Citrus Sinensis ID: 045201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSSP
ccEEcccccEEEEEEcHHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEEcccccccccccc
cccEEccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEEEEcccccccc
mdrilrpegavIIRDQADVLVKVRKIVggmrwntkiidhedgplvtEKILFAVKRYWVTENVTSSP
mdrilrpegaviirdqadvLVKVRKivggmrwntkiidhedgplvTEKILFAVKRYWVTENVTSSP
MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSSP
********GAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTE******
MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDH****LVTEKILFAVKR***********
MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSSP
*DRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTEN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTENVTSSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
B9DFI7616 Probable methyltransferas yes no 0.969 0.103 0.671 2e-22
Q94EJ6621 Probable methyltransferas no no 0.878 0.093 0.741 1e-18
Q9ZPH9633 Probable methyltransferas no no 0.863 0.090 0.666 5e-16
Q9C884639 Probable methyltransferas no no 0.863 0.089 0.596 1e-15
Q9SZX8633 Probable methyltransferas no no 0.909 0.094 0.6 3e-15
O80844631 Probable methyltransferas no no 0.863 0.090 0.596 2e-14
Q93W95600 Probable methyltransferas no no 0.863 0.095 0.491 2e-08
Q9ZW75611 Probable methyltransferas no no 0.5 0.054 0.757 1e-07
Q9FG39682 Probable methyltransferas no no 0.909 0.087 0.4 1e-06
O22285694 Probable methyltransferas no no 0.833 0.079 0.436 2e-06
>sp|B9DFI7|PMT2_ARATH Probable methyltransferase PMT2 OS=Arabidopsis thaliana GN=At1g26850 PE=1 SV=2 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 55/64 (85%)

Query: 1   MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTE 60
           MDRILRPEGAVIIRD  D L+KV++I+ GMRW+ K++DHEDGPLV EK+L AVK+YWVT 
Sbjct: 552 MDRILRPEGAVIIRDDVDTLIKVKRIIAGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVTN 611

Query: 61  NVTS 64
           + ++
Sbjct: 612 STST 615

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q94EJ6|PMTE_ARATH Probable methyltransferase PMT14 OS=Arabidopsis thaliana GN=At4g18030 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPH9|PMTF_ARATH Probable methyltransferase PMT15 OS=Arabidopsis thaliana GN=At4g00750 PE=1 SV=1 Back     alignment and function description
>sp|Q9C884|PMTI_ARATH Probable methyltransferase PMT18 OS=Arabidopsis thaliana GN=At1g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZX8|PMTH_ARATH Probable methyltransferase PMT17 OS=Arabidopsis thaliana GN=At4g10440 PE=3 SV=1 Back     alignment and function description
>sp|O80844|PMTG_ARATH Probable methyltransferase PMT16 OS=Arabidopsis thaliana GN=At2g45750 PE=3 SV=1 Back     alignment and function description
>sp|Q93W95|PMTD_ARATH Probable methyltransferase PMT13 OS=Arabidopsis thaliana GN=At4g00740 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZW75|PMTJ_ARATH Probable methyltransferase PMT19 OS=Arabidopsis thaliana GN=At2g43200 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
147765301 605 hypothetical protein VITISV_038569 [Viti 1.0 0.109 0.779 1e-24
225456747 610 PREDICTED: probable methyltransferase PM 1.0 0.108 0.779 1e-24
255541011 613 ATP binding protein, putative [Ricinus c 0.984 0.106 0.776 7e-24
297733989 513 unnamed protein product [Vitis vinifera] 1.0 0.128 0.779 2e-23
356508562 606 PREDICTED: probable methyltransferase PM 0.984 0.107 0.772 8e-23
217074996 610 unknown [Medicago truncatula] 0.984 0.106 0.723 1e-22
357516137 610 hypothetical protein MTR_8g055840 [Medic 0.984 0.106 0.723 1e-22
255562840 612 ATP binding protein, putative [Ricinus c 0.984 0.106 0.753 2e-22
225425706 618 PREDICTED: probable methyltransferase PM 0.984 0.105 0.776 3e-22
296086376 514 unnamed protein product [Vitis vinifera] 0.984 0.126 0.776 4e-22
>gi|147765301|emb|CAN60192.1| hypothetical protein VITISV_038569 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/68 (77%), Positives = 61/68 (89%), Gaps = 2/68 (2%)

Query: 1   MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVT- 59
           MDRILRPEGAVI RDQ DVL+KV+KIVGGMRWNTK++DHEDGPLV+EKILFAVK+YWV  
Sbjct: 537 MDRILRPEGAVIFRDQIDVLIKVKKIVGGMRWNTKLVDHEDGPLVSEKILFAVKQYWVVG 596

Query: 60  -ENVTSSP 66
             N T++P
Sbjct: 597 ENNSTAAP 604

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456747|ref|XP_002275852.1| PREDICTED: probable methyltransferase PMT2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541011|ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis] gi|223550685|gb|EEF52172.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297733989|emb|CBI15236.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356508562|ref|XP_003523024.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max] Back     alignment and taxonomy information
>gi|217074996|gb|ACJ85858.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357516137|ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula] gi|355522379|gb|AET02833.1| hypothetical protein MTR_8g055840 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255562840|ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis] gi|223538310|gb|EEF39917.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225425706|ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086376|emb|CBI31965.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
TAIR|locus:2202805616 AT1G26850 [Arabidopsis thalian 0.969 0.103 0.707 9.4e-21
TAIR|locus:2141035621 AT4G18030 [Arabidopsis thalian 0.984 0.104 0.681 2.3e-18
TAIR|locus:2117728633 AT4G00750 [Arabidopsis thalian 0.863 0.090 0.666 5.1e-15
TAIR|locus:2127711633 AT4G10440 [Arabidopsis thalian 0.863 0.090 0.631 1.1e-14
TAIR|locus:2196651639 AT1G33170 [Arabidopsis thalian 0.863 0.089 0.596 2.3e-14
TAIR|locus:2050679631 AT2G45750 [Arabidopsis thalian 0.863 0.090 0.596 1.3e-13
TAIR|locus:2117733600 QUA3 "QUASIMODO 3" [Arabidopsi 0.863 0.095 0.491 5.8e-08
TAIR|locus:2041031611 AT2G43200 [Arabidopsis thalian 0.5 0.054 0.757 7.1e-07
TAIR|locus:2063947694 AT2G39750 [Arabidopsis thalian 0.833 0.079 0.436 2.9e-06
TAIR|locus:2150670600 AT5G04060 [Arabidopsis thalian 0.863 0.095 0.368 3.9e-06
TAIR|locus:2202805 AT1G26850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 9.4e-21, P = 9.4e-21
 Identities = 46/65 (70%), Positives = 56/65 (86%)

Query:     1 MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVKRYWVTE 60
             MDRILRPEGAVIIRD  D L+KV++I+ GMRW+ K++DHEDGPLV EK+L AVK+YWVT 
Sbjct:   552 MDRILRPEGAVIIRDDVDTLIKVKRIIAGMRWDAKLVDHEDGPLVPEKVLIAVKQYWVT- 610

Query:    61 NVTSS 65
             N TS+
Sbjct:   611 NSTST 615
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2141035 AT4G18030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117728 AT4G00750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127711 AT4G10440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196651 AT1G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050679 AT2G45750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117733 QUA3 "QUASIMODO 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041031 AT2G43200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150670 AT5G04060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_XII0234
hypothetical protein (611 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 4e-25
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information 
 Score = 95.1 bits (237), Expect = 4e-25
 Identities = 36/54 (66%), Positives = 38/54 (70%)

Query: 1   MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVK 54
           MDRILRP GAVIIRD  DVL KV+KI   MRW  +I D EDGP   EKIL A K
Sbjct: 453 MDRILRPGGAVIIRDDVDVLDKVKKIAKAMRWEVRITDTEDGPHDPEKILIAQK 506

This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 99.88
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.47
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 96.24
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 92.04
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 91.89
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 90.01
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 90.0
PRK14968188 putative methyltransferase; Provisional 89.81
TIGR00438188 rrmJ cell division protein FtsJ. 88.01
PRK04266226 fibrillarin; Provisional 87.41
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 86.92
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 86.46
PLN02232160 ubiquinone biosynthesis methyltransferase 85.8
KOG2361264 consensus Predicted methyltransferase [General fun 85.8
TIGR00536284 hemK_fam HemK family putative methylases. The gene 85.78
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 85.27
COG2890280 HemK Methylase of polypeptide chain release factor 84.56
KOG4300252 consensus Predicted methyltransferase [General fun 83.75
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 82.7
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 81.8
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 81.74
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 81.51
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 81.41
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 81.33
PRK04457262 spermidine synthase; Provisional 80.47
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 80.14
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information 
Probab=99.88  E-value=5.3e-23  Score=158.63  Aligned_cols=54  Identities=61%  Similarity=0.913  Sum_probs=53.5

Q ss_pred             CceeccCCcEEEEEcCHHHHHHHHhhhccCCceeEEeecCCCCcCcceEEEEEe
Q 045201            1 MDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNTKIIDHEDGPLVTEKILFAVK   54 (66)
Q Consensus         1 MDRILRP~G~vIiRD~~~vi~~v~~i~~~l~W~~~~~~~e~~~~~~e~iLi~~K   54 (66)
                      |||||||||+|||||+.++|++|++|+++|||+++++++|+|++++||||+|||
T Consensus       453 mDRILRP~G~~iiRD~~~vl~~v~~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  453 MDRILRPGGWVIIRDTVDVLEKVKKIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             hHhhcCCCceEEEeccHHHHHHHHHHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            899999999999999999999999999999999999999999999999999998

; GO: 0008168 methyltransferase activity
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 96.18
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 95.7
1jsx_A207 Glucose-inhibited division protein B; methyltransf 94.97
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 94.43
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 94.12
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 93.9
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 93.34
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 92.84
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 92.04
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 91.94
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 91.58
3duw_A223 OMT, O-methyltransferase, putative; alternating of 91.47
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 91.29
2b3t_A276 Protein methyltransferase HEMK; translation termin 90.98
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 90.94
2i62_A265 Nicotinamide N-methyltransferase; structural genom 90.7
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 90.53
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 90.11
3ocj_A305 Putative exported protein; structural genomics, PS 89.83
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 89.49
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 89.44
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 89.29
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 89.21
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 89.16
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 89.13
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 89.05
3dh0_A219 SAM dependent methyltransferase; cystal structure, 88.85
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 88.79
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 88.69
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 88.45
3hnr_A220 Probable methyltransferase BT9727_4108; structural 88.45
2avd_A229 Catechol-O-methyltransferase; structural genomics, 88.28
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 88.08
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 87.71
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 87.66
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 87.34
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 87.28
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 87.23
3lpm_A259 Putative methyltransferase; structural genomics, p 87.23
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 86.67
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 86.62
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 86.6
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 86.41
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 85.98
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 85.76
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 85.75
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 85.02
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 84.42
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 84.37
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 84.01
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 83.89
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 83.15
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 83.15
3sso_A419 Methyltransferase; macrolide, natural product, ros 83.12
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 82.59
2frn_A278 Hypothetical protein PH0793; structural genomics, 82.56
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 81.99
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 81.55
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 81.27
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 81.25
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 80.98
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 80.97
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 80.91
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 80.67
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 80.43
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 80.33
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 80.24
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
Probab=96.18  E-value=0.0013  Score=40.78  Aligned_cols=59  Identities=17%  Similarity=0.259  Sum_probs=35.1

Q ss_pred             eeccCCcEEEEEcCHH----------HHHHHHhhhccCCceeEEeecCCCCcC------------------cceEEEEEe
Q 045201            3 RILRPEGAVIIRDQAD----------VLVKVRKIVGGMRWNTKIIDHEDGPLV------------------TEKILFAVK   54 (66)
Q Consensus         3 RILRP~G~vIiRD~~~----------vi~~v~~i~~~l~W~~~~~~~e~~~~~------------------~e~iLi~~K   54 (66)
                      |+|+|||.+++.+...          ..+++.+.+..-.+ +.+......+..                  .--+++|+|
T Consensus        89 r~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf-i~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~a~K  167 (176)
T 2ld4_A           89 RILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGL-VEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKK  167 (176)
T ss_dssp             HHEEEEEEEEEEEEEESSSCSSSSSCCHHHHHHHHHHTTC-EEEEEEEEECCCHHHHHHHHHHTCCCCSSEEEEEEEEEC
T ss_pred             HHCCCCEEEEEEcccccccccccccCCHHHHHHHHHHCCC-cEeecCcccCCCHHHHHHHHHHhcccCCceEEEEEeccC
Confidence            7899999999964321          14566666665555 333322111111                  134788999


Q ss_pred             cceecCCC
Q 045201           55 RYWVTENV   62 (66)
Q Consensus        55 ~~W~~~~~   62 (66)
                      .-|..+++
T Consensus       168 p~~~~gs~  175 (176)
T 2ld4_A          168 PNFEVGSS  175 (176)
T ss_dssp             CCSSCCSC
T ss_pred             CcccccCC
Confidence            88876655
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 92.12
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 90.58
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 90.51
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 90.03
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 87.63
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 85.73
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 84.61
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 83.52
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 82.32
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 82.0
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 81.43
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 81.36
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 80.31
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arylamine N-methyltransferase
domain: Indolethylamine N-methyltransferase, INMT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.12  E-value=0.066  Score=33.04  Aligned_cols=33  Identities=15%  Similarity=0.227  Sum_probs=24.7

Q ss_pred             ceeccCCcEEEEEcCHH----------------HHHHHHhhhccCCcee
Q 045201            2 DRILRPEGAVIIRDQAD----------------VLVKVRKIVGGMRWNT   34 (66)
Q Consensus         2 DRILRP~G~vIiRD~~~----------------vi~~v~~i~~~l~W~~   34 (66)
                      -|.|+|||.+|+.+-..                ..+.+++++..-.+++
T Consensus       180 ~~~LkpGG~li~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~v  228 (257)
T d2a14a1         180 ASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDI  228 (257)
T ss_dssp             HTTEEEEEEEEEEEESSCCEEEETTEEEECCCCCHHHHHHHHHHTTEEE
T ss_pred             HhccCCCcEEEEEEecccccceeccccccccCCCHHHHHHHHHHCCCEE
Confidence            37899999999976321                2577788888878864
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure