Citrus Sinensis ID: 045237

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------76
IGSTWEKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYKSDINRLLIQLWNVEEDVDRPDVLSILNDINYFVYESEKAIDTFFTTIMQPQSSESESESTSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
cccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEEEcccccccEEccccHHccccEEEEEEEcccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHcccccccEEEEEEcccHHHHcccccccccccccccHHcccHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHcccccccHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEcccccEEcEEEEcHHHHHHHHHHHHHcccEEEEccccccccccEEEEEEEcccccccccccccccccEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEEccccccccccccccccccccEEEccccccccHHHHcccccccEEEEEccccccHHHHHHHccccccccEEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEEEEEcccEEEEEcccccccccEEEEEccccccEEEEEccccccccEEEEEEccccccccccccccccccEEEEEcccHHHHHHHHcccccccccEEEcccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccHHHcccccccHHHHHHHHHccccccEEEEEEEccccccccccHHHHHHccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccccccEEEEEEccHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHcHHHHHHHcccccccHHHHHHccHHHccHHHHHHEEEEEEccccccEcHHHHHHHHHHHccccccHHHHHHHHHHHHHHccEEEEEEccccccEEEEEHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEccccccccccccccccEEEEEEccccccccHHHHHHHHccccEEEEEcccccccccccHccccHHHEEEEccccccccccccHcccccccEEEccccccccccHHHHHHHcccEEEEcccccccccccccccHHHHHEEcccccccccHHHHccHHHHcEEEEEccccccHHHHHHHHHccccccEEEEEcccccccccHHcccccccccccEEEEEEccccccccHHHHccccccEEEEEEccccccccEcccccccccccEEEEEcccccccEEEccccccccccEEEEcccHHHHcccccccccccccEEEEcccHHHHHHHHccccccccccEEEcccccc
igstwekgdmeMNLILFSDRLKRVlagedgaltlpdstnlkpVLQYFLSEIEIITTLLRDYKSDINRLLIQLWnveedvdrpdvlsILNDINYFVYESEKAIDTFFttimqpqssesesestSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKsvmpasglseiigkdytlKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREAlpdyqngsrvlitvvdpdiltsfelengekigsdsvlvggplfrikyeGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLikvgkrsaggkiktcsvpSSVWARLVVLAAKMKFVMVLDLGLVEELRTIkrfavpknltkfvsLEHIDTYLHSLQNfalesdhsaLLDCENICKKFKLLRVLNMGslvldqfpsgienLFLLRClkldvpslkslpsslcnllnlqtldmpssyidhtpedIWNMHKLMHLnfgcitlpappenycsslKNLIFisalhpcsctpdtlgrlpnvqtlkiygdlssyqsGLSKSLRELLKLESLKLVNKSKGWQLSQMILSeyqfppsltqlslsntelkedpmptleklpHLLVLKLKqnsysgrklacvgsggfpklkiLHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKlelhwpqpelrKKLRAYEDMERRydiqmypygi
igstwekgdmemNLILFSDRLKRVLAGEdgaltlpdstnlkPVLQYFLSEIEIITTLLRDYKSDINRLLIQLwnveedvdrpDVLSILNDINYFVYESEKAIDTFFTTIMQPQSSESESESTSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVmpasglseiigkdytlkksILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFelengekigsdsvLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKvgkrsaggkiktcsvpssVWARLVVLAAKMKFVMVLDLGLVEELrtikrfavpknltKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFrklelhwpqpelrkklrayedmerrydiqmypygi
IGSTWEKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYKSDINRLLIQLWNVEEDVDRPDVLSILNDINYFVYESEKAIDTFFTTIMQPQssesesestsYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRClkldvpslkslpsslcnllnlQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQsglskslrellkleslklvnkskGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTleklphllvlklkQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
***********MNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYKSDINRLLIQLWNVEEDVDRPDVLSILNDINYFVYESEKAIDTFFTTIM***************DALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFP**********************KLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQM*****
*****EKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYK*****************************NYFVYESEKAIDTFFTTIMQP*****ESESTSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVM**************LKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQ*MEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLD*********IKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCIT*********SSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
IGSTWEKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYKSDINRLLIQLWNVEEDVDRPDVLSILNDINYFVYESEKAIDTFFTTIM**************KDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
IGSTWEKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLLRDYKSDINRLLIQLWNVE*************DINYFVYESEKAIDTFFTTIMQPQSSESESESTSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IGSTWEKGDMEMNLILFSDRLKRVLAGEDGALTLPDSTNLKPVLQYFLSEIEIITTLxxxxxxxxxxxxxxxxxxxxxVDRPDVLSILNDINYFVYESEKAIDTFFTTIMQPQSSESESESTSYKDALVGLQKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTSFELENGEKIGSDSVLVGGPLFRIKYEGWQFFLLYCGCKSLESQMMEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLKLVNKSKGWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMYPYGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query758 2.2.26 [Sep-21-2011]
Q9FJB5901 Disease resistance RPP8-l yes no 0.779 0.655 0.259 3e-42
Q8W474907 Probable disease resistan no no 0.798 0.667 0.266 4e-33
Q9STE7847 Putative disease resistan no no 0.738 0.661 0.276 2e-32
Q8W4J9908 Disease resistance protei no no 0.810 0.676 0.246 2e-32
P59584910 Disease resistance protei no no 0.808 0.673 0.245 4e-32
P0C8S1906 Probable disease resistan no no 0.804 0.673 0.251 6e-32
Q9FJK8908 Probable disease resistan no no 0.803 0.670 0.251 2e-31
Q6L3Z71317 Putative late blight resi N/A no 0.762 0.438 0.257 5e-31
Q9M667835 Disease resistance protei no no 0.734 0.667 0.285 9e-31
Q6L4031312 Putative late blight resi N/A no 0.762 0.440 0.259 8e-30
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function desciption
 Score =  174 bits (440), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 187/721 (25%), Positives = 312/721 (43%), Gaps = 130/721 (18%)

Query: 132 QKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKD-YTLKKSIL 190
           ++ F+ + V+ +FD  AWV VS Q+  K +   I++ + P  G  EI+  D YT++  + 
Sbjct: 201 RQIFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELRPHDG--EILQMDEYTIQGKLF 258

Query: 191 RDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITV--------VDPDILT--- 239
           +  L   +Y+ VLDD++ +  W+ ++E  P  + G ++L+T          DP  L+   
Sbjct: 259 Q-LLETGRYLVVLDDVWKEEDWDRIKEVFP-RKRGWKMLLTSRNEGVGLHADPTCLSFRA 316

Query: 240 --------------------SFELENGEKIGSDSVL-VGGPLFRIKYEG----------- 267
                                 E E  E IG + V   GG    +K  G           
Sbjct: 317 RILNPKESWKLFERIVPRRNETEYEEMEAIGKEMVTYCGGLPLAVKVLGGLLANKHTASE 376

Query: 268 WQFFLLYCGCKSLESQMMEME--NEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTR 325
           W+      G + +    ++    N    +L  S  +LP  LK C  YL  F  + +I TR
Sbjct: 377 WKRVSENIGAQIVGKSCLDDNSLNSVYRILSLSYEDLPTDLKHCFLYLAHFPEDYKIKTR 436

Query: 326 QLYQLWMAEG-FVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVV 384
            LY  W AEG +       + E+YL+EL+ R L+   K +   ++K C +   +    + 
Sbjct: 437 TLYSYWAAEGIYDGLTILDSGEDYLEELVRRNLVIAEKSNLSWRLKLCQMHDMMREVCIS 496

Query: 385 LAAKMKFVMVLDLGLVEELRTIKRFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSALL 444
            A    F+ ++ +         +  +  + LT           +HS + F +        
Sbjct: 497 KAKVENFLQIIKVPTSTSTIIAQSPSRSRRLT-----------VHSGKAFHILGHK---- 541

Query: 445 DCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLK----SLPSSLCNLL 500
                 KK + L VL +   +  Q  S  ++L LLR   LD+ S+K     LPSS+  L+
Sbjct: 542 ------KKVRSLLVLGLKEDLWIQSASRFQSLPLLRV--LDLSSVKFEGGKLPSSIGGLI 593

Query: 501 NLQTLDMPSSYIDHTPEDIWNMHKLMHLNFG-CITLPAPPENYCSSLKNLIFIS-ALHPC 558
           +L+ L +  + + H P  I N+  +++LN    I +P    N    +  L ++S  L   
Sbjct: 594 HLRFLSLHQAVVSHLPSTIRNLKLMLYLNLHVAIGVPVHVPNVLKEMLELRYLSLPLDMH 653

Query: 559 SCTPDTLGRLPNVQ-------------------TLKIYGDLSSYQ---SGLSKSLRELLK 596
             T   LG L N++                    L+ +G   S +     LS SLR+  K
Sbjct: 654 DKTKLELGDLVNLEYLWCFSTQHSSVTDLLRMTKLRFFGVSFSERCTFENLSSSLRQFRK 713

Query: 597 LESLKLVNKSK----------------------GWQLSQMILSEYQFPPSLTQLSLSNTE 634
           LE+L  +   K                      G  LS+ I  ++Q PP +  + L    
Sbjct: 714 LETLSFIYSRKTYMVDYVGEFVLDFIHLKKLSLGVHLSK-IPDQHQLPPHIAHIYLLFCH 772

Query: 635 LKEDPMPTLEKLPHLLVLKLKQNSYSGRKLACVGSGGFPKLKILHLKSMFWLEEWTMGAR 694
           ++EDPMP LEKL HL  ++L++ ++ GR++ C   GGFP+L+ L +     LEEW +   
Sbjct: 773 MEEDPMPILEKLLHLKSVELRRKAFIGRRMVC-SKGGFPQLRALQISEQSELEEWIVEEG 831

Query: 695 AMTKLESLIINPCAYLKKLPEELWRIESFRKLELHWPQPELRKKLRAYEDMERRYDIQMY 754
           +M  L  LII+ C  L++LP+ L  + S ++L++   + E ++KL      E  Y +Q  
Sbjct: 832 SMPCLRDLIIHSCEKLEELPDGLKYVTSLKELKIEGMKREWKEKLVG----EDYYKVQHI 887

Query: 755 P 755
           P
Sbjct: 888 P 888
Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|Q9STE7|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|Q6L3Z7|R1B14_SOLDE Putative late blight resistance protein homolog R1B-14 OS=Solanum demissum GN=R1B-14 PE=3 SV=1 Back     alignment and function description
>sp|Q9M667|RPP13_ARATH Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2 Back     alignment and function description
>sp|Q6L403|R1B17_SOLDE Putative late blight resistance protein homolog R1B-17 OS=Solanum demissum GN=R1B-17 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query758
147766035 902 hypothetical protein VITISV_038742 [Viti 0.779 0.655 0.299 2e-60
359491404 922 PREDICTED: probable disease resistance R 0.779 0.640 0.310 4e-60
359489148 897 PREDICTED: probable disease resistance R 0.799 0.675 0.291 1e-54
297745275 1136 unnamed protein product [Vitis vinifera] 0.750 0.500 0.308 6e-54
359489156 899 PREDICTED: probable disease resistance p 0.799 0.674 0.287 5e-53
224096480 910 nbs-lrr resistance protein [Populus tric 0.762 0.635 0.282 6e-53
356538242 912 PREDICTED: disease resistance RPP8-like 0.821 0.683 0.285 1e-52
444301787 878 NBS type disease resistance protein [Mal 0.803 0.693 0.276 2e-52
297745279 920 unnamed protein product [Vitis vinifera] 0.762 0.628 0.286 2e-52
359489790 944 PREDICTED: probable disease resistance p 0.786 0.631 0.290 3e-52
>gi|147766035|emb|CAN70214.1| hypothetical protein VITISV_038742 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  240 bits (613), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 199/665 (29%), Positives = 321/665 (48%), Gaps = 74/665 (11%)

Query: 132 QKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMP-ASGLSEIIGKDYTLKKSIL 190
           +K +N   VK  FD  AWV VS  Y   ++L +I + ++    G   ++ + +  ++  +
Sbjct: 212 KKVYNCRSVKRRFDFCAWVYVSQDYRAGELLHEIGEKILRIEKGRLAMMNRQHLEER--V 269

Query: 191 RDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITV--------VDPDILT--- 239
              L  K+Y+ VLDDI+   +W+DL+   PD  N SRVL T          DP   T   
Sbjct: 270 STVLRKKRYLIVLDDIWETEVWDDLKTLFPDVMNASRVLFTTRIRDVAIHADPRSATHEL 329

Query: 240 -------SFEL--ENGEKIGSDSVLVGGPLFRI------KYEGWQFFLLYCG-------- 276
                  S+EL  +    +  DSV     L R+      K  G    ++  G        
Sbjct: 330 HFLNQAQSWELFLKKAFPMEGDSVTCPPELERLGTQIVAKCGGLPLAIVIIGGLLSRKEK 389

Query: 277 -----CKSLESQMMEMENEPTAL---LFCSIFELPLYLKFCCFYLCVFYGNLEISTRQLY 328
                 + L+S   ++ N+   L   L  S  +LP YLK C  Y  +F  +LEI   +L 
Sbjct: 390 XPSVWLRVLQSISWQLNNDSRQLMEILALSYNDLPYYLKPCFLYFGLFPEDLEIPVGKLV 449

Query: 329 QLWMAEGFVAHNSEAN----AEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVV 384
            LW+AEGFV    E +    AE++L+EL+ R +I+V ++   GKIK C +   +    + 
Sbjct: 450 LLWIAEGFVQQRGEESMEDVAEDFLEELVDRSMIQVAEKRYNGKIKMCRIHDLLRDLAMS 509

Query: 385 LAAKMKFVMVLDLGLVEELRTIK--RFAVPKNLTKFVSLEHIDTYLHSLQNFALESDHSA 442
            A + KF+ +LD   ++   T +  R +V  +L +++ L H + +  S+ +F+   +   
Sbjct: 510 EAKECKFLEILDSTNIDTSVTTRARRISVHSSLEEYMKLRHPNPHFRSMLHFSRCEESLR 569

Query: 443 LLDCENICKKFKLLRVLNMGSLVLDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNL 502
               +++ +  KLLRVL++  +     P  I  L  LR L L    L+ LPSS+ N  NL
Sbjct: 570 REQWKSLFESLKLLRVLDLERVQTHALPKEIRELVHLRYLGLRRTGLQRLPSSVQNFCNL 629

Query: 503 QTLDMPSSYIDHTPEDIWNMHKLMHLNFGCITLPAPPENYCS--SLKNLIFISALHPCSC 560
           QTLD+ ++ +   P  +WNM  L HL     ++   P  + S   L+ L  +S ++    
Sbjct: 630 QTLDIRATKVSRLPIQLWNMPGLRHLYLEKTSIAGHPPVHVSVMHLQTLSTVS-IYGNQW 688

Query: 561 TPDTLGRLPNVQTLKIYGDLSSYQSGLSKSLRELLKLESLK--------------LVNKS 606
            PD LG+L N++ L I+G  +S    LS+ L +L  L++L+              L+N+ 
Sbjct: 689 IPDLLGKLTNLRKLGIHGYFASQTEALSRCLVKLSNLQNLQLRGTELILEPTIKLLLNQP 748

Query: 607 KGWQLS-----QMILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYSG 661
              +L      + +    +  P+LT++ L  + L +D    L KLP+L +LKL  NS+ G
Sbjct: 749 NIHKLHLSGPIEKLPDPQEIQPNLTKIILEKSLLVQDIFVILGKLPNLQMLKLLINSFFG 808

Query: 662 RKLACVGSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIE 721
           +++ C  S GFPKL  L L  +  LEEW +   AM  L  L+I+ C  LKK+PE    + 
Sbjct: 809 KEITCSAS-GFPKLHGLELSELVNLEEWRVDDGAMPSLRHLVIDHCDQLKKIPEGFQYLT 867

Query: 722 SFRKL 726
           + R+L
Sbjct: 868 ALREL 872

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359491404|ref|XP_002274414.2| PREDICTED: probable disease resistance RPP8-like protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489148|ref|XP_003633887.1| PREDICTED: probable disease resistance RPP8-like protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745275|emb|CBI40355.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489156|ref|XP_003633889.1| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224096480|ref|XP_002334697.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222874531|gb|EEF11662.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356538242|ref|XP_003537613.1| PREDICTED: disease resistance RPP8-like protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|444301787|gb|AGD98930.1| NBS type disease resistance protein [Malus x domestica] Back     alignment and taxonomy information
>gi|297745279|emb|CBI40359.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489790|ref|XP_003633978.1| PREDICTED: probable disease resistance protein At1g58602-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query758
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.191 0.160 0.295 1.1e-28
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.385 0.321 0.239 2.1e-24
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.182 0.151 0.326 1.8e-23
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.137 0.122 0.396 3.1e-22
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.174 0.145 0.355 7.1e-22
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.186 0.155 0.333 2e-21
TAIR|locus:2075170835 RPP13 "RECOGNITION OF PERONOSP 0.242 0.220 0.290 2.4e-21
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.139 0.114 0.318 9.9e-21
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.129 0.093 0.373 2.7e-20
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.129 0.093 0.373 2.7e-20
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 187 (70.9 bits), Expect = 1.1e-28, Sum P(3) = 1.1e-28
 Identities = 44/149 (29%), Positives = 77/149 (51%)

Query:   608 GWQLSQMILSEYQFPPSLTQLSLSNTELKEDPMPTXXXXXXXXXXXXXQNSYSGRKLACV 667
             G  LS+ I  ++Q PP +  + L    ++EDPMP              + ++ GR++ C 
Sbjct:   747 GVHLSK-IPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVC- 804

Query:   668 GSGGFPKLKILHLKSMFWLEEWTMGARAMTKLESLIINPCAYLKKLPEELWRIESFRKLE 727
               GGFP+L+ L +     LEEW +   +M  L  LII+ C  L++LP+ L  + S ++L+
Sbjct:   805 SKGGFPQLRALQISEQSELEEWIVEEGSMPCLRDLIIHSCEKLEELPDGLKYVTSLKELK 864

Query:   728 LHWPQPELRKKL--RAYEDMERRYDIQMY 754
             +   + E ++KL    Y  ++   D+Q +
Sbjct:   865 IEGMKREWKEKLVGEDYYKVQHIPDVQFF 893
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017592001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (858 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query758
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 82.4 bits (204), Expect = 4e-17
 Identities = 62/251 (24%), Positives = 112/251 (44%), Gaps = 52/251 (20%)

Query: 132 QKAFNSNHVKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILR 191
           ++ +N + V  +FD  AWV VS  Y   ++  DI++ +       + + K+ +     ++
Sbjct: 37  KQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDS--DWVEKNESELAVKIK 94

Query: 192 DYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDI------------LT 239
           + L  K+++ VLDD++    W+ +    PD +NGSRV++T     +            + 
Sbjct: 95  EALLRKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVE 154

Query: 240 SFELENG-------------------EKIGSDSV-----------LVGGPL-FRIKYEGW 268
           S E E                     E++  + V           ++GG L F+   + W
Sbjct: 155 SLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEW 214

Query: 269 QFFLLYCGCKSLESQM--MEMENEPTALLFCSIFELPLYLKFCCFYLCVFYGNLEISTRQ 326
           +  L     + L +++   +  NE  ++L  S   LP++LK C  YL +F  +  I   Q
Sbjct: 215 EHVL-----EQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQ 269

Query: 327 LYQLWMAEGFV 337
           L +LW+AEGFV
Sbjct: 270 LIKLWIAEGFV 280

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 758
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
KOG4237498 consensus Extracellular matrix protein slit, conta 99.34
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.31
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.28
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.83
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.77
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.76
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.7
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.65
KOG4341483 consensus F-box protein containing LRR [General fu 98.62
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.45
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.42
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.4
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
PLN03150623 hypothetical protein; Provisional 98.17
PLN03150623 hypothetical protein; Provisional 98.12
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.84
KOG4341483 consensus F-box protein containing LRR [General fu 97.82
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.48
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.43
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.25
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.82
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.31
PRK04841 903 transcriptional regulator MalT; Provisional 95.21
cd01128249 rho_factor Transcription termination factor rho is 95.18
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.09
PRK09376416 rho transcription termination factor Rho; Provisio 94.81
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.45
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.17
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.14
PF05729166 NACHT: NACHT domain 92.99
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.58
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 91.89
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 91.67
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.25
TIGR00767415 rho transcription termination factor Rho. Members 90.71
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.73
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 89.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.79
smart0037026 LRR Leucine-rich repeats, outliers. 88.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.57
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 87.95
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 87.89
PRK05564313 DNA polymerase III subunit delta'; Validated 87.69
PF13173128 AAA_14: AAA domain 87.62
smart0037026 LRR Leucine-rich repeats, outliers. 84.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.78
KOG2543438 consensus Origin recognition complex, subunit 5 [R 83.9
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 80.91
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-69  Score=620.97  Aligned_cols=643  Identities=25%  Similarity=0.341  Sum_probs=459.9

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhhhcc--cccc-cc--CCCCcccccccccceeecchhhHHHHHHHhcCCCCCCCccccC
Q 045237           48 LSEIEIITTLLRDYKSDINRLLIQLW--NVEE-DV--DRPDVLSILNDINYFVYESEKAIDTFFTTIMQPQSSESESEST  122 (758)
Q Consensus        48 ~~~~~~~~~~l~~i~~~~~~~~~~~~--~~~~-~~--~~~~~~s~~~~~~~~v~Gr~~~~~~i~~~L~~~~~~~~~~~~~  122 (758)
                      ...+..+.+++.++...+..+..+..  .+.. ..  ...++.+...+..   +|.+..++++++.|++...    ...+
T Consensus       111 ~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~---VG~e~~~~kl~~~L~~d~~----~iv~  183 (889)
T KOG4658|consen  111 VSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD---VGLETMLEKLWNRLMEDDV----GIVG  183 (889)
T ss_pred             hhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc---ccHHHHHHHHHHHhccCCC----CEEE
Confidence            34444455556666666666554331  1111 11  1122333333322   5999999999999988543    2344


Q ss_pred             cceehHHH----HHHHhCccc-ccccCCeeEEEEECCCCCHHHHHHHHHHhhCCCCCCccccCchhhhHHHHHHHhcCCC
Q 045237          123 SYKDALVG----LQKAFNSNH-VKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGLSEIIGKDYTLKKSILRDYLTNK  197 (758)
Q Consensus       123 ~~~~~ivG----a~~vy~~~~-~~~~F~~~~wv~vs~~~~~~~i~~~i~~~l~~~~~~~~~~~~~~~~~~~~l~~~L~~k  197 (758)
                      ++++|+||    |+.|||+.. ++.+||.++||+||+.|+..+|+++|+..++.....+. ....++++ ..|.+.|++|
T Consensus       184 i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~-~~~~~~~~-~~i~~~L~~k  261 (889)
T KOG4658|consen  184 IYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWE-DKEEDELA-SKLLNLLEGK  261 (889)
T ss_pred             EECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccc-hhhHHHHH-HHHHHHhccC
Confidence            45556666    899999987 99999999999999999999999999999988443211 12347888 9999999999


Q ss_pred             eEEEEEeCCCChhhHHHHHhhCCCCCCCcEEEEEeCCccc---------------cCc---ccc-------------cch
Q 045237          198 KYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDI---------------LTS---FEL-------------ENG  246 (758)
Q Consensus       198 r~LlVLDDvw~~~~w~~l~~~~~~~~~gS~iivTTR~~~v---------------L~~---~~l-------------~~~  246 (758)
                      ||+|||||||+..+|+.++.|+|...+||||++|||++.|               |..   |++             +.+
T Consensus       262 rfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i  341 (889)
T KOG4658|consen  262 RFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDI  341 (889)
T ss_pred             ceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccH
Confidence            9999999999999999999999999999999999999999               333   777             447


Q ss_pred             hhhcccc-----------cccccccc-ccccccchhhhhhccccchhhhhh----cCCCchhHHHhhccCCcchhHHHHH
Q 045237          247 EKIGSDS-----------VLVGGPLF-RIKYEGWQFFLLYCGCKSLESQMM----EMENEPTALLFCSIFELPLYLKFCC  310 (758)
Q Consensus       247 ~~i~~~i-----------~~~g~~L~-~~~~~~W~~~~~~~~l~~l~~~~~----~~~~~i~~~L~~Sy~~L~~~~k~cF  310 (758)
                      +++|+++           +++|+.|+ |.+.++|+++     .+.+.+...    +.++.|+++|++|||.||+++|.||
T Consensus       342 ~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~-----~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CF  416 (889)
T KOG4658|consen  342 EELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRA-----LNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCF  416 (889)
T ss_pred             HHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHH-----HccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHH
Confidence            8888888           89999999 8889999999     888877743    2237899999999999998899999


Q ss_pred             hHhcccCCCceeeHhHHHHHHHHcCCCC-----CChHHHHHHHHHHHHhCccccccccCCCCCeeEEEcCHHHHHHHHHH
Q 045237          311 FYLCVFYGNLEISTRQLYQLWMAEGFVA-----HNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVL  385 (758)
Q Consensus       311 l~~a~Fp~~~~i~~~~Li~~w~a~g~i~-----~~~~~~~~~~~~~Lv~~sll~~~~~~~~~~~~~~~mHdli~dla~~i  385 (758)
                      +|||+||+||+|+++.||.+|+|+||++     ..+++.|++|+.+||+++|++.....  ++...|+|||++||||.++
T Consensus       417 LycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~i  494 (889)
T KOG4658|consen  417 LYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWI  494 (889)
T ss_pred             HhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHH
Confidence            9999999999999999999999999997     67789999999999999999987754  5567999999999999999


Q ss_pred             hc-----ccCeEEEeCC-----CcccCCCceeEEEeeCCCCccccccccc-cccceEEeccccC-CcchhhhhHHHhccC
Q 045237          386 AA-----KMKFVMVLDL-----GLVEELRTIKRFAVPKNLTKFVSLEHID-TYLHSLQNFALES-DHSALLDCENICKKF  453 (758)
Q Consensus       386 ~~-----~e~~~~~~~~-----~~~~~~~~~r~Ls~~~~~~~~~~~~~~~-~~Lr~L~~~~~~~-~~~~~~~~~~~~~~l  453 (758)
                      ++     +++++...+.     .....+..+||+++. +........... +++++|.+..+.. ..   .....+|..|
T Consensus       495 as~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~-~~~~~~~~~~~~~~~L~tLll~~n~~~l~---~is~~ff~~m  570 (889)
T KOG4658|consen  495 ASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLM-NNKIEHIAGSSENPKLRTLLLQRNSDWLL---EISGEFFRSL  570 (889)
T ss_pred             hccccccccceEEECCcCccccccccchhheeEEEEe-ccchhhccCCCCCCccceEEEeecchhhh---hcCHHHHhhC
Confidence            99     6775554431     122356788999999 555555666666 8899999999863 11   5677889999


Q ss_pred             CeeEEEEcCCCC-CCCCCccccCcccccEEeccCCCCcccCccccCCCCCcEEEccCC-cCcccchhhcccccCcEEEcC
Q 045237          454 KLLRVLNMGSLV-LDQFPSGIENLFLLRCLKLDVPSLKSLPSSLCNLLNLQTLDMPSS-YIDHTPEDIWNMHKLMHLNFG  531 (758)
Q Consensus       454 ~~Lr~L~L~~~~-l~~lp~~i~~l~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~-~l~~lp~~i~~l~~L~~L~l~  531 (758)
                      +.||+|||++|. +..+|.+|++|.|||||+++++.+..+|..+++|..|.+|++..+ .+..+|.....|++|++|.+.
T Consensus       571 ~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~  650 (889)
T KOG4658|consen  571 PLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLP  650 (889)
T ss_pred             cceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEee
Confidence            999999999876 779999999999999999999999999999999999999999999 666667767779999999887


Q ss_pred             CCC--CCCCCCCccccCcccccccccCCCCCCccccCCCCCCCe----EEEEecCchhhhhHHHHhhccCCCceEEeeec
Q 045237          532 CIT--LPAPPENYCSSLKNLIFISALHPCSCTPDTLGRLPNVQT----LKIYGDLSSYQSGLSKSLRELLKLESLKLVNK  605 (758)
Q Consensus       532 ~~~--~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~----L~l~~~~~~~~~~l~~~l~~~~~L~~L~L~~~  605 (758)
                      ...  .....++.+.+|++|....+..........+..+..|.+    +.+.++   .....+..+..+.+|+.|.+..+
T Consensus       651 ~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~---~~~~~~~~~~~l~~L~~L~i~~~  727 (889)
T KOG4658|consen  651 RSALSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGC---SKRTLISSLGSLGNLEELSILDC  727 (889)
T ss_pred             ccccccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhccc---ccceeecccccccCcceEEEEcC
Confidence            621  111123334444444443333322112222333333332    222111   23334445555666666666553


Q ss_pred             CCC------------cc-cccc------------cCCcCCCCCCccEEEEeeccCCCCCcccccCCCCCceEEEeccccC
Q 045237          606 SKG------------WQ-LSQM------------ILSEYQFPPSLTQLSLSNTELKEDPMPTLEKLPHLLVLKLKQNSYS  660 (758)
Q Consensus       606 ~~~------------~~-~~~l------------lp~~~~l~~~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~L~~n~~~  660 (758)
                      ...            .. +..+            .+....++++|+.|.+..|....++++....+..++.+.+..+.+.
T Consensus       728 ~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~  807 (889)
T KOG4658|consen  728 GISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLE  807 (889)
T ss_pred             CCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhhhcccEEecccccc
Confidence            210            00 0001            1211234589999999988877777777777777777666655555


Q ss_pred             CceeEEeCCCCCccccEEeeccCCCcCceEECc----ccccccceeeEecc-ccCCCCch
Q 045237          661 GRKLACVGSGGFPKLKILHLKSMFWLEEWTMGA----RAMTKLESLIINPC-AYLKKLPE  715 (758)
Q Consensus       661 ~~~~~~~~~~~~~~L~~L~L~~~~~l~~l~~~~----~~l~~L~~L~l~~c-~~l~~lp~  715 (758)
                      +...... .++|+++..+.+..-. ++.|....    +.+|.+.++.+.+| +.+...|+
T Consensus       808 ~l~~~~~-l~~l~~i~~~~l~~~~-l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~  865 (889)
T KOG4658|consen  808 GLRMLCS-LGGLPQLYWLPLSFLK-LEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPD  865 (889)
T ss_pred             cceeeec-CCCCceeEecccCccc-hhheehhcCcccccCccccccceeccccceeecCC
Confidence            5421221 4555555555554422 33333222    44444445555544 33334443

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query758
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 2e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  101 bits (253), Expect = 2e-22
 Identities = 45/291 (15%), Positives = 93/291 (31%), Gaps = 66/291 (22%)

Query: 132 QKAFNSNHVK--FYFDCRAWVRVSIQYNFKKI--LDDIIKSVMPASGLSEIIGKDYTLKK 187
            +A   + +    +     WV V  Q     +  L ++   +      S+ +  +    K
Sbjct: 165 AEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAK 224

Query: 188 SILRDYLTNK--KYMTVLDDIYHDMIWNDLREALPDYQNGSRVLIT-------------- 231
             LR  +  K  + + +LDD+     W+     L  + +  ++L+T              
Sbjct: 225 DRLRILMLRKHPRSLLILDDV-----WDS--WVLKAFDSQCQILLTTRDKSVTDSVMGPK 277

Query: 232 --VVDPDILT---SFEL---------ENGEKIGSD-----------SVLVGGPLFRIKYE 266
             V     L      E+          +  +                 L+G  L R    
Sbjct: 278 YVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGA-LLRDFPN 336

Query: 267 GWQFFLLYCGCKSLESQMMEMENEPTAL---LFCSIFELPLYLKFCCFYLCVFYGNLEIS 323
            W+++L     K  +        +  AL   +  S+  L   +K     L +   ++++ 
Sbjct: 337 RWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVP 396

Query: 324 TRQLYQLWMAEGFVAHNSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSV 374
           T+ L  LW  E           E+ L+E +++ L+   +    GK     +
Sbjct: 397 TKVLCILWDMETEE-------VEDILQEFVNKSLLFCDRN---GKSFRYYL 437
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query758
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.68
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.55
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.41
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.3
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.29
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.26
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.22
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.2
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.1
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.95
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.92
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.9
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.8
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.78
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.77
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.53
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.41
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.39
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.78
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.65
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.63
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.87
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.53
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.09
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.81
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.27
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.83
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.79
2fna_A357 Conserved hypothetical protein; structural genomic 94.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.57
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.94
2chg_A226 Replication factor C small subunit; DNA-binding pr 91.28
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 88.43
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 81.66
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-34  Score=324.55  Aligned_cols=267  Identities=17%  Similarity=0.208  Sum_probs=200.2

Q ss_pred             ecchhhHHHHHHHhcCCCCCCCccccCcceehHHH---------HHHHhC--cccccccCCeeEEEEECCCC--CHHHHH
Q 045237           96 YESEKAIDTFFTTIMQPQSSESESESTSYKDALVG---------LQKAFN--SNHVKFYFDCRAWVRVSIQY--NFKKIL  162 (758)
Q Consensus        96 ~Gr~~~~~~i~~~L~~~~~~~~~~~~~~~~~~ivG---------a~~vy~--~~~~~~~F~~~~wv~vs~~~--~~~~i~  162 (758)
                      |||++++++|.++|.....      ..+++++|+|         |++||+  |.+++.+|++++||+|++.+  ++.+++
T Consensus       131 ~GR~~~~~~l~~~L~~~~~------~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~  204 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCD------LDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLF  204 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTT------SSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccC------CCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHH
Confidence            5999999999999965321      1233444444         899998  78999999999999999985  899999


Q ss_pred             HHHHHhhCCCCC---Ccc-ccCchhhhHHHHHHHhcCCC-eEEEEEeCCCChhhHHHHHhhCCCCCCCcEEEEEeCCccc
Q 045237          163 DDIIKSVMPASG---LSE-IIGKDYTLKKSILRDYLTNK-KYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDI  237 (758)
Q Consensus       163 ~~i~~~l~~~~~---~~~-~~~~~~~~~~~~l~~~L~~k-r~LlVLDDvw~~~~w~~l~~~~~~~~~gS~iivTTR~~~v  237 (758)
                      ++|+++++....   .+. +..+.+.++ ..+++.|++| ||||||||||+..++ .+..     .+||+||||||++.|
T Consensus       205 ~~il~~l~~~~~~~~~~~~~~~~~~~l~-~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v  277 (549)
T 2a5y_B          205 TDILLMLKSEDDLLNFPSVEHVTSVVLK-RMICNALIDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEI  277 (549)
T ss_dssp             HHHHHHHTTTSCCTTCCCCTTCCHHHHH-HHHHHHHTTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGG
T ss_pred             HHHHHHHhcCcccccccccccccHHHHH-HHHHHHHcCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHH
Confidence            999999987532   110 112445678 8999999996 999999999998765 2221     179999999999877


Q ss_pred             ---------------cCc---ccc-----------cchhhhcccc-----------ccccccccccccccchhhhhhccc
Q 045237          238 ---------------LTS---FEL-----------ENGEKIGSDS-----------VLVGGPLFRIKYEGWQFFLLYCGC  277 (758)
Q Consensus       238 ---------------L~~---~~l-----------~~~~~i~~~i-----------~~~g~~L~~~~~~~W~~~~~~~~l  277 (758)
                                     |++   |+|           +++.+++.+|           +++|+.|+..   .|..+..   +
T Consensus       278 ~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~---~w~~~~~---l  351 (549)
T 2a5y_B          278 SNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK---TFEKMAQ---L  351 (549)
T ss_dssp             GGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS---SHHHHHH---H
T ss_pred             HHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccc---hHHHHHH---h
Confidence                           222   333           2334455555           7788888733   2433300   3


Q ss_pred             cchhhhhhcCCCchhHHHhhccCCcchhHHHHHh-----------HhcccCCCceeeHhHHHHHHHHc--CCCC-----C
Q 045237          278 KSLESQMMEMENEPTALLFCSIFELPLYLKFCCF-----------YLCVFYGNLEISTRQLYQLWMAE--GFVA-----H  339 (758)
Q Consensus       278 ~~l~~~~~~~~~~i~~~L~~Sy~~L~~~~k~cFl-----------~~a~Fp~~~~i~~~~Li~~w~a~--g~i~-----~  339 (758)
                      ....+..  ...++.++|++||++||+++|.||+           |||+||+++.|+    +++|+|+  ||+.     .
T Consensus       352 ~~~l~~~--~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~  425 (549)
T 2a5y_B          352 NNKLESR--GLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQ  425 (549)
T ss_dssp             HHHHHHH--CSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CC
T ss_pred             HHHhhcc--cHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCC
Confidence            3222221  2478999999999999999999999           999999999999    8999999  9996     3


Q ss_pred             ChHHHHHHHHHHHHhCccccccccCCCCCeeEEEcCHHHHHHHHHHhcccCe
Q 045237          340 NSEANAEEYLKELISRGLIKVGKRSAGGKIKTCSVPSSVWARLVVLAAKMKF  391 (758)
Q Consensus       340 ~~~~~~~~~~~~Lv~~sll~~~~~~~~~~~~~~~mHdli~dla~~i~~~e~~  391 (758)
                      ..+++++ ||++|+++||++....+   ...+|+|||++|++|+.++.++++
T Consensus       426 ~~~~~~~-~l~~L~~rsLl~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          426 LDDEVAD-RLKRLSKRGALLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             CTHHHHH-HHHHTTTBSSCSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             CHHHHHH-HHHHHHHcCCeeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence            3677777 99999999999987643   335899999999999999887653
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 758
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 3e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 47.5 bits (112), Expect = 3e-06
 Identities = 19/117 (16%), Positives = 36/117 (30%), Gaps = 14/117 (11%)

Query: 132 QKAFNSNH--VKFYFDCRAWVRVSIQYNFKKILDDIIKSVMPASGL------SEIIGKDY 183
            +A + +   +   +D   W++ S               +M  S        S       
Sbjct: 62  SQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSV 121

Query: 184 TLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDILTS 240
            LK+ I    +     + V DD+  +      +E         R L+T  D +I  +
Sbjct: 122 VLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNA 172
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query758
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.65
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.02
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.91
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.85
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.74
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.39
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.62
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 85.68
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.90  E-value=1.1e-24  Score=221.48  Aligned_cols=204  Identities=15%  Similarity=0.105  Sum_probs=143.6

Q ss_pred             eeecchhhHHHHHHHhcCCCCCCCccccCcceehHHH----HHHHhCccc--ccccCCeeEEEEECCCCCHHHHHHHHHH
Q 045237           94 FVYESEKAIDTFFTTIMQPQSSESESESTSYKDALVG----LQKAFNSNH--VKFYFDCRAWVRVSIQYNFKKILDDIIK  167 (758)
Q Consensus        94 ~v~Gr~~~~~~i~~~L~~~~~~~~~~~~~~~~~~ivG----a~~vy~~~~--~~~~F~~~~wv~vs~~~~~~~i~~~i~~  167 (758)
                      .+|||+.++++|+++|....+.. ...-.++.+|.+|    |++||++..  ++.+|++++||+|++.++...+...+..
T Consensus        21 ~~~gR~~~~~~i~~~L~~~~~~~-~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~   99 (277)
T d2a5yb3          21 TCYIREYHVDRVIKKLDEMCDLD-SFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDI   99 (277)
T ss_dssp             CSCCCHHHHHHHHHHHHHHTTSS-SEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred             ceeCcHHHHHHHHHHHHhccCCC-ceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHH
Confidence            46799999999999996532211 1111122222223    899998644  7788999999999999998877766655


Q ss_pred             hhC---CCC--CCcccc--CchhhhHHHHHHHhcCCCeEEEEEeCCCChhhHHHHHhhCCCCCCCcEEEEEeCCcccc--
Q 045237          168 SVM---PAS--GLSEII--GKDYTLKKSILRDYLTNKKYMTVLDDIYHDMIWNDLREALPDYQNGSRVLITVVDPDIL--  238 (758)
Q Consensus       168 ~l~---~~~--~~~~~~--~~~~~~~~~~l~~~L~~kr~LlVLDDvw~~~~w~~l~~~~~~~~~gS~iivTTR~~~vL--  238 (758)
                      .+.   ...  ..+...  ....... ..+.+.+.+||+|+||||||+..+|+.+..      .|||||||||+++|+  
T Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~  172 (277)
T d2a5yb3         100 LLMLKSEDDLLNFPSVEHVTSVVLKR-MICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNA  172 (277)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHH-HHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGG
T ss_pred             HHHHhcchhhcCCccchhhhhHHHHH-HHHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHh
Confidence            442   211  111111  1233344 568889999999999999999999987653      489999999999882  


Q ss_pred             -------------Cc---ccc-----------cchhhhcccc-----------ccccccccccccccchhhhhhccccch
Q 045237          239 -------------TS---FEL-----------ENGEKIGSDS-----------VLVGGPLFRIKYEGWQFFLLYCGCKSL  280 (758)
Q Consensus       239 -------------~~---~~l-----------~~~~~i~~~i-----------~~~g~~L~~~~~~~W~~~~~~~~l~~l  280 (758)
                                   +.   |+|           +..++++++|           +++|+.|+.++.+.|.+.     .+.+
T Consensus       173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~-----~~~L  247 (277)
T d2a5yb3         173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQL-----NNKL  247 (277)
T ss_dssp             CCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHH-----HHHH
T ss_pred             cCCCCceEECCCCCHHHHHHHHHHHhCCccCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHH-----HHHH
Confidence                         21   333           2334455555           889999996677888888     6655


Q ss_pred             hhhhhcCCCchhHHHhhccCCcchhHHHHHhHh
Q 045237          281 ESQMMEMENEPTALLFCSIFELPLYLKFCCFYL  313 (758)
Q Consensus       281 ~~~~~~~~~~i~~~L~~Sy~~L~~~~k~cFl~~  313 (758)
                      ...   ...++.+++.+||++||+++|+||-++
T Consensus       248 ~~~---~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         248 ESR---GLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHH---CSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             hcC---cHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            443   237899999999999999999999763
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure