis thaliana] gi|145333003|ref|NP_001078367.1| F-box protein [Arabidopsis thaliana] gi|142989615|sp|Q9SV82.2|FBD40_ARATH RecName: Full=FBD-associated F-box protein At4g10400 gi|119935957|gb|ABM06044.1| At4g10400 [Arabidopsis thaliana] gi|332657476|gb|AEE82876.1| F-box protein [Arabidopsis thaliana] gi|332657477|gb|AEE82877.1| F-box protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2039488405 AT2G26860 "AT2G26860" [Arabido 0.638 0.614 0.290 6.4e-17
TAIR|locus:2099054454 AT3G58880 "AT3G58880" [Arabido 0.635 0.546 0.272 1.1e-15
TAIR|locus:2101674427 AT3G50710 "AT3G50710" [Arabido 0.651 0.594 0.275 2.3e-15
TAIR|locus:2081157 520 AT3G59200 "AT3G59200" [Arabido 0.658 0.494 0.287 5.3e-15
TAIR|locus:2099019457 AT3G58860 "AT3G58860" [Arabido 0.682 0.582 0.257 3.2e-14
TAIR|locus:504954943455 AT5G35995 "AT5G35995" [Arabido 0.576 0.494 0.264 6e-14
TAIR|locus:2165071435 AT5G56810 [Arabidopsis thalian 0.356 0.319 0.267 2.1e-13
TAIR|locus:2162489450 AT5G22660 "AT5G22660" [Arabido 0.633 0.548 0.270 3.1e-13
TAIR|locus:2122754409 AT4G10400 "AT4G10400" [Arabido 0.876 0.836 0.275 3.4e-13
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.625 0.541 0.261 5.5e-13
TAIR|locus:2039488 AT2G26860 "AT2G26860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 6.4e-17, Sum P(2) = 6.4e-17
 Identities = 79/272 (29%), Positives = 131/272 (48%)

Query:    11 GLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEVEFHQXXXXXXXXXXXXXXXXTIAW 70
             GLPD++L  I+ CLPTK  V TS++S++W  LW  V                     I  
Sbjct:     6 GLPDELLVEILHCLPTKEVVSTSILSKRWEFLWLWVP------KLTFVMNHYESDLPI-- 57

Query:    71 SFQEFVSDILDRVNLLVIRRFYLHCLQS-YDAEVLRDWVVRGWTNNVVEVDIRVDNINE- 128
               Q+F++  L  +   VI  F+L C  S +  E ++ WVV   +  V E+ I   +++  
Sbjct:    58 --QDFITKNLRLLKPQVIESFHLQCFSSSFKPEDIKHWVVTTISRRVRELIINYCDLSWL 115

Query:   129 DN---FLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPSLRILHMDVIQLGVSGHHR 185
             D     LDLP++L T T+L  LKL G+ ++  D  + V  P L+ L +D +        R
Sbjct:   116 DKPVVLLDLPNSLYTCTSLVTLKLIGH-SIIVDVPRTVSLPCLKTLELDSVAYSNEESLR 174

Query:   186 DLYRCCPVLDDLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNEDNVSLTFEIN 245
              L   CPVL+DL +  ++ + +     +V + +R LN      D  +  +  V +T  + 
Sbjct:   175 LLLSYCPVLEDLTIHRDMHDNVKTLVIIVPSLLR-LNLPI---DGAYSCDGYVIVTPALK 230

Query:   246 TQNLVCLELRENFFAQYILRNLNLLEKADIGI 277
                +  L  RE+F   Y+L ++  +E+AD+ +
Sbjct:   231 YLKVPGL-YREDF--SYLLTHMPNVEEADLSV 259
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2099054 AT3G58880 "AT3G58880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954943 AT5G35995 "AT5G35995" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165071 AT5G56810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122754 AT4G10400 "AT4G10400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 2e-05
pfam0838751 pfam08387, FBD, FBD 3e-05
pfam0064648 pfam00646, F-box, F-box domain 4e-04
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.002
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information 
 Score = 42.1 bits (100), Expect = 2e-05
 Identities = 12/42 (28%), Positives = 25/42 (59%)

Query: 341 CLRNCLRGISVRGFGGKLHELQVIEYLLKNARVLRRMDIYAS 382
           CL + L  + ++G+ G   E ++++Y L+NA  L+++ I   
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVE 43

Length = 72
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.68
KOG4341483 consensus F-box protein containing LRR [General fu 99.47
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.38
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.73
smart0057972 FBD domain in FBox and BRCT domain containing plan 98.67
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.3
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.22
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.22
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.03
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.81
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.79
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.61
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.56
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.44
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.33
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.26
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.19
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.86
KOG4341483 consensus F-box protein containing LRR [General fu 96.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.42
KOG0617264 consensus Ras suppressor protein (contains leucine 96.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.26
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.13
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 96.08
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.06
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 95.72
PLN03150623 hypothetical protein; Provisional 95.43
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 95.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.4
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.06
KOG0617264 consensus Ras suppressor protein (contains leucine 94.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 94.31
KOG0281499 consensus Beta-TrCP (transducin repeats containing 94.19
PRK15386 426 type III secretion protein GogB; Provisional 93.14
KOG2997366 consensus F-box protein FBX9 [General function pre 93.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 92.22
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 91.82
PLN03150623 hypothetical protein; Provisional 91.05
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 91.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 90.96
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 90.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.4
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 89.76
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 89.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 89.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 88.54
KOG0472565 consensus Leucine-rich repeat protein [Function un 86.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 86.66
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 86.4
PF13013109 F-box-like_2: F-box-like domain 84.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 81.46
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.9
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.68  E-value=6.5e-19  Score=154.04  Aligned_cols=270  Identities=19%  Similarity=0.205  Sum_probs=173.9

Q ss_pred             CCCCChHHHHHHHccCChHHHHHHHHhhhchHHhhccc-ccceEEEeeCCCCCCCCCCccchhHHHHHHHHHhcccCCCc
Q 045124            9 FYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTEV-EFHQLALDDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLV   87 (390)
Q Consensus         9 is~LPd~iL~~Ils~Lp~~~~~rts~lSrrWr~lw~~~-~~~~L~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~~~~~~   87 (390)
                      +..|||||+..|||.|+.+|+.+.+.|||||.++-... -|..+++.+....+             +...+++.+  |  
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p-------------~~l~~l~~r--g--  160 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP-------------DVLGRLLSR--G--  160 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh-------------hHHHHHHhC--C--
Confidence            57899999999999999999999999999998764332 12234544444432             223333222  2  


Q ss_pred             eeEEEEEEccCCChhHHHHHHHHHHhCCeeEEEEEeccCCCCceecCCCCCccCCcccEEEEcCeeecCCCCCCcccCCc
Q 045124           88 IRRFYLHCLQSYDAEVLRDWVVRGWTNNVVEVDIRVDNINEDNFLDLPSNLCTSTALEVLKLQGNITLDPDPDQRVIFPS  167 (390)
Q Consensus        88 l~~l~l~~~~~~~~~~~~~wl~~~~~~~v~~L~L~~~~~~~~~~~~lp~~l~~c~~L~~L~L~~~~~~~~~~~~~~~~~~  167 (390)
                      |..|++.-.....+..+.-.  ...+..++.++|+...   -..-.+-..+..|.+|+.|.|.|..+.+.--...+--.+
T Consensus       161 V~v~Rlar~~~~~prlae~~--~~frsRlq~lDLS~s~---it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~  235 (419)
T KOG2120|consen  161 VIVFRLARSFMDQPRLAEHF--SPFRSRLQHLDLSNSV---ITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSN  235 (419)
T ss_pred             eEEEEcchhhhcCchhhhhh--hhhhhhhHHhhcchhh---eeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhcccc
Confidence            55555542221222122111  1234568888887651   122333444567999999999998765421112334578


Q ss_pred             ccEEEeeeEEECCCchHhHhhhcCCccceEEEeceecCCCCeeEEE--EccceeEEEeeeeeccCCCCCCCCCcceEEEe
Q 045124          168 LRILHMDVIQLGVSGHHRDLYRCCPVLDDLYVRGNIAEPLPFQFDV--VSTSVRNLNSEFYLEDKHFDNEDNVSLTFEIN  245 (390)
Q Consensus       168 Lk~L~L~~v~~~~~~~l~~ll~~cp~Le~L~l~~c~~~~~~~~l~i--~~~~L~~L~i~~~~~~~~~~~~~~~~~~~~i~  245 (390)
                      |+.|+|+.+..-+..++.-++++|..|.+|+|.+|....-..+..|  .+++|+.|+++|+..+-..    .....+.-.
T Consensus       236 L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~----sh~~tL~~r  311 (419)
T KOG2120|consen  236 LVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQK----SHLSTLVRR  311 (419)
T ss_pred             ceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhh----hHHHHHHHh
Confidence            9999999998776688999999999999999999986211111222  4689999999664432222    122445668


Q ss_pred             cCccceEEeeecc----cceeeeccCCcceeEEeeeeeeeecCCCCccCCCccHHHHHhhhccCCCccEEEEeccc
Q 045124          246 TQNLVCLELRENF----FAQYILRNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCT  317 (390)
Q Consensus       246 ap~L~~L~~~~~~----~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~f~~~~~~~~l~~lL~~~p~L~~L~l~~~~  317 (390)
                      +|+|..|+++++.    .+...+-.++.|++++++-|+.+.             ....--++..|.|..|.+.++-
T Consensus       312 cp~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY~i~-------------p~~~~~l~s~psl~yLdv~g~v  374 (419)
T KOG2120|consen  312 CPNLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCYDII-------------PETLLELNSKPSLVYLDVFGCV  374 (419)
T ss_pred             CCceeeeccccccccCchHHHHHHhcchheeeehhhhcCCC-------------hHHeeeeccCcceEEEEecccc
Confidence            9999999999853    233456678888988888776442             1122225567777777777763

>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.8 bits (123), Expect = 3e-07
 Identities = 47/346 (13%), Positives = 96/346 (27%), Gaps = 100/346 (28%)

Query: 54  DDSDLLEPDLSPDTIAWSFQEFVSDILDRVNLLVIRRFYLHCLQSYDAEVLRDWVVR--- 110
           D  D+ +  LS        +E +  I+   + +         L S   E+++ +V     
Sbjct: 37  DVQDMPKSILS--------KEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLR 88

Query: 111 ---GWTNNVVEVDIRVDNINEDNFLDLPSNLCTS-------------------TALEVLK 148
               +  + ++ + R  ++    +++    L                       AL  L+
Sbjct: 89  INYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELR 148

Query: 149 LQGNITLD---------------PDPDQRVIFPSLRILHMDVIQLGVSGHHRD------L 187
              N+ +D                    +            +  L +   +        L
Sbjct: 149 PAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDF------KIFWLNLKNCNSPETVLEML 202

Query: 188 YRCCPVLD-DLYVRGNIAEPLPFQFDVVSTSVRNLNSEFYLEDKHFDNE----DNVSLTF 242
            +    +D +   R + +  +  +   +   +R L     L+ K ++N      NV    
Sbjct: 203 QKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRL-----LKSKPYENCLLVLLNVQNAK 257

Query: 243 EINTQNLVCLELRENFFAQYIL---RNLNLLEKADIGIGG----VFMCPRGGGFD----- 290
             N  NL C   +       IL   R   +    D         + +             
Sbjct: 258 AWNAFNLSC---K-------ILLTTRFKQV---TDFLSAATTTHISLDHHSMTLTPDEVK 304

Query: 291 --FDHWSDERISFLP-EVYNVNSLALSGCTVGEAKGEFPDCVQRWE 333
                + D R   LP EV   N   LS   + E+  +       W+
Sbjct: 305 SLLLKYLDCRPQDLPREVLTTNPRRLS--IIAESIRDGLATWDNWK 348
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.78
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.94
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.79
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.68
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.62
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.61
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.59
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.59
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.58
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.55
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.54
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.54
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.54
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.53
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.5
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.47
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.47
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.46
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.43
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.4
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.4
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.37
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.37
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.37
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.35
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.33
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.31
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.3
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.3
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.29
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.26
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.26
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.25
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.25
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.2
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.17
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.17
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.11
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.03
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.03
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.02
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.98
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.97
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.96
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.93
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.91
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.87
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.86
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.85
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.79
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.79
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.79
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.72
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.62
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.55
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.53
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.51
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.51
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.45
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.43
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.24
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.21
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.2
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.0
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.99
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.85
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.23
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 94.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 92.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.83
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 92.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 91.38
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
Probab=99.78  E-value=1.8e-20  Score=188.71  Aligned_cols=321  Identities=14%  Similarity=0.101  Sum_probs=159.9

Q ss_pred             CCCCCCCcCC----CCChHHHHHHHccC-ChHHHHHHHHhhhchHHhhcccccc-eEEEeeCCCCCCCCCCccchhHHHH
Q 045124            1 MPPRRRNFFY----GLPDDILRHIIACL-PTKNAVGTSLISRQWIDLWTEVEFH-QLALDDSDLLEPDLSPDTIAWSFQE   74 (390)
Q Consensus         1 ~~~~~~D~is----~LPd~iL~~Ils~L-p~~~~~rts~lSrrWr~lw~~~~~~-~L~~~~~~~~~~~~~~~~~~~~~~~   74 (390)
                      |++++.||++    .||||++.+||+|| +.+|++++++|||||++++...  + .+.+... +              ..
T Consensus         1 m~~~~~~r~~~~~~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~~--~~~l~~~~~-~--------------~~   63 (592)
T 3ogk_B            1 MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSET--REHVTMALC-Y--------------TA   63 (592)
T ss_dssp             -----------CCCCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHH--CCEEEESCG-G--------------GS
T ss_pred             CCChhhhhHhhccCCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhcc--ccEEEEeec-c--------------cc
Confidence            7788888888    89999999999999 8999999999999999986444  2 2222111 1              01


Q ss_pred             HHHHHhcccCCCceeEEEEEEccC---------CChhHHHHHHHHHH--hCCeeEEEEEeccCCCCceecCCCCCcc-CC
Q 045124           75 FVSDILDRVNLLVIRRFYLHCLQS---------YDAEVLRDWVVRGW--TNNVVEVDIRVDNINEDNFLDLPSNLCT-ST  142 (390)
Q Consensus        75 ~v~~~l~~~~~~~l~~l~l~~~~~---------~~~~~~~~wl~~~~--~~~v~~L~L~~~~~~~~~~~~lp~~l~~-c~  142 (390)
                      .+..++.+.+.  ++.+.+.....         ........|+....  .+++++|+|..+...    ...+..+.. |+
T Consensus        64 ~~~~~~~~~~~--L~~L~L~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~i~----~~~~~~l~~~~~  137 (592)
T 3ogk_B           64 TPDRLSRRFPN--LRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVS----DLDLDRLAKARA  137 (592)
T ss_dssp             CHHHHHHHCTT--CSEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCC----HHHHHHHHHHHG
T ss_pred             ChHHHHHhCCC--CeEEEecCCcchhhcccccccccccchHHHHHHHhhCCCCCeEEeeccEec----HHHHHHHHHhcc
Confidence            12233333333  67777755221         11222334555433  256777777544110    011111122 33


Q ss_pred             c-ccEEEEcCeeecCCC--CCCcccCCcccEEEeeeEEECCC--chHhHhhhcCCccceEEEeceecCCCC--e--eEEE
Q 045124          143 A-LEVLKLQGNITLDPD--PDQRVIFPSLRILHMDVIQLGVS--GHHRDLYRCCPVLDDLYVRGNIAEPLP--F--QFDV  213 (390)
Q Consensus       143 ~-L~~L~L~~~~~~~~~--~~~~~~~~~Lk~L~L~~v~~~~~--~~l~~ll~~cp~Le~L~l~~c~~~~~~--~--~l~i  213 (390)
                      + |++|+|.+|......  .....++++|++|+|.++.+.+.  ..+..+..+||.|+.|++.++......  .  .+..
T Consensus       138 ~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~~~~  217 (592)
T 3ogk_B          138 DDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIAR  217 (592)
T ss_dssp             GGCCEEEEESCEEEEHHHHHHHHHHCTTCSEEECTTCEEECCCSHHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHHHHH
T ss_pred             ccCcEEECcCCCCcCHHHHHHHHhhCCCCCEEECccccccCcchhHHHHHHhcCCCccEEEeeccCCCccCHHHHHHHHh
Confidence            3 777777666421100  00112566677777766665431  115556666666666666655442111  0  0111


Q ss_pred             EccceeEEEeeeeeccCCCCCCCCCcceEEEecCccceEEeee---------------------------cc--cceeee
Q 045124          214 VSTSVRNLNSEFYLEDKHFDNEDNVSLTFEINTQNLVCLELRE---------------------------NF--FAQYIL  264 (390)
Q Consensus       214 ~~~~L~~L~i~~~~~~~~~~~~~~~~~~~~i~ap~L~~L~~~~---------------------------~~--~~~~~~  264 (390)
                      .+++|+.|.+    .+|.....    .......|+|+.|.+++                           ..  .....+
T Consensus       218 ~~~~L~~L~L----~~~~~~~l----~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~l~~~~  289 (592)
T 3ogk_B          218 NCRSLVSVKV----GDFEILEL----VGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILF  289 (592)
T ss_dssp             HCTTCCEEEC----SSCBGGGG----HHHHHHCTTCCEEEECBCCCCTTCTTSSSCCCCCTTCCEEEETTCCTTTGGGGG
T ss_pred             hCCCCcEEec----cCccHHHH----HHHHhhhhHHHhhcccccccccchHHHHHHhhccccccccCccccchhHHHHHH
Confidence            3456666666    44443211    11222344555555442                           11  011223


Q ss_pred             ccCCcceeEEeeeeeeeecCCCCccCCCccHHHHHhhhccCCCccEEEEecccccccCCCCCCcccccccCCCccchhhc
Q 045124          265 RNLNLLEKADIGIGGVFMCPRGGGFDFDHWSDERISFLPEVYNVNSLALSGCTVGEAKGEFPDCVQRWEERDVPADCLRN  344 (390)
Q Consensus       265 ~~~~~L~~l~l~~~~~~~~~~~~~f~~~~~~~~l~~lL~~~p~L~~L~l~~~~~~~~~~~~~~~~~~w~~~~~~~~c~~~  344 (390)
                      .++++|+++++..+.             -....+..++..||+|+.|.+......   ..       ..   .... ...
T Consensus       290 ~~~~~L~~L~Ls~~~-------------l~~~~~~~~~~~~~~L~~L~L~~~~~~---~~-------l~---~~~~-~~~  342 (592)
T 3ogk_B          290 PFAAQIRKLDLLYAL-------------LETEDHCTLIQKCPNLEVLETRNVIGD---RG-------LE---VLAQ-YCK  342 (592)
T ss_dssp             GGGGGCCEEEETTCC-------------CCHHHHHHHHTTCTTCCEEEEEGGGHH---HH-------HH---HHHH-HCT
T ss_pred             hhcCCCcEEecCCCc-------------CCHHHHHHHHHhCcCCCEEeccCccCH---HH-------HH---HHHH-hCC
Confidence            445566666654322             124556677888999999988832110   00       00   0101 125


Q ss_pred             ccceEEEEe----------cCCchhHHHHHHHHHhcccccceEEEEE
Q 045124          345 CLRGISVRG----------FGGKLHELQVIEYLLKNARVLRRMDIYA  381 (390)
Q Consensus       345 ~Lk~v~i~~----------~~g~~~e~~~~~~ll~~a~~Le~l~i~~  381 (390)
                      +|+.+.+.+          +... . -.-+..+.++.++|+.+.+..
T Consensus       343 ~L~~L~L~~g~~~~~~~~~~~~~-~-~~~~~~l~~~~~~L~~L~l~~  387 (592)
T 3ogk_B          343 QLKRLRIERGADEQGMEDEEGLV-S-QRGLIALAQGCQELEYMAVYV  387 (592)
T ss_dssp             TCCEEEEECCCCSSTTSSTTCCC-C-HHHHHHHHHHCTTCSEEEEEE
T ss_pred             CCCEEEeecCccccccccccCcc-C-HHHHHHHHhhCccCeEEEeec
Confidence            799999983          3222 1 122345567889999998843
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 2e-04
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 4e-04
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.5 bits (89), Expect = 2e-04
 Identities = 10/41 (24%), Positives = 21/41 (51%)

Query: 2  PPRRRNFFYGLPDDILRHIIACLPTKNAVGTSLISRQWIDL 42
          P  +R+F   LP ++  ++++ L  K+ +  +   R W  L
Sbjct: 12 PQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRIL 52
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.95
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.74
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.72
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.44
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.33
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.31
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.3
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.18
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.13
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.12
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.1
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.96
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.87
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.23
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.0
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.86
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.3
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 95.73
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.59
d2ifga3156 High affinity nerve growth factor receptor, N-term 95.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.83
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 94.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.87
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 93.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.0
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 88.77
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.00  E-value=9.8e-11  Score=71.12  Aligned_cols=37  Identities=27%  Similarity=0.572  Sum_probs=34.1

Q ss_pred             CCCCChHHHHHHHccCChHHHHHHHHhhhchHHhhcc
Q 045124            9 FYGLPDDILRHIIACLPTKNAVGTSLISRQWIDLWTE   45 (390)
Q Consensus         9 is~LPd~iL~~Ils~Lp~~~~~rts~lSrrWr~lw~~   45 (390)
                      ++.||+||+.+||++||.+|.++++.|||+|+++...
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~   37 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASD   37 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTC
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCC
Confidence            4789999999999999999999999999999997643
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure