Citrus Sinensis ID: 045227

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MIAVDPSTQETGSGDSVASSPQHGLHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQTDDSGVI
ccccccccccccccccccccccccccccEEEEEEEEccEEEEccccccEEEEcccEEEEEEcccccHHHHHHHHHHHHcccccccEEEEEcccccEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccccHHHHHHcccccccccccccccccc
ccccccccccccccccccccccccccccEEEEEEccccEEccccccccEEEEcccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEcccccEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccc
miavdpstqetgsgdsvasspqhglhlKSVRFICYfggeirlgpndnklryvggdTHIISVHRSstflalqtkplklagmaesdisvkyqlpngelisvtsdeDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILftqtddsgvi
miavdpstqetgsgdsvasspqhglHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDIsvkyqlpngelISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKIlftqtddsgvi
MIAVDPSTQETGSGDSVASSPQHGLHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQTDDSGVI
************************LHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQ*******
*******************************FICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSAL*************TIRLFLFNKR******************************
**********************HGLHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQTDDSGVI
**************************LKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQTDD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAVDPSTQETGSGDSVASSPQHGLHLKSVRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLFNKRGIVSFFRHWINKILSCFKILFTQTDDSGVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
224114107 415 predicted protein [Populus trichocarpa] 0.751 0.313 0.510 1e-29
224078832 420 predicted protein [Populus trichocarpa] 0.751 0.309 0.530 1e-29
255567451 417 ATP binding protein, putative [Ricinus c 0.676 0.280 0.529 7e-27
449433908 429 PREDICTED: uncharacterized protein LOC10 0.757 0.305 0.453 3e-24
356521285 424 PREDICTED: uncharacterized protein LOC10 0.664 0.271 0.522 5e-24
18412822 477 octicosapeptide/Phox/Bem1p domain-contai 0.676 0.245 0.5 1e-23
110740816 475 hypothetical protein [Arabidopsis thalia 0.676 0.246 0.5 1e-23
7267274 446 putative protein [Arabidopsis thaliana] 0.676 0.262 0.5 1e-23
297809707 445 hypothetical protein ARALYDRAFT_490165 [ 0.676 0.262 0.5 2e-23
356524756 421 PREDICTED: uncharacterized protein LOC10 0.664 0.273 0.507 2e-23
>gi|224114107|ref|XP_002316669.1| predicted protein [Populus trichocarpa] gi|222859734|gb|EEE97281.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 101/147 (68%), Gaps = 17/147 (11%)

Query: 1   MIAVDPSTQETGSGDSVASSPQHGLHL---KSVRFICYFGGEIRLGPNDNKLRYVGGDTH 57
           M ++ PS  ++G+ DSV SSP+ G H+     VRF+C FGG+I   P+DN+LRYVGGDT 
Sbjct: 1   MSSLHPSELDSGAPDSVVSSPRPGYHVSHDPRVRFMCSFGGKILPRPHDNQLRYVGGDTR 60

Query: 58  IISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGE---LISVTSDEDVENMMAEYDR 114
           I++VHRS+TF  L TK  KL+G+   ++SVKYQLPN +   LI+VT+DEDVENMM EYDR
Sbjct: 61  IVAVHRSTTFSTLITKLSKLSGIG--NLSVKYQLPNEDLDALITVTTDEDVENMMDEYDR 118

Query: 115 ILGSALQDDVQDLTSSAAGTIRLFLFN 141
           IL +          +  +  +RLFLF+
Sbjct: 119 ILHNQ---------NPRSARLRLFLFS 136

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078832|ref|XP_002305645.1| predicted protein [Populus trichocarpa] gi|222848609|gb|EEE86156.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255567451|ref|XP_002524705.1| ATP binding protein, putative [Ricinus communis] gi|223536066|gb|EEF37724.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449433908|ref|XP_004134738.1| PREDICTED: uncharacterized protein LOC101213084 isoform 1 [Cucumis sativus] gi|449433910|ref|XP_004134739.1| PREDICTED: uncharacterized protein LOC101213084 isoform 2 [Cucumis sativus] gi|449433912|ref|XP_004134740.1| PREDICTED: uncharacterized protein LOC101213084 isoform 3 [Cucumis sativus] gi|449479395|ref|XP_004155588.1| PREDICTED: uncharacterized LOC101213084 isoform 1 [Cucumis sativus] gi|449479399|ref|XP_004155589.1| PREDICTED: uncharacterized LOC101213084 isoform 2 [Cucumis sativus] gi|449479403|ref|XP_004155590.1| PREDICTED: uncharacterized LOC101213084 isoform 3 [Cucumis sativus] gi|449479407|ref|XP_004155591.1| PREDICTED: uncharacterized LOC101213084 isoform 4 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356521285|ref|XP_003529287.1| PREDICTED: uncharacterized protein LOC100806717 [Glycine max] Back     alignment and taxonomy information
>gi|18412822|ref|NP_567290.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis thaliana] gi|15809940|gb|AAL06897.1| AT4g05150/C17L7_70 [Arabidopsis thaliana] gi|332657085|gb|AEE82485.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110740816|dbj|BAE98505.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7267274|emb|CAB81057.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297809707|ref|XP_002872737.1| hypothetical protein ARALYDRAFT_490165 [Arabidopsis lyrata subsp. lyrata] gi|297318574|gb|EFH48996.1| hypothetical protein ARALYDRAFT_490165 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356524756|ref|XP_003530994.1| PREDICTED: uncharacterized protein LOC100803004 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
TAIR|locus:2115658 477 AT4G05150 [Arabidopsis thalian 0.676 0.245 0.507 2.8e-23
TAIR|locus:2101175180 AT3G48240 "AT3G48240" [Arabido 0.520 0.5 0.447 9.8e-16
TAIR|locus:2032895 1147 AT1G16270 [Arabidopsis thalian 0.583 0.088 0.420 1.7e-15
TAIR|locus:2179366 513 AT5G64430 "AT5G64430" [Arabido 0.606 0.204 0.413 2.1e-15
TAIR|locus:2144721 531 AT5G09620 "AT5G09620" [Arabido 0.502 0.163 0.5 3.7e-15
TAIR|locus:2161907192 AT5G63130 "AT5G63130" [Arabido 0.520 0.468 0.416 1.4e-14
TAIR|locus:2093146 1117 AT3G24715 [Arabidopsis thalian 0.497 0.076 0.452 2.2e-14
TAIR|locus:2038836 720 PDE331 "PIGMENT DEFECTIVE 331" 0.699 0.168 0.368 5.9e-14
TAIR|locus:2089648 666 AT3G18230 [Arabidopsis thalian 0.751 0.195 0.342 6.6e-14
TAIR|locus:2102787 1171 AT3G46920 [Arabidopsis thalian 0.595 0.087 0.364 9.1e-14
TAIR|locus:2115658 AT4G05150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 273 (101.2 bits), Expect = 2.8e-23, P = 2.8e-23
 Identities = 67/132 (50%), Positives = 88/132 (66%)

Query:    15 DSVASSPQHGLHLKS-VRFICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTK 73
             DS+ASSP+     +  VRF+C FGG I   P DN+L YVGGD  +++VHR +TF +L +K
Sbjct:    43 DSLASSPRSEYDSQPRVRFMCTFGGRILPRPPDNQLCYVGGDNRMVAVHRHTTFASLLSK 102

Query:    74 PLKLAGMAESDISVKYQLPNGEL---ISVTSDEDVENMMAEYDRILGSALQDDVQDLTSS 130
               KL+G  +S+ISVKYQLPN +L   ISV++DEDVENMM EYDR+     Q+      + 
Sbjct:   103 LAKLSG--KSNISVKYQLPNEDLDALISVSTDEDVENMMDEYDRVA----QNQ-----NP 151

Query:   131 AAGTIRLFLFNK 142
              A  +RLFLF K
Sbjct:   152 RASRLRLFLFTK 163
GO:0005634 "nucleus" evidence=ISM
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0048767 "root hair elongation" evidence=RCA
TAIR|locus:2101175 AT3G48240 "AT3G48240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032895 AT1G16270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179366 AT5G64430 "AT5G64430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144721 AT5G09620 "AT5G09620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161907 AT5G63130 "AT5G63130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093146 AT3G24715 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038836 PDE331 "PIGMENT DEFECTIVE 331" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089648 AT3G18230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102787 AT3G46920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00040183
hypothetical protein (421 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd0641097 cd06410, PB1_UP2, Uncharacterized protein 2 1e-32
smart0066681 smart00666, PB1, PB1 domain 1e-15
pfam0056484 pfam00564, PB1, PB1 domain 5e-14
cd0599281 cd05992, PB1, The PB1 domain is a modular domain m 9e-14
>gnl|CDD|99731 cd06410, PB1_UP2, Uncharacterized protein 2 Back     alignment and domain information 
 Score =  111 bits (281), Expect = 1e-32
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 17/111 (15%)

Query: 33  ICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLP 92
           +C +GG I   P D +LRYVGG+T I+SV RS +F  L +K  +L G A   +++KYQLP
Sbjct: 1   LCSYGGRILPRPPDGQLRYVGGETRIVSVDRSISFKELVSKLSELFG-AGVVVTLKYQLP 59

Query: 93  NGE---LISVTSDEDVENMMAEYDRILGSALQDDVQDLTSSAAGTIRLFLF 140
           + +   LISV++DED++NMM EYDR              S  +  +R+FLF
Sbjct: 60  DEDLDALISVSNDEDLKNMMEEYDR-------------LSGGSARLRVFLF 97

The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. Length = 97
>gnl|CDD|214770 smart00666, PB1, PB1 domain Back     alignment and domain information
>gnl|CDD|215996 pfam00564, PB1, PB1 domain Back     alignment and domain information
>gnl|CDD|99716 cd05992, PB1, The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
cd0641097 PB1_UP2 Uncharacterized protein 2. The PB1 domain 100.0
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 99.5
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 99.23
cd0599281 PB1 The PB1 domain is a modular domain mediating s 99.22
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 98.9
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 98.41
cd0640181 PB1_TFG The PB1 domain found in TFG protein, an on 98.21
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 98.11
cd0640483 PB1_aPKC PB1 domain is an essential modular domain 98.07
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 97.96
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 97.94
cd0640380 PB1_Par6 The PB1 domain is an essential part of Pa 97.91
cd0640579 PB1_Mekk2_3 The PB1 domain is present in the two m 97.9
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 97.67
cd0640287 PB1_p62 The PB1 domain is an essential part of p62 97.63
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 97.25
cd0639992 PB1_P40 The PB1 domain is essential part of the p4 96.67
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 96.62
cd0639591 PB1_Map2k5 PB1 domain is essential part of the mit 91.25
KOG0695 593 consensus Serine/threonine protein kinase [Signal 91.09
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 89.94
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 89.0
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 88.93
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 88.17
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 87.94
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 87.69
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 87.6
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 87.41
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 86.93
PTZ0004476 ubiquitin; Provisional 85.57
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 84.6
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 83.91
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 82.57
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 82.5
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 81.6
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 81.21
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 80.3
>cd06410 PB1_UP2 Uncharacterized protein 2 Back     alignment and domain information 
Probab=100.00  E-value=2.3e-42  Score=259.21  Aligned_cols=94  Identities=49%  Similarity=0.875  Sum_probs=89.0

Q ss_pred             EeeeCCEEEecCCCCceeeecCceEEEEEcCCCChHHHHHhHHHHhCCCCcceEEEeecCCCC---eeeecChHHHHHHH
Q 045227           33 ICYFGGEIRLGPNDNKLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGE---LISVTSDEDVENMM  109 (173)
Q Consensus        33 mCSyGGrIlPRp~Dg~LrYvGGeTRIv~V~Rsisf~eL~~kLs~l~g~~~~~~~lKYQLPgED---LISVssDeDL~~Mm  109 (173)
                      ||||||||+|||+||+|+|+|||||||+|+|++||+||++||+++++.... ++||||||+||   ||||++||||+|||
T Consensus         1 ~cs~GG~i~pr~~dg~l~Y~GG~tr~i~V~r~~s~~el~~kl~~~~~~~~~-~~lky~Lp~edld~Lisv~~DeDl~~M~   79 (97)
T cd06410           1 LCSYGGRILPRPPDGQLRYVGGETRIVSVDRSISFKELVSKLSELFGAGVV-VTLKYQLPDEDLDALISVSNDEDLKNMM   79 (97)
T ss_pred             CcccCCEEeCcCCCCCEEEcCCceEEEEEcCCCCHHHHHHHHHHHhCCCCc-eEEEEEcCCCCcceeEEecCcHHHHHHH
Confidence            799999999999999999999999999999999999999999999998533 89999999999   99999999999999


Q ss_pred             HHHHHHhhcccccccccccCCCCceeEEEEe
Q 045227          110 AEYDRILGSALQDDVQDLTSSAAGTIRLFLF  140 (173)
Q Consensus       110 eEYdrl~~~~~~~~~~~~~s~~~~rlRvFLF  140 (173)
                      +||+++.             .+++|+|+|||
T Consensus        80 ~e~~~~~-------------~~~~rirvflf   97 (97)
T cd06410          80 EEYDRLS-------------GGSARLRVFLF   97 (97)
T ss_pred             Hhhcccc-------------CCCceEEEEEC
Confidence            9999982             36899999998

The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3 proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06405 PB1_Mekk2_3 The PB1 domain is present in the two mitogen-activated protein kinase kinases MEKK2 and MEKK3 which are two members of the signaling kinase cascade involved in angiogenesis and early cardiovascular development Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 50.2 bits (119), Expect = 7e-08
 Identities = 30/178 (16%), Positives = 55/178 (30%), Gaps = 50/178 (28%)

Query: 43  GPNDNKLRYVG------GDTHIIS---VHRSSTFLALQTKPLKLA--------GM----- 80
            P+     Y+        D  + +   V R   +L L+   L+L         G+     
Sbjct: 104 QPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGK 163

Query: 81  ----AE--SDISVKYQLPNG----ELISVTSDEDVENMMAE-YDRILGSALQ-----DDV 124
                +      V+ ++        L +  S E V  M+ +   +I  +         ++
Sbjct: 164 TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNI 223

Query: 125 QDLTSSAAGTIRLFLFNKRG----IVSFFRH-WINKILSCF----KILFTQTDDSGVI 173
           +    S    +R  L +K      +V    +    K  + F    KIL T T    V 
Sbjct: 224 KLRIHSIQAELRRLLKSKPYENCLLV--LLNVQNAKAWNAFNLSCKILLT-TRFKQVT 278

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
2cu1_A103 Mitogen-activated protein kinase kinase kinase 2; 99.54
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 98.82
2jrh_A94 Mitogen-activated protein kinase kinase kinase 3; 98.27
2npt_B100 Mitogen-activated protein kinase kinase kinase 2; 98.19
2c60_A111 Human mitogen-activated protein kinase kinase kina 98.17
2kkc_A102 Sequestosome-1; P62, PB1, autophagy, ubiquitin-pro 98.05
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 97.94
2ktr_A117 Sequestosome-1; autophagy, NF-KB signaling, HOMO-o 97.94
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 97.66
1wmh_B86 Partitioning defective-6 homolog alpha; kinase, PB 97.6
1pqs_A77 Cell division control protein 24; alpha and beta p 97.58
1oey_J107 P40-PHOX, neutrophil cytosol factor 4; immune syst 97.16
2bkf_A87 Zinc-finger protein NBR1 (NEXT to breast cancer 1; 96.88
1wj6_A101 KIAA0049 protein, RSGI RUH-024; PB1 domain, protei 96.44
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 94.66
2npt_A106 Dual specificity mitogen-activated protein kinase; 92.26
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 89.28
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 87.68
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 86.8
3v6c_B91 Ubiquitin; structural genomics, structural genomic 86.5
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 86.4
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 85.52
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 84.91
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 84.38
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 84.13
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 84.03
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 83.85
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 83.29
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 83.08
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 82.87
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 81.58
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 81.32
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 80.82
>2cu1_A Mitogen-activated protein kinase kinase kinase 2; PB1 domain, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, signaling protein; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
Probab=99.54  E-value=3.5e-14  Score=107.86  Aligned_cols=75  Identities=20%  Similarity=0.402  Sum_probs=65.5

Q ss_pred             ecCceEEEEEcCCCChHHHHHhHHHHhCCCCcceEEEeecCCCC-eeeecChHHHHHHHHHHHHHhhcccccccccccCC
Q 045227           52 VGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGE-LISVTSDEDVENMMAEYDRILGSALQDDVQDLTSS  130 (173)
Q Consensus        52 vGGeTRIv~V~Rsisf~eL~~kLs~l~g~~~~~~~lKYQLPgED-LISVssDeDL~~MmeEYdrl~~~~~~~~~~~~~s~  130 (173)
                      .+||+|||.|+|.++|.||..|+.++||.   .+.|.|+  +.+ ||+++|+|||++.||+|||..              
T Consensus        15 ~~GEkRIi~f~RPv~f~eL~~Kv~~~fGq---~ldL~y~--n~EllIpl~sQeDLDkaIellDrss--------------   75 (103)
T 2cu1_A           15 HRGEKRILQFPRPVKLEDLRSKAKIAFGQ---SMDLHYT--NNELVIPLTTQDDLDKAVELLDRSI--------------   75 (103)
T ss_dssp             ETTEEEEEEEESSCCHHHHHHHHHHHHSS---CEEEEEC--SSSSCEECCSHHHHHHHHHHHHHCS--------------
T ss_pred             ecCeEEEEeccCCccHHHHHHHHHHHhCC---eeeEEEe--cceEEEeccCHHHHHHHHHHHccCC--------------
Confidence            47999999999999999999999999997   8999999  666 999999999999999999952              


Q ss_pred             CCceeEEEEecCCCc
Q 045227          131 AAGTIRLFLFNKRGI  145 (173)
Q Consensus       131 ~~~rlRvFLFp~~~~  145 (173)
                      ...-||++|-+.+..
T Consensus        76 ~~kSLrIlL~~~~~~   90 (103)
T 2cu1_A           76 HMKSLKILLVINGST   90 (103)
T ss_dssp             SCCSEEEEEEECCCC
T ss_pred             cccceEEEEecCCCC
Confidence            344567788876654
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2jrh_A Mitogen-activated protein kinase kinase kinase 3; kinase signaling domain, transferase; NMR {Homo sapiens} PDB: 2pph_A Back     alignment and structure
>2npt_B Mitogen-activated protein kinase kinase kinase 2; MAP2K5, MEK5, MKK PRKMK5, MAP kinase kinase 5, PHOX, PHOX-domain; 1.75A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2c60_A Human mitogen-activated protein kinase kinase kinase 3 isoform 2; MAP3K3, MAP/ERK kinase kinase 3, MAPKKK3, MEKK3, serine threonine phosphorylation; HET: MSE; 1.25A {Homo sapiens} SCOP: d.15.2.2 PDB: 2o2v_B Back     alignment and structure
>2kkc_A Sequestosome-1; P62, PB1, autophagy, ubiquitin-proteasome system, NF-KB signaling, alternative splicing, apoptosis, cytoplasm, differentiation; NMR {Rattus norvegicus} PDB: 2ktr_B Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2ktr_A Sequestosome-1; autophagy, NF-KB signaling, HOMO-oligomer, PB1 dimer, signaling protein, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>1wmh_B Partitioning defective-6 homolog alpha; kinase, PB1 domain, OPCA motif, APKC, cell polarity, transferase/cell cycle complex; 1.50A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1pqs_A Cell division control protein 24; alpha and beta protein, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1tz1_A Back     alignment and structure
>1oey_J P40-PHOX, neutrophil cytosol factor 4; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2bkf_A Zinc-finger protein NBR1 (NEXT to breast cancer 1; PB1 domain, interaction domain, Z finger; 1.56A {Homo sapiens} SCOP: d.15.2.2 PDB: 2g4s_A Back     alignment and structure
>1wj6_A KIAA0049 protein, RSGI RUH-024; PB1 domain, protein binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>2npt_A Dual specificity mitogen-activated protein kinase; MAP2K5, MEK5, MKK PRKMK5, MAP kinase kinase 5, PHOX, PHOX-domain; 1.75A {Homo sapiens} SCOP: d.15.2.2 PDB: 2o2v_A 1wi0_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1ip9a_85 d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker' 4e-06
d2bkfa185 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NB 0.003
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Bud emergence mediator Bemp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 40.9 bits (96), Expect = 4e-06
 Identities = 12/69 (17%), Positives = 29/69 (42%), Gaps = 3/69 (4%)

Query: 48  KLRYVGGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVEN 107
           K  Y   D   + +   +T+  L++K      +   +  ++ +L +G    + +D  V N
Sbjct: 16  KFYY-KDDIFALMLKGDTTYKELRSKIAPR--IDTDNFKLQTKLFDGSGEEIKTDSQVSN 72

Query: 108 MMAEYDRIL 116
           ++    +I 
Sbjct: 73  IIQAKLKIS 81
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 98.85
d2c60a180 Mitogen-activated protein kinase kinase kinase 3, 98.22
d2nptb182 Mitogen-activated protein kinase kinase kinase 2, 98.19
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 98.15
d1oeyj_105 Neutrophil cytosol factor 4 (p40phox component of 97.04
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 96.17
d1wmha_83 Protein kinase C, iota type {Human (Homo sapiens) 96.15
d2npta1105 Mitogen activated protein kinase kinase 5, Map2k5 95.37
d1pqsa_77 Cell division control protein 24, CDC24, C-termina 94.88
d1wmhb_82 Partitioning defective-6 homolog alpha, PAR-6 alph 92.47
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 84.87
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 83.46
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 83.3
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 82.95
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 81.3
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Bud emergence mediator Bemp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.85  E-value=3.6e-09  Score=74.48  Aligned_cols=58  Identities=16%  Similarity=0.257  Sum_probs=51.1

Q ss_pred             cCceEEEEEcCCCChHHHHHhHHHHhCCCCcceEEEeecCCCCeeeecChHHHHHHHHHH
Q 045227           53 GGDTHIISVHRSSTFLALQTKPLKLAGMAESDISVKYQLPNGELISVTSDEDVENMMAEY  112 (173)
Q Consensus        53 GGeTRIv~V~Rsisf~eL~~kLs~l~g~~~~~~~lKYQLPgEDLISVssDeDL~~MmeEY  112 (173)
                      ++|++++.|+.+++|.+|+.++.+.++.  ..+.|||+=-.+|+|+++||+||+++|++.
T Consensus        20 ~~D~~~~~l~~~it~~dL~~kI~~rf~~--~~~~lkY~Dedgd~v~i~sD~Dl~~ai~~~   77 (85)
T d1ip9a_          20 KDDIFALMLKGDTTYKELRSKIAPRIDT--DNFKLQTKLFDGSGEEIKTDSQVSNIIQAK   77 (85)
T ss_dssp             TTCCEEEEECSCCCHHHHHHHHHHHHTS--SCEEEEECCSSSCCSCCCSHHHHHHHHHTT
T ss_pred             CCcEEEEEeCCCCCHHHHHHHHHHHhCC--CceEEEEEcCCCCEEEEeCHHHHHHHHHhc
Confidence            4678899999999999999999999986  479999996555599999999999999753
>d2c60a1 d.15.2.2 (A:43-122) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nptb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure