Citrus Sinensis ID: 045318

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------139

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKLIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPATSLVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHcHHHHccccccEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHccccEEEcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccEEccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEcccccEEEcHHHHHHHHHHHHcccEEEEccccccccccccccEEEEEEEcccccccccccccccccccEEEEEcccccccccccHHHHHHccccccEEEEEEcccccccccccccccccccEEEcccccccccccHHHccccccEEEcccccccccccHHccccccccEEEEccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEEEcccccccccccHHHHHcccccccccccEEEEcccccccccccccccccccEEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccEEEEEcccccccccHHHcccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEccEEc

ccHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHcccccccccccEEEEEEEccccccHHHHHHHHHccHHHHHHccEEEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHccEEEEEEccccccccccccccEEEEEEEccccccEcccccHHHHHHccEEEccccccccccccHHHHHHHHHcccEEEEEEccccccccccccccccHEEEEEcccccccccccccccHHHHHHEEHcccHHHHHccHHHcccccccEEEccccccHHcccccccccHcccEccEEEEcccccccHHHHHHHHHcccEEEEccccccccHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEEcccHHHHHcccccccccccccccccEEEEccccHHHHccccccccccEEEEcccccccccccccccccEEEEccccccEccccccccccccEEcccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEcccccHHcccHcccccccccEEEEcccccHccccHHcccccccccEEEEEcccccccccccccccccccEEEEcccccHcccccHHHHccccccccccHHHccccccccEEEEcccccHHHccccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccEEccccccccccccccccEEEEcccccHcccccHcccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccEEEEEcccccHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEccEEc

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVlddadekqMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKliptcctnrgprslafnssmRSKIDEISSRLQDIVTEKEqldlkenpssrgrFKKVIQerlpatslvneaevhgrdddKKAIVELLLNddlnadcdgglfvipivgmgglgkTTLAQLVYNDHmveshfdlkawtcvsddfdaIKVTKAILRSICMhtdadddlNSLQVKLKDGLSRKKFLLVLDDMwndnygdwtslrlpfvagasgskiIVTTRNQSVASMMGSVSayelkkltdddcrlvftqhslgtkdfsnhQHLKEIGEEILKKCNGLPLAAKTlggllrgksnpfdwrNVLNNKiwnlpeeggDIMRALKNDVVLVWMAegllepdtsemkMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENtlegnkqqkfsknlrhfsypighfdhirrfeaisdckhLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREynickisntigdlkhlrhldLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGnliklrhlnnynvpllegmplrighlsclqtlpyfvvgkntgsQLRELKFLENLQVKLKISrlenvkdsgdardaelngkrNLDVLFLEwtnssgssrepetekHVLDMLRPHENLKQLAIRGygganfpiwlgdstfsnlellrfencamctslpsigqlpalkhLSIIGMALVKSVGlqfygnsgtvsfpsletlffgdmpewedwiphqpsqevevfpqlqELSLVRCSKLLgrlpehlpslKTLVIQECEQLLvtvpsiptlckleiggckkvvwgstdlsslnsmvssnvpnqVFLTgllnqelpiLEELAICNTKVTYLWQTgsgllqdisslhkleigncpellSLVAAEEADqqqqglpcrlhylelrscpslvklpqtLLSLSSLRQLkisechsmkslpealmhndnapleslnvvdcnsltyiarvqlppslkllhIQSCHDLRTLIdedqisgmkkdgdipsgsssytcllerlhiedcpsltslfslkglpatledikvknCSKLLFLSKRGALPKVLKDLYIYECSELESIaegldndssvetiTFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLiqdcpslgsftadcfptkvsalgidyltihkpffelGLRRFTSLRELRLyggsrdvvafppedtkmalpasltflwidnfpnllrlssIENLTslqflrfrncpkleyfpenglptsLLRLQIIACPLMkerckkekghywpliadlpsveidficv

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHavlddadekqMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEkqhhetntsmlrkliptcCTNRGPRslafnssmrsKIDEISSRLQDIVTekeqldlkenpssrgrfkkviqerlpatslvneaevhgrdddKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHslgtkdfsnhQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGllepdtsemkMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKIsntigdlkhlRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKlkisrlenvkdsgdardaelngkrnldVLFLEwtnssgssrepeTEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLlflskrgalpkvLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGsrdvvafppeDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHywpliadlpsveiDFICV

MSiigeailgaaieMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKLIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPATSLVNEAEVHGRDDDKKAIVElllnddlnadcdgglFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMllklqclrvlclrEYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDlsslnsmvssnvPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTllslsslRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

**IIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRR**************MLRKLIPTCCTN**********************************************************************KKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLE***********GRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRL*****************RNLDVLFLEWT********************PHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECH*************NAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDED****************SYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFIC*

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALR*******************LIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLD************************VNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSIC***********LQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLG********HLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLE**K*QKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSG******TEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQT*SGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKLIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPATSLVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTN************HVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQ****NTSMLRKLIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLK*********************LVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKLIPTCCTNRGPRSLAFNSSMRSKxxxxxxxxxxxxxxxxxxxxxENPSSRGRFKKVIQERLPATSLVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALKNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVTYLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKISECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIARVQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQFSIEILLIQDCPSLGSFTADCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSSIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEIDFICV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1388	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.617	0.813	0.391	1e-171
Q9LRR5		1424	Putative disease resistan	no	no	0.923	0.900	0.319	1e-159
Q7XA42		979	Putative disease resistan	N/A	no	0.642	0.911	0.325	1e-127
Q7XA39		988	Putative disease resistan	N/A	no	0.656	0.922	0.324	1e-125
Q7XA40		992	Putative disease resistan	N/A	no	0.650	0.910	0.323	1e-124
Q7XBQ9		970	Disease resistance protei	N/A	no	0.650	0.930	0.330	1e-123
Q38834		852	Disease resistance RPP13-	no	no	0.509	0.829	0.277	3e-51
Q8W3K3		910	Putative disease resistan	no	no	0.574	0.875	0.253	8e-47
P0DI18		1049	Probable disease resistan	no	no	0.662	0.877	0.250	3e-45
P0DI17		1049	Probable disease resistan	no	no	0.662	0.877	0.250	3e-45

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  604 bits (1557), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 367/937 (39%), Positives = 545/937 (58%), Gaps = 80/937 (8%)

Query: 1   MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADL-KKWERILFKIHAVLDDADEKQ 59
           M+ IGE  L A ++ LF+ L+S     F ++ ++  +L ++    L  I AVL DA+EKQ
Sbjct: 1   MTGIGEMFLAAFLQALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQ 60

Query: 60  MTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETNTSMLRKLIPTCCTN 119
           +T   V  W+ EL+++ Y  ED LD+ +TEALR  +  E     ++++ LR+L       
Sbjct: 61  ITNPVVEKWVNELRDVVYHAEDALDDIATEALRLNIGAES----SSSNRLRQL------- 109

Query: 120 RGPRSLA-----FNSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPA 174
           RG  SL       +  + +++++++ RL+ + +++  L LKE  +       + ++RLP 
Sbjct: 110 RGRMSLGDFLDGNSEHLETRLEKVTIRLERLASQRNILGLKELTA------MIPKQRLPT 163

Query: 175 TSLVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDH 234
           TSLV+E+EV GRDDDK  I+  L+ ++     D G+ V+ IVG+GG+GKTTL+QL+YND 
Sbjct: 164 TSLVDESEVFGRDDDKDEIMRFLIPEN---GKDNGITVVAIVGIGGVGKTTLSQLLYNDQ 220

Query: 235 MVESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRK--KFL 292
            V S+F  K W  VS++FD  K+TK +  S+        DL+ LQVKLK+ L+     FL
Sbjct: 221 HVRSYFGTKVWAHVSEEFDVFKITKKVYESVTSRPCEFTDLDVLQVKLKERLTGTGLPFL 280

Query: 293 LVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSAYELKKLTDDDCR 352
           LVLDD+WN+N+ DW  LR PF+  A GS+I+VTTR+Q VAS+M +V  + L+ L+D DC 
Sbjct: 281 LVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCW 340

Query: 353 LVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNK 412
            +F +   G ++   ++ + ++ E I+ KC GLPLA KTLGG+LR +    +W  VL+++
Sbjct: 341 SLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSR 400

Query: 413 IWNLPEEGGDIMRAL----------------------------KNDVVLVWMAEGLLEPD 444
           IW+LP +  +++  L                            K+ VVL+WMAEG L+  
Sbjct: 401 IWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQT 460

Query: 445 TSEMKMEELGRSYFRELHSRSFFQKSYMDSRFIMHDLITDLAQWAASDSYFRLENTLEGN 504
            S   +EELG  YF EL SRS  QK+   +R+IMHD I +LAQ+A+ +   + E   +G 
Sbjct: 461 RSSKNLEELGNEYFSELESRSLLQKT--KTRYIMHDFINELAQFASGEFSSKFE---DGC 515

Query: 505 KQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQWT-FSRHFLSDSVV--HML 561
           K Q  S+  R+ SY   ++     FEA+ + K LRTF+ +  T  SR    D +V   +L
Sbjct: 516 KLQ-VSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSCCLDQMVSEKLL 574

Query: 562 LKLQCLRVLCLREYNICKIS-NTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLES 620
             L  LRVL L  Y I ++  +   ++ H R LDLS T +E LP+S+  +YNL TLLL  
Sbjct: 575 PTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSY 634

Query: 621 CSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLREL 680
           CS LK+L  D+ NLI LR+L+     L + MP R G L  LQTL  F V  + GS++ EL
Sbjct: 635 CSSLKELPTDISNLINLRYLDLIGTKLRQ-MPRRFGRLKSLQTLTTFFVSASDGSRISEL 693

Query: 681 KFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSS------REPET 734
             L +L  KLKI  L+ V D  DA +A LN K++L  +   W   S SS         + 
Sbjct: 694 GGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQN 753

Query: 735 EKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLP 794
           E  V + LRPH ++++LAI  Y G  FP WL D +FS +  +R   C  CTSLPS+GQLP
Sbjct: 754 EAEVFEKLRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLP 813

Query: 795 ALKHLSIIGMALVKSVGLQFYGNSGTVS------FPSLETLFFGDMPEWEDWIPHQPSQE 848
            LK L I GM  ++S+G +FY +   +       F SLETL F ++P+W++W+  + ++ 
Sbjct: 814 CLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRG 873

Query: 849 VEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQEC 885
            ++FP L++L ++RC +L G LP  LPSL +L I +C
Sbjct: 874 -DLFPSLKKLFILRCPELTGTLPTFLPSLISLHIYKC 909

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q8W3K3\|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1388
225449649		1418	PREDICTED: putative disease resistance p	0.951	0.930	0.425	0.0
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.958	0.934	0.425	0.0
359495024		1390	PREDICTED: putative disease resistance p	0.940	0.938	0.409	0.0
147862409		1466	hypothetical protein VITISV_042289 [Viti	0.899	0.851	0.418	0.0
225450019		1394	PREDICTED: putative disease resistance p	0.940	0.936	0.403	0.0
147766392		1471	hypothetical protein VITISV_007674 [Viti	0.939	0.886	0.403	0.0
225450023		1396	PREDICTED: putative disease resistance p	0.937	0.931	0.401	0.0
359495026		2204	PREDICTED: uncharacterized protein LOC10	0.927	0.583	0.407	0.0
147860511		1406	hypothetical protein VITISV_014536 [Viti	0.908	0.896	0.410	0.0
359487416		1472	PREDICTED: putative disease resistance p	0.940	0.887	0.401	0.0

>gi\|225449649\|ref\|XP_002262753.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1482 (42%), Positives = 872/1482 (58%), Gaps = 162/1482 (10%)

Query: 1    MSIIGEAILGAAIEMLFKKLMSADLLQFARQEQIQADLKKWERILFKIHAVLDDADEKQM 60
            M  +G A+L A   +LF KL SADL  FAR+EQI ++LKKWE+ L KI+AVLDDA+EKQM
Sbjct: 1    MDAVGGAVLSALFGVLFDKLTSADL-TFARREQIHSELKKWEKTLMKINAVLDDAEEKQM 59

Query: 61   TKQSVRLWLRELKNLAYDVEDILDEFSTEA-LRRQLLEEKQHHETNTSMLRKLIPTCCTN 119
            + + V++WL EL++LAYD +DILDEF+T+A LR  L+ E Q    + S +  LIPTCCT 
Sbjct: 60   SNRFVKIWLSELRDLAYDADDILDEFATQAALRPNLISESQ---GSPSKVWSLIPTCCTT 116

Query: 120  R-GPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLKE--NPSSRGRFKKVIQERLPATS 176
               P    FN  M SKI +I++RL DI T + +L L++   P S         +R P T 
Sbjct: 117  LISPTDFMFNVEMGSKIKDITARLMDISTRRIELGLEKVGGPVS-------TWQRPPTTC 169

Query: 177  LVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMV 236
            LVNE  V+GRD D+K IV+LLL D      +  + V+PIVGMGG+GKTTLA+LV+ND  +
Sbjct: 170  LVNEPCVYGRDKDEKMIVDLLLRD---GGSESKVGVVPIVGMGGVGKTTLARLVFNDETI 226

Query: 237  ESHFDLKAWTCVSDDFDAIKVTKAILRSICMHTDADDDLNSLQVKLKDGLSRKKFLLVLD 296
            + +F L++W CVSD+FD I++TKAIL SI   T A  DLN LQVKL D L+ K+FLLVLD
Sbjct: 227  KQYFTLRSWVCVSDEFDIIRITKAILDSITSQTTALSDLNQLQVKLSDALAGKRFLLVLD 286

Query: 297  DMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMM-GSVSAYELKKLTDDDCRLVF 355
            D+WN NYGDW  LR PF  GA+GSKIIVTTR+  VA MM GS + + +K L+ DDC  VF
Sbjct: 287  DVWNKNYGDWVLLRSPFSTGAAGSKIIVTTRDAEVARMMAGSDNYHYVKALSYDDCWSVF 346

Query: 356  TQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWN 415
             QH+   ++   H  L+ IG++I++KC GLPLAAKTLGGLLR KS   +W +VL +KIWN
Sbjct: 347  VQHAFENRNICAHPSLEVIGKKIVQKCGGLPLAAKTLGGLLRSKSKDDEWEDVLYSKIWN 406

Query: 416  LPEEGGDIMRAL----------------------------KNDVVLVWMAEGLLEPDTSE 447
             P++  DI+ AL                            K ++VL+WMAEGL++     
Sbjct: 407  FPDKESDILPALRLSYHYLPSHLKRCFAYCSIFPKDYEFDKKELVLLWMAEGLIQQSPKG 466

Query: 448  MK-MEELGRSYFRELHSRSFFQKSYMD-SRFIMHDLITDLAQWAASDSYFRLENTLEGNK 505
             K ME++G  YF EL SRSFFQ S  + SRF+MHDLI DLAQ+ + +  F LE++L+ N+
Sbjct: 467  KKQMEDMGSDYFCELLSRSFFQLSSCNGSRFVMHDLINDLAQYVSEEICFHLEDSLDSNQ 526

Query: 506  QQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVS--VQWTFSRHF-LSDSVVHMLL 562
            +  FS ++RH S+    ++  R+FE     K+LRTF++  +   +   F L+D V H LL
Sbjct: 527  KHTFSGSVRHSSFARCKYEVFRKFEDFYKAKNLRTFLALPIHMQYYDFFHLTDKVSHDLL 586

Query: 563  -KLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESC 621
             KL+ LRVL L  Y I ++ N+IGDLKHLR+L+LS T+I+ LP+S++ L+NL TL+L  C
Sbjct: 587  PKLRYLRVLSLSHYEIRELPNSIGDLKHLRYLNLSCTIIQELPDSLSDLHNLQTLVLFRC 646

Query: 622  SRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELK 681
             RL +L     NLI LRHL+  +   LE MP ++G L  LQTL  F+VGK+    ++EL 
Sbjct: 647  RRLNRLPRGFKNLINLRHLDIAHTHQLEVMPPQMGKLKSLQTLSKFIVGKSKELGIKELG 706

Query: 682  FLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPET-EKHVLD 740
             L +L+ KL I  L+NV D  DARDA L  K +L+ L +EW+++     + ET E +VL 
Sbjct: 707  DLLHLRGKLSILDLQNVVDIQDARDANLKDKHHLEELLMEWSSNMFDDSQNETIELNVLH 766

Query: 741  MLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLPSIGQLPALKHLS 800
             L+P+ NLK+L I+ YGG  FP W+GD +FS +  L    C  CT LPS+G+L +LK L 
Sbjct: 767  FLQPNTNLKKLTIQSYGGLTFPYWIGDPSFSKMVCLELNYCRKCTLLPSLGRLSSLKKLC 826

Query: 801  IIGMALVKSVGLQFYGNSGTV--SFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQEL 858
            + GM  VKSVG++FYG        FPSLE L F DMPEWE+W         E +P+L+EL
Sbjct: 827  VKGMQGVKSVGIEFYGEPSLCVKPFPSLEFLRFEDMPEWEEWC------SSESYPRLREL 880

Query: 859  SLVRCSKLLGRLPEHLPSLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGS-TDLS 917
             +  C KL+ +LP HLPSL  L I +C +L+  +PS+P L  L +  C + +  S  DL+
Sbjct: 881  EIHHCPKLIQKLPSHLPSLVKLDIIDCPKLVAPLPSLPFLRDLIVAECNEAMLRSGGDLT 940

Query: 918  SLNSMVSSNVPNQVFLTGLLNQELPILEELAICN-TKVTYLWQTGSGLLQDISSLHKLEI 976
            SL ++   N+ N  FL   L + L  LE L ICN +++ +L Q+G G  +++S +  L I
Sbjct: 941  SLITLRLENISNLTFLNEGLVRFLGALEVLEICNCSELKFLLQSGVG-FENLSCIRHLVI 999

Query: 977  GNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLSLSSLRQLKIS---- 1032
              CP+L+ L        + Q LPC L YLE+  C SL KLP  L SL+SLR+L I     
Sbjct: 1000 VMCPKLVLLA-------EDQPLPCNLEYLEINKCASLEKLPIGLQSLTSLRELSIQKCPK 1052

Query: 1033 -------------------ECHSMKSLPEALMHNDN----APLESLNVVDCNSLTYIARV 1069
                               +C  ++SLP+ +M N        LE L +V C SL    R 
Sbjct: 1053 LCSLAEMDFPPMLISLELYDCEGLESLPDGMMINGENRNFCLLECLKIVHCPSLICFPRG 1112

Query: 1070 QLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSYTCLLERLHIEDCPSLTSL 1129
            +LP  LK L I  C  L++L  E  I G             +TC LE L I  CP L+S 
Sbjct: 1113 ELPSKLKELEIIDCAKLQSL-PEGLILG------------DHTCHLEFLRIHRCPLLSS- 1158

Query: 1130 FSLKGLPATLEDIKVKNCSKL-------------------LFLSKRGALP--KVLKDLYI 1168
            F    LP+T++ ++++NC +L                   L ++  G L   K L +L+I
Sbjct: 1159 FPRGLLPSTMKRLEIRNCKQLESISLLSHSTTLEYLRIDRLKINFSGCLHSLKHLIELHI 1218

Query: 1169 YECSELESIAE-GLDNDSSVETITFGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQF-S 1226
            Y CS LES  E G  + +                  L ML I+ C+ L +LP  +  F S
Sbjct: 1219 YSCSGLESFPERGFSSPN------------------LKMLHIDDCKNLKSLPLQMQSFTS 1260

Query: 1227 IEILLIQDCPSLGSFTADCFPTKVSALGI-DYLTIHKPFFELGLRRFTSLRELRLYGGSR 1285
            +  L I DCP+L SF  +     +++  I +   +  P ++ GL   TSL+   +     
Sbjct: 1261 LRDLRIYDCPNLVSFAEEGLSLNLTSFWIRNCKNLKMPLYQWGLHGLTSLQTFVI----N 1316

Query: 1286 DVVAFPPEDTKMALPASLTFLWIDNFPNLLRLSS--IENLTSLQFLRFRNCPKLEYF-PE 1342
            +V  F   D+   LP +LT+L I  F NL  LSS  ++NLTSL+ L   +CPKL+ F P+
Sbjct: 1317 NVAPFCDHDSLPLLPRTLTYLSISKFHNLESLSSMGLQNLTSLEILEIYSCPKLQTFLPK 1376

Query: 1343 NGLPTSLLRLQIIACPLMKERCKKEKGHYWPLIADLPSVEID 1384
             GL  +L  L+I  CP+++ RC+K KG  WP+I+ +P +++D
Sbjct: 1377 EGLSATLSNLRIKFCPIIEARCRKNKGEDWPMISHIPRIDMD 1418

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

>gi\|359495024\|ref\|XP_002267933.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147862409\|emb\|CAN81911.1\| hypothetical protein VITISV_042289 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450019\|ref\|XP_002272632.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] gi\|451798996\|gb\|AGF69196.1\| disease resistance protein At3g14460-like protein 3 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|147766392\|emb\|CAN67818.1\| hypothetical protein VITISV_007674 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225450023\|ref\|XP_002272823.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi\|451798994\|gb\|AGF69195.1\| disease resistance protein At3g14460-like protein 2 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359495026\|ref\|XP_003634900.1\| PREDICTED: uncharacterized protein LOC100854556 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147860511\|emb\|CAN79726.1\| hypothetical protein VITISV_014536 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487416\|ref\|XP_002272889.2\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1388
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.324	0.316	0.385	3.9e-140
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.608	0.801	0.354	4.9e-127
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.211	0.162	0.327	8.5e-72
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.229	0.374	0.300	1.1e-40
TAIR\|locus:2037639		907	AT1G58390 "AT1G58390" [Arabido	0.179	0.274	0.333	2.9e-40
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.141	0.192	0.377	4e-37
TAIR\|locus:2827038		1017	AT1G59124 "AT1G59124" [Arabido	0.141	0.192	0.377	4e-37
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.275	0.451	0.278	2.4e-36
TAIR\|locus:504956182		1049	AT1G58848 [Arabidopsis thalian	0.141	0.186	0.377	3.4e-36
TAIR\|locus:2826978		1049	AT1G59218 [Arabidopsis thalian	0.141	0.186	0.377	3.4e-36

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 727 (261.0 bits), Expect = 3.9e-140, Sum P(4) = 3.9e-140
 Identities = 182/472 (38%), Positives = 257/472 (54%)

Query:   428 KNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMD-SRFIMHDLITDLA 486
             + ++VL+WMA  LL    S  ++E++G  Y  +L ++SFFQ+  +  + F+MHDL+ DLA
Sbjct:   436 REELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLA 495

Query:   487 QWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQW 546
             +  + D  FRLE+    +   +     RHFS+     D    F +I   + LRT +    
Sbjct:   496 KAVSGDFCFRLED----DNIPEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNS 551

Query:   547 TFSRHFL--SDSVVH-MXXXXXXXXXXXXXEYNICKISNTIGDLKHLRHLDLSETLIETL 603
               S   L  ++ V++ +              Y I  +  ++  LK LR+LDLS T I+ L
Sbjct:   552 PTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTKIKEL 611

Query:   604 PESVNTLYNLHTLLLESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQT 663
             PE V TL NL TLLL +C  L  L   +  LI LR L+    PL+E MP  I  L  LQ 
Sbjct:   612 PEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTPLVE-MPPGIKKLRSLQK 670

Query:   664 LPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARDAELNGKRNLDVLFLEWT 723
             L  FV+G+ +G+ L ELK L +L+  L+IS L+NV  + +A+DA L  K  LD L L+WT
Sbjct:   671 LSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWT 730

Query:   724 NSSGSSREPET-------EKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELL 776
                GS   P +       +K VL ML PH +LK   I  Y G  FP WLGDS+F  +  +
Sbjct:   731 -VKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSV 789

Query:   777 RFENCAMCTSLPSIGQLPALKHLSIIGMALVKSVGLQFY---GNSGTVSFPSLETLFFGD 833
                +C +C SLP +GQLP+LK+LSI    +++ VGL F+    NS  V F SL+ L F  
Sbjct:   790 TLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYG 849

Query:   834 MPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLPSLKTLVIQEC 885
             MP W++WI   P  E  +FP LQ+L + RC  L  + PE LPS   + I +C
Sbjct:   850 MPRWDEWIC--PELEDGIFPCLQKLIIQRCPSLRKKFPEGLPSSTEVTISDC 899

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00010803001	SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (1418 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1388
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	1e-58
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.002

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  203 bits (519), Expect = 1e-58
 Identities = 98/248 (39%), Positives = 142/248 (57%), Gaps = 14/248 (5%)

Query: 186 RDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHMVESHFDLKAW 245
           R+D  +A++E LL    N      L V+ IVGMGG+GKTTLA+ +YND  V  HFD  AW
Sbjct: 1   REDMIEALIEKLLEMSDN------LGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAW 54

Query: 246 TCVSDDFDAIKVTKAILRSI--CMHTDADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNY 303
             VS  +   ++ K IL+ +        + + + L VK+K+ L RK+FLLVLDD+W  N 
Sbjct: 55  VVVSKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKN- 113

Query: 304 GDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVS-AYELKKLTDDDCRLVFTQHSLGT 362
            DW  + +PF  G +GS++IVTTR++SVA  MG  S  +E++ L  ++   +F+      
Sbjct: 114 -DWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKV-FE 171

Query: 363 KDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEEGGD 422
           K+      L+E+ +EI++KC GLPLA K LGGLL  KS   +W +VL      L    G 
Sbjct: 172 KELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGL 231

Query: 423 --IMRALK 428
             ++  L 
Sbjct: 232 NEVLSILS 239

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1388
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.89
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.88
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.87
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.86
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.85
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.83
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.83
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.79
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.48
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.47
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.47
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.47
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.31
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.28
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.27
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.23
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.2
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.08
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.05
PRK04841		903	transcriptional regulator MalT; Provisional	99.04
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.97
PF05729		166	NACHT: NACHT domain	98.86
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.85
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.76
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.75
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.74
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.7
KOG4341		483	consensus F-box protein containing LRR [General fu	98.67
PRK15386		426	type III secretion protein GogB; Provisional	98.66
PRK06893		229	DNA replication initiation factor; Validated	98.63
PRK13342		413	recombination factor protein RarA; Reviewed	98.62
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.61
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	98.6
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.6
KOG4341		483	consensus F-box protein containing LRR [General fu	98.57
PRK15386		426	type III secretion protein GogB; Provisional	98.49
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.44
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.44
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.39
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.39
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.38
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.37
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	98.35
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.33
cd01128		249	rho_factor Transcription termination factor rho is	98.32
PF13173		128	AAA_14: AAA domain	98.31
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.3
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.3
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	98.3
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	98.29
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.29
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.29
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	98.27
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	98.26
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.26
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.25
PRK12402		337	replication factor C small subunit 2; Reviewed	98.25
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	98.25
PRK04195		482	replication factor C large subunit; Provisional	98.24
PTZ00202		550	tuzin; Provisional	98.24
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	98.23
PRK09376		416	rho transcription termination factor Rho; Provisio	98.23
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.22
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	98.21
PLN03025		319	replication factor C subunit; Provisional	98.19
PRK13341		725	recombination factor protein RarA/unknown domain f	98.18
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	98.17
PLN03150		623	hypothetical protein; Provisional	98.16
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	98.16
PRK08727		233	hypothetical protein; Validated	98.15
PLN03150		623	hypothetical protein; Provisional	98.14
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	98.14
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	98.13
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.11
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.1
PRK00440		319	rfc replication factor C small subunit; Reviewed	98.1
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.05
KOG2028		554	consensus ATPase related to the helicase subunit o	98.05
PRK09087		226	hypothetical protein; Validated	98.04
PRK08903		227	DnaA regulatory inactivator Hda; Validated	98.04
PRK08084		235	DNA replication initiation factor; Provisional	98.04
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	98.03
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.02
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	98.02
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.0
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	98.0
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	98.0
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	98.0
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	97.99
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.99
TIGR00767		415	rho transcription termination factor Rho. Members	97.97
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	97.97
PRK07471		365	DNA polymerase III subunit delta'; Validated	97.95
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.94
PRK09112		351	DNA polymerase III subunit delta'; Validated	97.93
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	97.92
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	97.91
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.89
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.89
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.88
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	97.87
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	97.86
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	97.86
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.86
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.86
PRK05642		234	DNA replication initiation factor; Validated	97.84
COG3899		849	Predicted ATPase [General function prediction only	97.84
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	97.77
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	97.76
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	97.76
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	97.75
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	97.75
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	97.75
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.74
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	97.73
CHL00181		287	cbbX CbbX; Provisional	97.72
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	97.69
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	97.68
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	97.67
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	97.67
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	97.67
PRK06620		214	hypothetical protein; Validated	97.63
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	97.63
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	97.62
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	97.62
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	97.6
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.59
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.58
PHA02544		316	44 clamp loader, small subunit; Provisional	97.58
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	97.57
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.57
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	97.55
COG3903		414	Predicted ATPase [General function prediction only	97.54
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.53
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	97.52
PRK03992		389	proteasome-activating nucleotidase; Provisional	97.52
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.51
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	97.48
CHL00095		821	clpC Clp protease ATP binding subunit	97.47
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	97.46
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	97.46
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.45
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	97.37
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	97.37
PRK14088		440	dnaA chromosomal replication initiation protein; P	97.36
PRK07399		314	DNA polymerase III subunit delta'; Validated	97.34
PF00004		132	AAA: ATPase family associated with various cellula	97.32
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.32
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	97.3
PF14516		331	AAA_35: AAA-like domain	97.3
COG0593		408	DnaA ATPase involved in DNA replication initiation	97.28
PRK00149		450	dnaA chromosomal replication initiation protein; R	97.27
PRK12422		445	chromosomal replication initiation protein; Provis	97.26
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.25
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	97.19
PRK14086		617	dnaA chromosomal replication initiation protein; P	97.19
smart00382		148	AAA ATPases associated with a variety of cellular	97.18
PRK10865		857	protein disaggregation chaperone; Provisional	97.16
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.15
PRK05707		328	DNA polymerase III subunit delta'; Validated	97.13
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	97.12
PRK10536		262	hypothetical protein; Provisional	97.12
PRK08116		268	hypothetical protein; Validated	97.11
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	97.11
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.07
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	97.06
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	97.05
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	97.0
PRK08118		167	topology modulation protein; Reviewed	96.99
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	96.98
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	96.98
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	96.93
CHL00176		638	ftsH cell division protein; Validated	96.89
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.89
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	96.87
PRK08058		329	DNA polymerase III subunit delta'; Validated	96.86
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	96.84
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	96.84
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	96.78
PRK06090		319	DNA polymerase III subunit delta'; Validated	96.78
PRK13531		498	regulatory ATPase RavA; Provisional	96.76
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	96.75
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	96.75
PRK08769		319	DNA polymerase III subunit delta'; Validated	96.74
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	96.73
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	96.73
PRK12608		380	transcription termination factor Rho; Provisional	96.72
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.7
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.64
PRK06871		325	DNA polymerase III subunit delta'; Validated	96.62
PRK10865		857	protein disaggregation chaperone; Provisional	96.62
PRK07952		244	DNA replication protein DnaC; Validated	96.61
PRK08181		269	transposase; Validated	96.61
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	96.58
PRK08939		306	primosomal protein DnaI; Reviewed	96.53
KOG1514		767	consensus Origin recognition complex, subunit 1, a	96.52
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.52
PRK06921		266	hypothetical protein; Provisional	96.5
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	96.49
PRK06526		254	transposase; Provisional	96.48
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	96.45
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	96.43
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	96.41
PRK07261		171	topology modulation protein; Provisional	96.41
PRK09183		259	transposase/IS protein; Provisional	96.4
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	96.4
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	96.35
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	96.31
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	96.31
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	96.28
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.24
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	96.23
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	96.22
PRK12377		248	putative replication protein; Provisional	96.21
TIGR02237		209	recomb_radB DNA repair and recombination protein R	96.2
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	96.18
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.17
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.15
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	96.14
PRK07993		334	DNA polymerase III subunit delta'; Validated	96.1
PRK04296		190	thymidine kinase; Provisional	96.08
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.08
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	96.07
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.05
PRK05541		176	adenylylsulfate kinase; Provisional	96.02
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	96.01
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.0
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	95.98
CHL00095		821	clpC Clp protease ATP binding subunit	95.98
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	95.97
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	95.92
PRK06964		342	DNA polymerase III subunit delta'; Validated	95.89
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	95.85
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	95.84
cd01394		218	radB RadB. The archaeal protein radB shares simila	95.82
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	95.79
cd01133		274	F1-ATPase_beta F1 ATP synthase beta subunit, nucle	95.76
PRK04132		846	replication factor C small subunit; Provisional	95.75
CHL00195		489	ycf46 Ycf46; Provisional	95.75
PRK06835		329	DNA replication protein DnaC; Validated	95.74
PRK06696		223	uridine kinase; Validated	95.74
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	95.68
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	95.68
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	95.66
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	95.63
cd00983		325	recA RecA is a bacterial enzyme which has roles in	95.63
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	95.62
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.57
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	95.56
PF05659		147	RPW8: Arabidopsis broad-spectrum mildew resistance	95.54
KOG1969		877	consensus DNA replication checkpoint protein CHL12	95.54
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.53
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	95.52
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	95.51
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	95.49
PRK09354		349	recA recombinase A; Provisional	95.46
PF08423		256	Rad51: Rad51; InterPro: IPR013632 This domain is f	95.44
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	95.43
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.39
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	95.37
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	95.37
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	95.37
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	95.37
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	95.34
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.33
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.31
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.25
PRK13695		174	putative NTPase; Provisional	95.23
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	95.22
PRK15455		644	PrkA family serine protein kinase; Provisional	95.22
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	95.21
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	95.2
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	95.19
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	95.18
PHA02244		383	ATPase-like protein	95.16
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	95.13
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	95.12
KOG0473		326	consensus Leucine-rich repeat protein [Function un	95.12
TIGR02239		316	recomb_RAD51 DNA repair protein RAD51. This eukary	95.11
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.1
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	95.02
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	94.99
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	94.99
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	94.99
PRK00771		437	signal recognition particle protein Srp54; Provisi	94.99
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.98
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	94.95
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	94.95
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.88
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	94.87
PRK06067		234	flagellar accessory protein FlaH; Validated	94.87
PRK05439		311	pantothenate kinase; Provisional	94.85
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	94.85
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	94.84
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	94.84
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	94.82
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	94.81
PLN03186		342	DNA repair protein RAD51 homolog; Provisional	94.81
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	94.81
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	94.8
PRK04301		317	radA DNA repair and recombination protein RadA; Va	94.8
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.78
cd03216		163	ABC_Carb_Monos_I This family represents the domain	94.78
COG2884		223	FtsE Predicted ATPase involved in cell division [C	94.74
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	94.73
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.69
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	94.68
PRK07667		193	uridine kinase; Provisional	94.66
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	94.61
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	94.59
PF00006		215	ATP-synt_ab: ATP synthase alpha/beta family, nucle	94.56
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	94.56
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	94.53
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	94.52
TIGR00959		428	ffh signal recognition particle protein. This mode	94.49
PTZ00301		210	uridine kinase; Provisional	94.48
TIGR02236		310	recomb_radA DNA repair and recombination protein R	94.47
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.45
PRK05480		209	uridine/cytidine kinase; Provisional	94.4
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	94.4
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	94.4
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	94.38
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	94.33
KOG1532		366	consensus GTPase XAB1, interacts with DNA repair p	94.29
PRK10867		433	signal recognition particle protein; Provisional	94.28
cd03115		173	SRP The signal recognition particle (SRP) mediates	94.28
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	94.27
PRK11608		326	pspF phage shock protein operon transcriptional ac	94.26
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	94.25
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	94.21
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.21
cd03246		173	ABCC_Protease_Secretion This family represents the	94.21
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	94.19
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	94.16
PTZ00035		337	Rad51 protein; Provisional	94.11
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	94.11
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	94.1
COG0468		279	RecA RecA/RadA recombinase [DNA replication, recom	94.08
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.05
TIGR00235		207	udk uridine kinase. Model contains a number of lon	94.05
PRK06547		172	hypothetical protein; Provisional	94.02
PRK08233		182	hypothetical protein; Provisional	94.02
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	93.97
PRK07132		299	DNA polymerase III subunit delta'; Validated	93.93
COG2842		297	Uncharacterized ATPase, putative transposase [Gene	93.88
PF07726		131	AAA_3: ATPase family associated with various cellu	93.88
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	93.85
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.81
TIGR00064		272	ftsY signal recognition particle-docking protein F	93.8
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	93.79
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	93.77
PTZ00088		229	adenylate kinase 1; Provisional	93.73
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	93.73
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	93.7
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	93.7
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	93.67
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	93.64
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	93.63
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	93.6
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	93.59
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	93.54
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	93.54
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	93.5
PHA00729		226	NTP-binding motif containing protein	93.47
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	93.47
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	93.45
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	93.42
PRK06002		450	fliI flagellum-specific ATP synthase; Validated	93.34
PRK06762		166	hypothetical protein; Provisional	93.3
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	93.3
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	93.27
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	93.27
cd01134		369	V_A-ATPase_A V/A-type ATP synthase catalytic subun	93.26
PRK05022		509	anaerobic nitric oxide reductase transcription reg	93.24
PRK08972		444	fliI flagellum-specific ATP synthase; Validated	93.24
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	93.22
PRK14974		336	cell division protein FtsY; Provisional	93.2
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	93.17
PTZ00185		574	ATPase alpha subunit; Provisional	93.08
PRK12678		672	transcription termination factor Rho; Provisional	93.06
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	93.05
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	93.04
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	93.03
PRK03839		180	putative kinase; Provisional	93.02
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	92.95
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	92.94
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	92.92
PRK00625		173	shikimate kinase; Provisional	92.9
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	92.87
PRK04040		188	adenylate kinase; Provisional	92.85
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	92.85
KOG0736		953	consensus Peroxisome assembly factor 2 containing	92.84
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	92.82
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	92.82
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	92.8
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	92.77
PRK12597		461	F0F1 ATP synthase subunit beta; Provisional	92.73
PRK08927		442	fliI flagellum-specific ATP synthase; Validated	92.71
cd01135		276	V_A-ATPase_B V/A-type ATP synthase (non-catalytic)	92.69
PRK04328		249	hypothetical protein; Provisional	92.62
PF00154		322	RecA: recA bacterial DNA recombination protein; In	92.58
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	92.56
PRK09280		463	F0F1 ATP synthase subunit beta; Validated	92.56
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	92.54
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	92.53
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	92.52
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	92.47
PRK09519		790	recA DNA recombination protein RecA; Reviewed	92.47
cd03215		182	ABC_Carb_Monos_II This family represents domain II	92.44
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	92.41
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	92.41
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	92.39
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	92.29
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	92.29
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	92.26
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	92.23
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	92.22
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	92.2
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	92.18
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	92.17
CHL00206		2281	ycf2 Ycf2; Provisional	92.13
PRK00889		175	adenylylsulfate kinase; Provisional	92.11
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	92.1
cd01136		326	ATPase_flagellum-secretory_path_III Flagellum-spec	92.08
COG0714		329	MoxR-like ATPases [General function prediction onl	92.06
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	92.05
TIGR03498		418	FliI_clade3 flagellar protein export ATPase FliI.	92.01
PRK00409		782	recombination and DNA strand exchange inhibitor pr	92.0
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	91.98
PF12061		402	DUF3542: Protein of unknown function (DUF3542); In	91.97
PRK08533		230	flagellar accessory protein FlaH; Reviewed	91.97
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	91.95
PRK13948		182	shikimate kinase; Provisional	91.94
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	91.87
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	91.85
PRK07594		433	type III secretion system ATPase SsaN; Validated	91.84
COG0003		322	ArsA Predicted ATPase involved in chromosome parti	91.84
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	91.81
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	91.8
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	91.77
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	91.75
PRK00131		175	aroK shikimate kinase; Reviewed	91.73
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	91.73
PRK15453		290	phosphoribulokinase; Provisional	91.71
PRK08149		428	ATP synthase SpaL; Validated	91.69
TIGR03305		449	alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit	91.67
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	91.67
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	91.65
cd01132		274	F1_ATPase_alpha F1 ATP synthase alpha, central dom	91.65
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	91.63
PRK11823		446	DNA repair protein RadA; Provisional	91.59
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	91.57
PRK06936		439	type III secretion system ATPase; Provisional	91.57
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	91.55
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	91.53
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	91.5
PRK06217		183	hypothetical protein; Validated	91.47
PRK05917		290	DNA polymerase III subunit delta'; Validated	91.45
PRK13949		169	shikimate kinase; Provisional	91.45
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	91.44
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.43
KOG0736		953	consensus Peroxisome assembly factor 2 containing	91.42
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	91.4
PRK10416		318	signal recognition particle-docking protein FtsY;	91.38
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	91.38
PF13245		76	AAA_19: Part of AAA domain	91.37
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	91.36
PRK05973		237	replicative DNA helicase; Provisional	91.34
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	91.34
PLN02348		395	phosphoribulokinase	91.29
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	91.25
PRK03846		198	adenylylsulfate kinase; Provisional	91.24
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	91.21
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	91.18
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	91.17
PRK13947		171	shikimate kinase; Provisional	91.16
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	91.16
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.16
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	91.13
PRK09099		441	type III secretion system ATPase; Provisional	91.08
PRK05688		451	fliI flagellum-specific ATP synthase; Validated	91.06
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	91.05
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	91.05
PRK05922		434	type III secretion system ATPase; Validated	91.02
TIGR03496		411	FliI_clade1 flagellar protein export ATPase FliI.	91.01
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	90.99
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	90.98
PRK00300		205	gmk guanylate kinase; Provisional	90.9
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	90.88
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	90.88
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	90.87
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	90.85
PRK12339		197	2-phosphoglycerate kinase; Provisional	90.84
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	90.78

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=1.7e-75  Score=720.14  Aligned_cols=790  Identities=28%  Similarity=0.394  Sum_probs=562.6

Q ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHHHhhcccCcHHHHHHHHHHHHHHhhhhhHHhhhhhHHHHHHHHhhhcccccc
Q 045318           26 LQFARQEQIQADLKKWERILFKIHAVLDDADEKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHETN  105 (1388)
Q Consensus        26 ~~~~~~~~~~~~~~~l~~~l~~i~~~l~~a~~~~~~~~~~~~wl~~lr~~~yd~ed~ld~~~~~~~~~~~~~~~~~~~~~  105 (1388)
                      .++....++++.+..|++.|..++++++|+++++.....+..|.+.+++++|++||.++.+.......+..+.-.    .
T Consensus        18 ~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~----~   93 (889)
T KOG4658|consen   18 RESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLS----T   93 (889)
T ss_pred             HHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhh----h
Confidence            345556788889999999999999999999999888899999999999999999999999998876654322110    0


Q ss_pred             cccccccccccccCCCCCchhhchhHHHHHHHHHHHHHHHHHhhhccCccCCCCCCCcccccccccccccccccCCcccc
Q 045318          106 TSMLRKLIPTCCTNRGPRSLAFNSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPATSLVNEAEVHG  185 (1388)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG  185 (1388)
                      ....++..   |      ..++++..+..+..+.+++..+.+.+..++........+.. ....+..++.+..++.. ||
T Consensus        94 ~~~~~~~~---c------~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~-~~~~~~~e~~~~~~~~~-VG  162 (889)
T KOG4658|consen   94 RSVERQRL---C------LCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGES-LDPREKVETRPIQSESD-VG  162 (889)
T ss_pred             hHHHHHHH---h------hhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccc-ccchhhcccCCCCcccc-cc
Confidence            00011111   1      01345677777777778887777777777655432211110 11112223444444445 99


Q ss_pred             chhhHHHHHHHHhcCCCCCCCCCCcEEEEEEcCCCChHHHHHHHHhcCcc-ccccCCceEEEEeCCccCHHHHHHHHHHH
Q 045318          186 RDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHM-VESHFDLKAWTCVSDDFDAIKVTKAILRS  264 (1388)
Q Consensus       186 r~~~~~~l~~~l~~~~~~~~~~~~~~vv~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~wv~~s~~~~~~~~~~~i~~~  264 (1388)
                      .++.++++.+.|..++        ..+|+|+||||+||||||+.++|+.. ++.+||.++||+||++++..+++++|++.
T Consensus       163 ~e~~~~kl~~~L~~d~--------~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~  234 (889)
T KOG4658|consen  163 LETMLEKLWNRLMEDD--------VGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILER  234 (889)
T ss_pred             HHHHHHHHHHHhccCC--------CCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHH
Confidence            9999999999998753        28999999999999999999999987 99999999999999999999999999999


Q ss_pred             hcCCCCC--CCcHHHHHHHHHhhcCCceEEEEEeCCCCCChhhhhhhcccccCCCCCcEEEEEcCChhHHhh-cCCCceE
Q 045318          265 ICMHTDA--DDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASM-MGSVSAY  341 (1388)
Q Consensus       265 l~~~~~~--~~~~~~~~~~l~~~l~~k~~LlVlDdv~~~~~~~~~~l~~~~~~~~~gs~iivTtR~~~v~~~-~~~~~~~  341 (1388)
                      ++.....  ....++++..+.+.|++|||+|||||||+.  .+|+.+..++|....||||++|||++.|+.. +++...+
T Consensus       235 l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~  312 (889)
T KOG4658|consen  235 LGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPI  312 (889)
T ss_pred             hccCCcccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccc
Confidence            9875443  233478899999999999999999999998  4799999999999899999999999999998 8888899


Q ss_pred             eCCCCChhhHHHHHHHcccCCCCCCCCchHHHHHHHHHHHcCCChHHHHHHHHhhcCCCCHHHHHHHHhhhccCCCCC--
Q 045318          342 ELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDWRNVLNNKIWNLPEE--  419 (1388)
Q Consensus       342 ~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~~~~i~~~c~g~Plai~~~~~~l~~~~~~~~w~~~~~~~~~~~~~~--  419 (1388)
                      +++.|+++|||.||++.||.... ...+.++++|++++++|+|+|||++++|+.|+.|.+..+|+++.+...+.+...  
T Consensus       313 ~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~  391 (889)
T KOG4658|consen  313 EVECLTPEEAWDLFQKKVGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFS  391 (889)
T ss_pred             cccccCccccHHHHHHhhccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCC
Confidence            99999999999999999976533 333448999999999999999999999999999999999999998765542222  


Q ss_pred             --CCchhHhh----------------------------HHHHHHHHHHcCCcCCCCCcchHHHHHHHHHHHHHhCCCCcc
Q 045318          420 --GGDIMRAL----------------------------KNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQK  469 (1388)
Q Consensus       420 --~~~~~~~l----------------------------~~~li~~wia~g~i~~~~~~~~~~~~~~~~~~~L~~~~li~~  469 (1388)
                        ...+++.+                            ++++|.+||||||+.+..++.++++.|+.|+.+|+.++|++.
T Consensus       392 ~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~  471 (889)
T KOG4658|consen  392 GMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIE  471 (889)
T ss_pred             chhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhh
Confidence              22343433                            789999999999999877788999999999999999999998


Q ss_pred             cc---CCCcccccchHHHHHHHhcc-----CceEEeecc--cccccccccCCcceEEEeeccccccccccccccCCCCCc
Q 045318          470 SY---MDSRFIMHDLITDLAQWAAS-----DSYFRLENT--LEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLR  539 (1388)
Q Consensus       470 ~~---~~~~~~mHdli~d~a~~~~~-----~~~~~~~~~--~~~~~~~~~~~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr  539 (1388)
                      ..   ....|+|||+|||+|.|+++     .+...+..+  .........+..+|++++..+....+   ..-..+++|+
T Consensus       472 ~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L~  548 (889)
T KOG4658|consen  472 ERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKLR  548 (889)
T ss_pred             cccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCccc
Confidence            74   44789999999999999999     455444432  11112233356789999988765443   3345667899


Q ss_pred             eeeeecccccccccchHHHHhhccCceeeEEEeCCc-cccccccccccCcccceeeccCccccccccchhcccccceeec
Q 045318          540 TFVSVQWTFSRHFLSDSVVHMLLKLQCLRVLCLREY-NICKISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLL  618 (1388)
Q Consensus       540 ~L~~~~~~~~~~~l~~~~~~~~~~l~~Lr~L~L~~~-~i~~lp~~i~~l~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~L  618 (1388)
                      +|.+.....   ++.......|..++.||||||++| .+..+|++|++|.|||||+|+++.|..+|..+++|+.|.+||+
T Consensus       549 tLll~~n~~---~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl  625 (889)
T KOG4658|consen  549 TLLLQRNSD---WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNL  625 (889)
T ss_pred             eEEEeecch---hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecc
Confidence            997554311   123333444688999999999987 7889999999999999999999999999999999999999999


Q ss_pred             CCCcchhhcchhhcccCCCCeeecCCCCCcccCcCCCCCCCCCCCCCceEeccCCCCCcccccccccccceeEeecccCC
Q 045318          619 ESCSRLKKLCADMGNLIKLRHLNNYNVPLLEGMPLRIGHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENV  698 (1388)
Q Consensus       619 ~~~~~~~~lp~~i~~L~~L~~L~l~~~~~~~~~p~~i~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~L~i~~l~~~  698 (1388)
                      ..+.....+|..+..|.+||+|.+.... ...-...++.+.+|++|..+.....+...+..+..+..|+.......+.. 
T Consensus       626 ~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~-  703 (889)
T KOG4658|consen  626 EVTGRLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEG-  703 (889)
T ss_pred             ccccccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcc-
Confidence            9988777777777779999999987754 22222345556666666655554333222233333333331111111111 


Q ss_pred             CCchhhhhhhcCCCCCCCeEEEEeeCCCCCCCCchhHHHHhccCCCCCCcceEEEeccCCCCCCcccCCCCCCCccEEee
Q 045318          699 KDSGDARDAELNGKRNLDVLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRF  778 (1388)
Q Consensus       699 ~~~~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~~~~~~~l~~L~~~~~L~~L~l~~~~~~~~p~~~~~~~l~~L~~L~L  778 (1388)
                       .........+..+.+|+.|.+..+...............+.   .++++..+.+.++.+...+.|..  ..++|+.|.+
T Consensus       704 -~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~---~f~~l~~~~~~~~~~~r~l~~~~--f~~~L~~l~l  777 (889)
T KOG4658|consen  704 -CSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLL---CFPNLSKVSILNCHMLRDLTWLL--FAPHLTSLSL  777 (889)
T ss_pred             -cccceeecccccccCcceEEEEcCCCchhhcccccccchhh---hHHHHHHHHhhccccccccchhh--ccCcccEEEE
Confidence             11222344566778888888887766432111100000000   13344555555555555566653  2577888888


Q ss_pred             ecCCCCCCC-CCCCCCCCcceeeccCCcCcEEeccccccCCCccCCCCccee-eccccccccccccCCCCCccccccccc
Q 045318          779 ENCAMCTSL-PSIGQLPALKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETL-FFGDMPEWEDWIPHQPSQEVEVFPQLQ  856 (1388)
Q Consensus       779 ~~~~~~~~l-~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~~~~~f~~L~~L-~l~~~~~l~~~~~~~~~~~~~~~~~L~  856 (1388)
                      ..|...+.+ |....+..++.+.+                    .|.+++.+ .+.+.+.+..+..     ..-.++.|+
T Consensus       778 ~~~~~~e~~i~~~k~~~~l~~~i~--------------------~f~~~~~l~~~~~l~~l~~i~~-----~~l~~~~l~  832 (889)
T KOG4658|consen  778 VSCRLLEDIIPKLKALLELKELIL--------------------PFNKLEGLRMLCSLGGLPQLYW-----LPLSFLKLE  832 (889)
T ss_pred             ecccccccCCCHHHHhhhcccEEe--------------------cccccccceeeecCCCCceeEe-----cccCccchh
Confidence            877765543 33333333433221                    24444444 3444444333321     111245577


Q ss_pred             EEeecCCccccccCCCCCCCccEEEEecc
Q 045318          857 ELSLVRCSKLLGRLPEHLPSLKTLVIQEC  885 (1388)
Q Consensus       857 ~L~l~~C~~L~~~~p~~l~~L~~L~i~~~  885 (1388)
                      .+.+..||++. .    +|.+.++.+.+|
T Consensus       833 ~~~ve~~p~l~-~----~P~~~~~~i~~~  856 (889)
T KOG4658|consen  833 ELIVEECPKLG-K----LPLLSTLTIVGC  856 (889)
T ss_pred             heehhcCcccc-c----Cccccccceecc
Confidence            77777777775 3    445556666665

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK12608 transcription termination factor Rho; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>TIGR02239 recomb_RAD51 DNA repair protein RAD51	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PLN03186 DNA repair protein RAD51 homolog; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only]	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK06002 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK08972 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PTZ00185 ATPase alpha subunit; Provisional	Back alignment and domain information

>PRK12678 transcription termination factor Rho; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK12597 F0F1 ATP synthase subunit beta; Provisional	Back alignment and domain information

>PRK08927 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK09280 F0F1 ATP synthase subunit beta; Validated	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>PRK09519 recA DNA recombination protein RecA; Reviewed	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PRK07594 type III secretion system ATPase SsaN; Validated	Back alignment and domain information

>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>PRK08149 ATP synthase SpaL; Validated	Back alignment and domain information

>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>PRK06936 type III secretion system ATPase; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PRK09099 type III secretion system ATPase; Provisional	Back alignment and domain information

>PRK05688 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK05922 type III secretion system ATPase; Validated	Back alignment and domain information

>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1388
1z6t_A		591	Structure Of The Apoptotic Protease-activating Fact		8e-06
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		6e-05
3sfz_A		1249	Crystal Structure Of Full-Length Murine Apaf-1 Leng		3e-04

>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591

Back alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 58/215 (26%), Positives = 93/215 (43%), Gaps = 46/215 (21%) Query: 213 IPIVGMGGLGKTTLAQLVYNDH-MVESHFDLKA-WTCVSDDFDAIKVTKAILRSICMHTD 270 + I GM G GK+ LA DH ++E F W V + + K L+++C D Sbjct: 150 VTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMK--LQNLCTRLD 207 Query: 271 ADDDLNS-LQVKLKDGLSRKKFL---------LVLDDMWNDNYGDWTSLRLPFVAGASGS 320 D+ + L + +++ R + L L+LDD+W+ W A S Sbjct: 208 QDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDS----WV-----LKAFDSQC 258 Query: 321 KIIVTTRNQSVA-SMMGSVSAYELKKLTDDDCRLVFTQHSLGTKD-------FSNHQH-- 370 +I++TTR++SV S+MG +V + SLG + F N + Sbjct: 259 QILLTTRDKSVTDSVMGPKY-------------VVPVESSLGKEKGLEILSLFVNMKKAD 305 Query: 371 LKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPFDW 405 L E I+K+C G PL +G LLR N +++ Sbjct: 306 LPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEY 340

PyMOL of 1z6t

>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1388
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-109
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	4e-86
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-47
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	2e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-11
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-10
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-10
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-04
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-10
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	5e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	7e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	7e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	7e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	8e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	9e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  357 bits (919), Expect = e-109
 Identities = 93/617 (15%), Positives = 189/617 (30%), Gaps = 110/617 (17%)

Query: 57  EKQMTKQSVRLWLRELKNLAYDVEDILDEFSTEALRRQLLEEKQHHE-TNTSMLRKLIPT 115
           + +     ++      K++      I+D   ++       EEK  +E T       LI  
Sbjct: 2   DAKARNCLLQHREALEKDI--KTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKM 59

Query: 116 CCTNRGPRSLAF-NSSMRSKIDEISSRLQDIVTEKEQLDLKENPSSRGRFKKVIQERLPA 174
                    ++F N+ +     ++++ L D +        K++ S        ++  L  
Sbjct: 60  ILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGIT---SYVRTVLCE 116

Query: 175 TSLVNEAEVH-GRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYND 233
             +     V   R     AI + L               + I GM G GK+ LA     D
Sbjct: 117 GGVPQRPVVFVTRKKLVNAIQQKLSKLKGE------PGWVTIHGMAGCGKSVLAAEAVRD 170

Query: 234 HMVESHF--DLKAWTCVSDDFDAIKVTK------AILRSICMHTDADDDLNSLQVKLKDG 285
           H +          W  V     +  + K       + +          ++   + +L+  
Sbjct: 171 HSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRIL 230

Query: 286 LSRK--KFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVASMMGSVSA--Y 341
           + RK  + LL+LDD+W+                 S  +I++TTR++SV   +        
Sbjct: 231 MLRKHPRSLLILDDVWDSWVLKA---------FDSQCQILLTTRDKSVTDSVMGPKYVVP 281

Query: 342 ELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSN 401
               L  +    + +              L E    I+K+C G PL    +G LLR   N
Sbjct: 282 VESSLGKEKGLEILSLFV-----NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPN 336

Query: 402 PF-DWRNVLNNKIWNLPEEGG-----DIMRAL---------------------------- 427
            +  +   L NK +    +        +  A+                            
Sbjct: 337 RWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVP 396

Query: 428 KNDVVLVWMAEGLLEPDTSEMKMEELGRSYFRELHSRSFFQKSYMD--SRFIMHDLITDL 485
              + ++W  E             E      +E  ++S           R+ +HDL  D 
Sbjct: 397 TKVLCILWDME------------TEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDF 444

Query: 486 AQWAASDSYFRLENTLEGNKQQKFSKNLRHFSYPIGHFDHIRRFEAISDCKHLRTFVSVQ 545
                  +  +L++      ++  ++  R+      H     + + +     L       
Sbjct: 445 LT---EKNCSQLQD----LHKKIITQFQRYHQP---HTLSPDQEDCMYWYNFLA------ 488

Query: 546 WTFSRHFLSDSVVHMLLKLQCLRVLCLREYNICKISNTIGDLKHLRHLDLSETLIETLPE 605
           +  +   +   +  ++  L  ++        +   ++ I +    RH+ L E       E
Sbjct: 489 YHMASAKMHKELCALMFSLDWIKAKT----ELVGPAHLIHEFVEYRHI-LDEKDCAVS-E 542

Query: 606 SVNTLYNLHTLLLESCS 622
           +     +L+  LL    
Sbjct: 543 NFQEFLSLNGHLLGRQP 559

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1388
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.98
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.98
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.96
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.95
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.95
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.95
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.94
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.94
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.94
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.93
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.92
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.92
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.9
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.87
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.87
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.86
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.84
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.84
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.83
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.83
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.82
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.82
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.81
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.81
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.8
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.77
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.76
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.76
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.75
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.74
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.74
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.74
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.72
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.72
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.67
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.67
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.66
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.65
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.65
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.65
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.65
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.65
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.64
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.64
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.64
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.63
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.62
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.61
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.6
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.59
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.59
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.58
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.58
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.57
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.57
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.55
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.54
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.54
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.53
3qfl_A		115	MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-	99.52
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.51
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.48
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.48
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.48
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.47
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.46
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.46
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.44
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	99.44
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.43
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.43
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.42
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.4
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.4
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.39
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	99.36
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.35
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.35
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.33
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.31
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.31
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.3
2fna_A		357	Conserved hypothetical protein; structural genomic	99.28
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.28
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.24
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.23
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.23
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.19
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.18
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.18
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.18
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.17
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.15
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.15
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.15
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.14
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	99.14
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.14
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.13
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	99.12
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.11
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.1
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	99.09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.09
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.08
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.08
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.02
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.02
2chg_A		226	Replication factor C small subunit; DNA-binding pr	99.0
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.99
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	98.98
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	98.97
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.96
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.95
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.94
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.92
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.91
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.88
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.87
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.86
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.8
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	98.8
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	98.8
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.73
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.73
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.69
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.68
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.68
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.64
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.63
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.63
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	98.61
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	98.57
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.57
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.54
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	98.42
2chq_A		319	Replication factor C small subunit; DNA-binding pr	98.38
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.34
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.28
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	98.22
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.21
3bos_A		242	Putative DNA replication factor; P-loop containing	98.19
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	98.16
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.1
3pvs_A		447	Replication-associated recombination protein A; ma	98.1
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.09
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.09
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	98.06
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	98.0
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	97.99
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	97.98
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	97.95
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	97.92
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	97.89
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	97.86
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	97.86
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	97.85
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	97.83
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.81
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	97.76
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	97.72
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	97.71
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	97.7
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	97.67
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.63
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	97.61
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.61
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	97.61
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	97.59
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.59
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.57
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.51
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	97.51
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	97.48
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	97.48
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	97.48
3co5_A		143	Putative two-component system transcriptional RES	97.46
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	97.45
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	97.43
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	97.42
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.37
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.34
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	97.32
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	97.28
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.26
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.23
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	97.21
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	97.21
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.2
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	97.19
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	97.19
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	97.16
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	97.14
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	97.12
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	97.12
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	97.07
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	97.0
4b4t_L		437	26S protease subunit RPT4; hydrolase, AAA-atpases,	96.99
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.96
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	96.94
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	96.9
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.86
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	96.86
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	96.81
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	96.75
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	96.71
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	96.67
4b4t_I		437	26S protease regulatory subunit 4 homolog; hydrola	96.66
4b4t_M		434	26S protease regulatory subunit 6A; hydrolase, AAA	96.59
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	96.53
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	96.48
2r44_A		331	Uncharacterized protein; putative ATPase, structur	96.45
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	96.44
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	96.44
2qgz_A		308	Helicase loader, putative primosome component; str	96.33
3nbx_X		500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	96.15
2cvh_A		220	DNA repair and recombination protein RADB; filamen	96.07
1r6b_X		758	CLPA protein; AAA+, N-terminal domain, CLPS, cryst	95.94
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	95.84
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	95.62
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	95.54
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	95.53
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	95.49
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	95.32
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	95.25
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	95.24
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	95.15
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	94.97
3io5_A		333	Recombination and repair protein; storage dimer, i	94.93
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	94.93
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	94.92
1xp8_A		366	RECA protein, recombinase A; recombination, radior	94.89
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	94.88
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	94.8
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	94.73
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	94.52
3ice_A		422	Transcription termination factor RHO; transcriptio	94.51
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	94.49
1u94_A		356	RECA protein, recombinase A; homologous recombinat	94.05
2z43_A		324	DNA repair and recombination protein RADA; archaea	93.96
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.85
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	93.71
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	93.62
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	93.61
1sky_E		473	F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp	93.38
2ga8_A		359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	93.1
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	93.06
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	93.03
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	92.99
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	92.98
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	92.96
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	92.92
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	92.89
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	92.77
2ck3_D		482	ATP synthase subunit beta\, mitochondrial; hydrola	92.73
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	92.7
3l0o_A		427	Transcription termination factor RHO; helicase, RH	92.68
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.65
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	92.56
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	92.52
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	92.51
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	92.48
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	92.46
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	92.44
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	92.43
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	92.35
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	92.34
2xxa_A		433	Signal recognition particle protein; protein trans	92.2
1fx0_B		498	ATP synthase beta chain; latent ATPase, thermal st	92.16
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	92.12
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	92.04
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	91.97
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	91.88
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	91.88
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	91.81
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	91.8
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	91.76
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	91.73
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	91.72
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	91.69
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	91.52
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	91.52
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	91.52
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	91.45
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	91.44
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	91.44
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	91.43
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	91.42
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	91.41
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	91.41
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	91.4
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	91.33
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	91.33
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	91.31
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	91.3
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	91.29
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	91.27
1tue_A		212	Replication protein E1; helicase, replication, E1E	91.25
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	91.22
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	91.21
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	91.19
2hf9_A		226	Probable hydrogenase nickel incorporation protein	91.15
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	91.12
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	91.1
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	91.09
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	91.07
3fwy_A		314	Light-independent protochlorophyllide reductase I	91.05
1via_A		175	Shikimate kinase; structural genomics, transferase	90.99
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	90.97
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	90.96
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	90.93
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	90.92
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	90.91
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	90.86
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	90.78
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	90.77
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	90.72
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	90.64
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	90.58
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	90.48
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	90.48
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	90.43
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	90.41
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	90.36
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	90.34
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	90.29
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	90.23
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	90.22
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	90.21
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.19
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	90.17
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	90.16
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	90.13
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	90.1
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	90.09
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	90.08
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	89.95
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	89.89
3mfy_A		588	V-type ATP synthase alpha chain; A-type ATP syntha	89.86
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	89.85
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	89.8
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	89.73
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	89.71
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	89.67
2qe7_A		502	ATP synthase subunit alpha; blockage of ATP hydrol	89.64
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	89.57
2vli_A		183	Antibiotic resistance protein; transferase, tunica	89.49
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	89.47
3vr4_A		600	V-type sodium ATPase catalytic subunit A; V-ATPase	89.42
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	89.38
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	89.35
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	89.29
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	89.25
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	89.25
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	89.2
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	89.14
2r6a_A		454	DNAB helicase, replicative helicase; replication,	89.11
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	89.03
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	89.02
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	89.0
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	88.94
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	88.91
2r9v_A		515	ATP synthase subunit alpha; TM1612, structural gen	88.89
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	88.87
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	88.81
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	88.8
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	88.79
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	88.75
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	88.73
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	88.61
2ck3_A		510	ATP synthase subunit alpha\, mitochondrial; hydrol	88.56
4a74_A		231	DNA repair and recombination protein RADA; hydrola	88.52
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	88.51
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	88.48
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	88.43
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	88.38
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	88.36
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	88.34
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	88.34
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	88.32
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	88.3
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	88.28
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	88.08
3exa_A		322	TRNA delta(2)-isopentenylpyrophosphate transferase	88.04
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	88.02
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	88.02
2og2_A		359	Putative signal recognition particle receptor; nuc	87.99
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	87.88
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	87.84
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	87.82
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	87.8
3vr4_D		465	V-type sodium ATPase subunit D; V-ATPase, rotary m	87.7
1g41_A		444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	87.68
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	87.61
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	87.55
1b0u_A		262	Histidine permease; ABC transporter, transport pro	87.54
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	87.54
2wji_A		165	Ferrous iron transport protein B homolog; membrane	87.52
1sgw_A		214	Putative ABC transporter; structural genomics, P p	87.46
1ji0_A		240	ABC transporter; ATP binding protein, structural g	87.42
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	87.35
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	87.34
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	87.32
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	87.26
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	87.24
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	87.22
1g6h_A		257	High-affinity branched-chain amino acid transport	87.18
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	87.13
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	87.06
3end_A		307	Light-independent protochlorophyllide reductase ir	87.04
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	87.01
2zej_A		184	Dardarin, leucine-rich repeat kinase 2; parkinson'	86.97
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	86.95
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	86.84
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	86.83
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	86.83
2ged_A		193	SR-beta, signal recognition particle receptor beta	86.81
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	86.73
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	86.72
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	86.7
3oaa_A		513	ATP synthase subunit alpha; rossmann fold, hydrola	86.7
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	86.68
2ghi_A		260	Transport protein; multidrug resistance protein, M	86.63
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	86.59
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	86.5
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	86.45
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	86.41
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	86.38
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	86.29
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	86.27
2c61_A		469	A-type ATP synthase non-catalytic subunit B; hydro	86.27
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	86.24
2qmh_A		205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	86.2
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	86.11
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	86.07
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	86.06
2eyu_A		261	Twitching motility protein PILT; pilus retraction	85.98
2wjg_A		188	FEOB, ferrous iron transport protein B homolog; me	85.86
2vp4_A		230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	85.85
1fx0_A		507	ATP synthase alpha chain; latent ATPase, thermal s	85.84
2lkc_A		178	Translation initiation factor IF-2; NMR {Geobacill	85.81
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	85.68
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	85.64
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	85.58
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	85.53
3gqb_B		464	V-type ATP synthase beta chain; A3B3, V-ATPase, AT	85.45
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	85.41
3sop_A		270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	85.38
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	85.26
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	85.25
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	85.25
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	85.22
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	85.18
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	85.11
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	85.01
2nzj_A		175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	85.0
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	84.99
3con_A		190	GTPase NRAS; structural genomics consortium, SGC,	84.99
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	84.9
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	84.7
2gj8_A		172	MNME, tRNA modification GTPase TRME; G-domain dime	84.62
1z2a_A		168	RAS-related protein RAB-23; RAB GTPase, vesicular	84.52
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	84.51
1fzq_A		181	ADP-ribosylation factor-like protein 3; protein-GD	84.42
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	84.41
1svi_A		195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	84.3
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	84.14
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	84.04
1u8z_A		168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	84.0
1cp2_A		269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	83.9
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	83.89
2erx_A		172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	83.85
3q72_A		166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	83.83
1nrj_B		218	SR-beta, signal recognition particle receptor beta	83.81
3eph_A		409	TRNA isopentenyltransferase; transferase, alternat	83.75
1m7b_A		184	RND3/RHOE small GTP-binding protein; small GTPase,	83.74

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=1e-45  Score=476.70  Aligned_cols=649  Identities=19%  Similarity=0.107  Sum_probs=389.7

Q ss_pred             eeeEEEeCCccccc----cccccccCcccceeeccCccccccccchhcccccceeecCCCcchhhcch--hhcccCCCCe
Q 045318          566 CLRVLCLREYNICK----ISNTIGDLKHLRHLDLSETLIETLPESVNTLYNLHTLLLESCSRLKKLCA--DMGNLIKLRH  639 (1388)
Q Consensus       566 ~Lr~L~L~~~~i~~----lp~~i~~l~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~--~i~~L~~L~~  639 (1388)
                      +++.|+|+++.+..    +|.+++++++|++++++.+.+..+|..++++++|++|||++|.....+|.  .++++++|++
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~  130 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKF  130 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCE
T ss_pred             cEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCE
Confidence            45555555555442    45555555555555555555555555555566666666655554444554  5555666666


Q ss_pred             eecCCCCCcccCcCCC-CCCCCCCCCCceEeccCCCCCcccccccccccceeEeecccCCCCchhhhh--hhcCCCCCCC
Q 045318          640 LNNYNVPLLEGMPLRI-GHLSCLQTLPYFVVGKNTGSQLRELKFLENLQVKLKISRLENVKDSGDARD--AELNGKRNLD  716 (1388)
Q Consensus       640 L~l~~~~~~~~~p~~i-~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~L~i~~l~~~~~~~~~~~--~~l~~~~~L~  716 (1388)
                      |++++|.+...+|..+ +++++|++|..                             ..+...+....  ..+.++++|+
T Consensus       131 L~Ls~n~l~~~~~~~~~~~l~~L~~L~L-----------------------------s~n~l~~~~~~~~~~~~~l~~L~  181 (768)
T 3rgz_A          131 LNVSSNTLDFPGKVSGGLKLNSLEVLDL-----------------------------SANSISGANVVGWVLSDGCGELK  181 (768)
T ss_dssp             EECCSSEEECCSSCCSCCCCTTCSEEEC-----------------------------CSSCCEEETHHHHHHTTCCTTCC
T ss_pred             EECcCCccCCcCCHHHhccCCCCCEEEC-----------------------------CCCccCCcCChhhhhhccCCCCC
Confidence            6665555433334332 44444444410                             00000000000  1144555666


Q ss_pred             eEEEEeeCCCCCCCCchhHHHHhccCCCCCCcceEEEeccCCCCCCcccCCCCCCCccEEeeecCCCCCCCC-CCCCCCC
Q 045318          717 VLFLEWTNSSGSSREPETEKHVLDMLRPHENLKQLAIRGYGGANFPIWLGDSTFSNLELLRFENCAMCTSLP-SIGQLPA  795 (1388)
Q Consensus       717 ~L~L~~~~~~~~~~~~~~~~~~l~~L~~~~~L~~L~l~~~~~~~~p~~~~~~~l~~L~~L~L~~~~~~~~l~-~l~~l~~  795 (1388)
                      .|++++|.+.+..+           ...+++|+.|+++++.....+..+.  .+++|++|++++|.+...+| .++.+++
T Consensus       182 ~L~Ls~n~l~~~~~-----------~~~l~~L~~L~Ls~n~l~~~~~~l~--~l~~L~~L~Ls~n~l~~~~~~~l~~l~~  248 (768)
T 3rgz_A          182 HLAISGNKISGDVD-----------VSRCVNLEFLDVSSNNFSTGIPFLG--DCSALQHLDISGNKLSGDFSRAISTCTE  248 (768)
T ss_dssp             EEECCSSEEESCCB-----------CTTCTTCCEEECCSSCCCSCCCBCT--TCCSCCEEECCSSCCCSCHHHHTTTCSS
T ss_pred             EEECCCCcccccCC-----------cccCCcCCEEECcCCcCCCCCcccc--cCCCCCEEECcCCcCCCcccHHHhcCCC
Confidence            66666554432110           1223334444443333322222222  24555555555555444333 3455555


Q ss_pred             cceeeccCCcCcEEeccccccCCCccCCCCcceeeccccccccccccCCCCCcccccccccEEeecCCccccccCCCCCC
Q 045318          796 LKHLSIIGMALVKSVGLQFYGNSGTVSFPSLETLFFGDMPEWEDWIPHQPSQEVEVFPQLQELSLVRCSKLLGRLPEHLP  875 (1388)
Q Consensus       796 L~~L~L~~~~~~~~~~~~~~~~~~~~~f~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~C~~L~~~~p~~l~  875 (1388)
                      |++|++++|.....+                                     ....+++|++|++++ +.+++.+|..+.
T Consensus       249 L~~L~Ls~n~l~~~~-------------------------------------~~~~l~~L~~L~L~~-n~l~~~ip~~~~  290 (768)
T 3rgz_A          249 LKLLNISSNQFVGPI-------------------------------------PPLPLKSLQYLSLAE-NKFTGEIPDFLS  290 (768)
T ss_dssp             CCEEECCSSCCEESC-------------------------------------CCCCCTTCCEEECCS-SEEEESCCCCSC
T ss_pred             CCEEECCCCcccCcc-------------------------------------CccccCCCCEEECcC-CccCCccCHHHH
Confidence            555555555322110                                     011367788888887 466656665431


Q ss_pred             CccEEEEecccCccccCCCCCcceEEEEcCCCCeeecccCcCccccccccCCCCchhcchhhhccCCCcceEEEeeeeee
Q 045318          876 SLKTLVIQECEQLLVTVPSIPTLCKLEIGGCKKVVWGSTDLSSLNSMVSSNVPNQVFLTGLLNQELPILEELAICNTKVT  955 (1388)
Q Consensus       876 ~L~~L~i~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~~~~~~~~~l~~~~~~~l~~L~~L~l~~~~l~  955 (1388)
                      .                 .+++|+.|+++++.....                      ....+..+++|++|++++|.+.
T Consensus       291 ~-----------------~~~~L~~L~Ls~n~l~~~----------------------~p~~~~~l~~L~~L~L~~n~l~  331 (768)
T 3rgz_A          291 G-----------------ACDTLTGLDLSGNHFYGA----------------------VPPFFGSCSLLESLALSSNNFS  331 (768)
T ss_dssp             T-----------------TCTTCSEEECCSSEEEEC----------------------CCGGGGGCTTCCEEECCSSEEE
T ss_pred             h-----------------hcCcCCEEECcCCcCCCc----------------------cchHHhcCCCccEEECCCCccc
Confidence            1                 123344444444332110                      0112256788999999999887


Q ss_pred             -eecccCCccccCCCCccEEEEcCCCchhhhhhhHhhhhhhcCCCCcceEEEecCCCCcccccccccC--CCccceEEEc
Q 045318          956 -YLWQTGSGLLQDISSLHKLEIGNCPELLSLVAAEEADQQQQGLPCRLHYLELRSCPSLVKLPQTLLS--LSSLRQLKIS 1032 (1388)
Q Consensus       956 -~l~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~p~~~~~--l~~L~~L~l~ 1032 (1388)
                       .++.   ..+..+++|+.|++++|.....++...      ....++|+.|++++|...+.+|..+..  +++|++|+++
T Consensus       332 ~~ip~---~~l~~l~~L~~L~Ls~n~l~~~~p~~l------~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~  402 (768)
T 3rgz_A          332 GELPM---DTLLKMRGLKVLDLSFNEFSGELPESL------TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ  402 (768)
T ss_dssp             EECCH---HHHTTCTTCCEEECCSSEEEECCCTTH------HHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECC
T ss_pred             CcCCH---HHHhcCCCCCEEeCcCCccCccccHHH------HhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECC
Confidence             4432   337788999999999876544555432      111237999999999888888877766  7889999999


Q ss_pred             cCCCCccChhhhccCCCCCccceeeccCCCcccccc-ccCCCCccEEEeecCcCcccchhhhhhccCCCCCCCCCCCCcc
Q 045318         1033 ECHSMKSLPEALMHNDNAPLESLNVVDCNSLTYIAR-VQLPPSLKLLHIQSCHDLRTLIDEDQISGMKKDGDIPSGSSSY 1111 (1388)
Q Consensus      1033 ~~~~l~~~p~~~~~~~l~~L~~L~l~~c~~l~~~~~-~~~~~sL~~L~l~~c~~L~~~~~~~~l~~~~~~~~lp~~~~~~ 1111 (1388)
                      +|.....+|..+.  .+++|+.|++++|.....+|. ....++|+.|++++|. +              .+.+|..+..+
T Consensus       403 ~n~l~~~~p~~l~--~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~-l--------------~~~~p~~~~~l  465 (768)
T 3rgz_A          403 NNGFTGKIPPTLS--NCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM-L--------------EGEIPQELMYV  465 (768)
T ss_dssp             SSEEEEECCGGGG--GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC-C--------------CSCCCGGGGGC
T ss_pred             CCccccccCHHHh--cCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCc-c--------------cCcCCHHHcCC
Confidence            9988778888774  488899999988754334432 2445788888888774 2              23566666666


Q ss_pred             ccccceeecCCCCCcccccCCCCCCcccCceeEecCCCccccCCCCCCccccccEEeccCCCccccccCCCCCCCcceec
Q 045318         1112 TCLLERLHIEDCPSLTSLFSLKGLPATLEDIKVKNCSKLLFLSKRGALPKVLKDLYIYECSELESIAEGLDNDSSVETIT 1191 (1388)
Q Consensus      1112 ~~~L~~L~l~~c~~l~~l~~~~~~~~sL~~L~l~~c~~l~~l~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~l~ 1191 (1388)
                      ++ |+.|++++|.-...++......++|+.|++++|.....+|.....+++|++|++++|.-...+|..           
T Consensus       466 ~~-L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~-----------  533 (768)
T 3rgz_A          466 KT-LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAE-----------  533 (768)
T ss_dssp             TT-CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGG-----------
T ss_pred             CC-ceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHH-----------
Confidence            66 999999986544455544455566999999887766677766667788999999998655455543           


Q ss_pred             cchhhhhhhccccceEeecCCCCccccCCcCCc-CccceEEecc---------CCC------------------------
Q 045318         1192 FGAVQFLKFYLKLTMLDINGCEKLMALPNNLHQ-FSIEILLIQD---------CPS------------------------ 1237 (1388)
Q Consensus      1192 l~~~~~l~~l~~L~~L~l~~~~~L~~l~~~~~~-~~L~~L~l~~---------c~~------------------------ 1237 (1388)
                            +..+++|+.|++++|+-...+|..+.. ..+..+.+..         ...                        
T Consensus       534 ------l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  607 (768)
T 3rgz_A          534 ------LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL  607 (768)
T ss_dssp             ------GGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGG
T ss_pred             ------HcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcc
Confidence                  346789999999998766677765433 2222221111         000                        


Q ss_pred             --C-----------cccCC-CCCCCccceeecccccCCcchhcccccccCccceeEecCCCCCccccCcccccccCCCcc
Q 045318         1238 --L-----------GSFTA-DCFPTKVSALGIDYLTIHKPFFELGLRRFTSLRELRLYGGSRDVVAFPPEDTKMALPASL 1303 (1388)
Q Consensus      1238 --l-----------~~~~~-~~~~~~L~~L~l~~~~l~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~sL 1303 (1388)
                        .           ...|. .+-.++|+.|++++|.+.+.++. .++++++|+.|+|++| ...+.+|...   ..+++|
T Consensus       608 ~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~-~l~~l~~L~~L~Ls~N-~l~g~ip~~l---~~L~~L  682 (768)
T 3rgz_A          608 STRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK-EIGSMPYLFILNLGHN-DISGSIPDEV---GDLRGL  682 (768)
T ss_dssp             GGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCG-GGGGCTTCCEEECCSS-CCCSCCCGGG---GGCTTC
T ss_pred             ccccccccccceecccCchhhhccccccEEECcCCcccccCCH-HHhccccCCEEeCcCC-ccCCCCChHH---hCCCCC
Confidence              0           00010 01236799999999999877775 5889999999999994 4556777765   678999


Q ss_pred             ceeecccCCCCCCcc-CCCCCCCcCcEeecCCCCCccCCCCCCCCccceeeeccCcchH----HHhcccCCCCCCccccc
Q 045318         1304 TFLWIDNFPNLLRLS-SIENLTSLQFLRFRNCPKLEYFPENGLPTSLLRLQIIACPLMK----ERCKKEKGHYWPLIADL 1378 (1388)
Q Consensus      1304 ~~L~l~~~~~l~~l~-~~~~l~~L~~L~l~~c~~l~~l~~~~l~~sL~~L~i~~c~~L~----~~~~~~~~~~~~~~~~~ 1378 (1388)
                      +.|++++|...+.+| .+.++++|++|++++|+--..+|..+...++....+.+||.|-    ..|....+++|++|+|+
T Consensus       683 ~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~  762 (768)
T 3rgz_A          683 NILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS  762 (768)
T ss_dssp             CEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC----------
T ss_pred             CEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCc
Confidence            999999999777888 8999999999999996544578887777788888888887532    27999999999999999


Q ss_pred             cceE
Q 045318         1379 PSVE 1382 (1388)
Q Consensus      1379 ~~~~ 1382 (1388)
                      |++.
T Consensus       763 ~~~~  766 (768)
T 3rgz_A          763 HHHH  766 (768)
T ss_dssp             ----
T ss_pred             cccC
Confidence            9864

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X*	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11	Back alignment and structure

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ...	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B*	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A*	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8}	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ...	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D*	Back alignment and structure

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A*	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}	Back alignment and structure

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*	Back alignment and structure

>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A*	Back alignment and structure

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D*	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A	Back alignment and structure

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*	Back alignment and structure

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*	Back alignment and structure

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*	Back alignment and structure

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1388
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-43
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  157 bits (397), Expect = 2e-43
 Identities = 36/277 (12%), Positives = 87/277 (31%), Gaps = 33/277 (11%)

Query: 165 KKVIQERLPATSLVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKT 224
           ++++  +L   ++  +   + R+     +++ L        CD   F + + G  G GK+
Sbjct: 4   RQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEM-----CDLDSFFLFLHGRAGSGKS 58

Query: 225 TLAQLVYNDH--MVESHFDLKAWTCVSDDFDAIKVTKAILRSIC----------MHTDAD 272
            +A    +    ++  ++D   W   S               +              +  
Sbjct: 59  VIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHV 118

Query: 273 DDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIVTTRNQSVA 332
             +   ++     + R   L V DD+  +    W        A     + +VTTR+  ++
Sbjct: 119 TSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW--------AQELRLRCLVTTRDVEIS 170

Query: 333 -SMMGSVSAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKT 391
            +   +    E+  L  D+C      + +        +    +  + ++  +G P     
Sbjct: 171 NAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEED---VLNKTIELSSGNPATLMM 227

Query: 392 LGGLLRGKSNPFDWRNVLNNKIWNLPEEGGDIMRALK 428
                  K+        LNNK+ +       +     
Sbjct: 228 FFKSCEPKTFE-KMAQ-LNNKLESRGLV--GVECITP 260

PyMOL of d2a5yb3

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1388
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	100.0
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.78
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.69
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.66
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.65
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.65
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.53
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.51
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.48
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.41
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.37
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.36
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.35
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.27
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.26
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.22
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.15
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.15
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.08
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.06
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.06
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.04
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.02
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.01
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.98
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.95
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	98.94
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.89
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.85
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.82
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.75
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.7
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.7
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.5
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	98.5
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	98.48
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.47
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	98.47
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	98.45
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	98.41
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	98.33
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	98.32
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	98.3
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.3
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	98.27
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.16
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	98.14
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.13
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	98.04
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	97.97
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	97.9
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	97.79
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	97.78
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	97.75
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.63
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	97.54
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	97.45
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.38
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.34
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	97.28
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	97.19
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	96.8
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	96.37
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	96.09
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.9
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	95.45
d2qy9a2		211	GTPase domain of the signal recognition particle r	95.39
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	95.32
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	95.29
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	95.27
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	95.26
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	95.23
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	95.2
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	95.13
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	95.1
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	95.09
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	94.92
d1j8yf2		211	GTPase domain of the signal sequence recognition p	94.85
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	94.78
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	94.7
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.68
d1okkd2		207	GTPase domain of the signal recognition particle r	94.68
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	94.65
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	94.65
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	94.55
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	94.54
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	94.48
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	94.44
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	94.43
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	94.39
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	94.39
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	94.25
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	94.21
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	94.2
d1vmaa2		213	GTPase domain of the signal recognition particle r	94.15
d1ls1a2		207	GTPase domain of the signal sequence recognition p	94.04
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	94.01
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	94.0
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	93.93
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	93.92
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	93.88
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	93.83
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	93.83
d1xpua3		289	Transcription termination factor Rho, ATPase domai	93.77
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	93.65
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	93.53
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	93.52
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	93.37
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	92.88
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	92.77
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	92.53
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	92.51
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	92.41
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	92.37
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	92.26
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	92.23
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	91.99
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	91.8
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	91.58
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	91.57
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	91.51
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	91.45
d1fx0a3		276	Central domain of alpha subunit of F1 ATP synthase	91.34
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	91.32
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	91.25
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	90.92
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	90.91
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	90.86
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	90.86
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	90.84
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	90.61
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	90.39
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	90.21
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	89.93
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	89.88
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	89.64
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	89.58
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	89.46
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	89.42
d1g2912		240	Maltose transport protein MalK, N-terminal domain	89.37
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	89.27
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	89.25
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	89.15
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	88.88
d2awna2		232	Maltose transport protein MalK, N-terminal domain	88.8
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	88.76
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	88.76
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	88.71
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	88.7
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	88.59
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	88.48
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	88.46
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	88.45
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	88.33
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	88.14
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	88.03
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	88.03
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	88.01
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	87.83
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	87.76
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	87.7
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	87.69
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	87.65
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	87.55
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	87.46
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	87.4
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	87.36
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	87.32
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	87.23
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	87.16
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	86.95
d2jdia3		285	Central domain of alpha subunit of F1 ATP synthase	86.87
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	86.84
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	86.72
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	86.64
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	86.54
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	86.53
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	86.46
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	86.46
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	86.39
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	86.35
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	86.28
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	86.27
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	86.22
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	86.16
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	86.07
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	86.04
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	86.0
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	85.82
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	85.78
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	85.77
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	85.72
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	85.57
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	85.52
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	85.49
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	85.48
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	85.46
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	85.37
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	85.25
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	85.17
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	85.11
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	85.11
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	85.07
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	84.8
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	84.8
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	84.79
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	84.77
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	84.74
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	84.72
d1nrjb_		209	Signal recognition particle receptor beta-subunit	84.51
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	84.5
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	84.45
d1wb9a2		234	DNA repair protein MutS, the C-terminal domain {Es	84.35
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	84.26
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	84.26
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	84.08
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	84.05
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	84.03
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	83.99
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	83.9
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	83.89
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	83.88
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	83.83
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	83.7
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	83.65
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	83.62
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	83.57
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	83.55
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	83.29
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	83.27
d2fh5b1		207	Signal recognition particle receptor beta-subunit	83.05
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	82.91
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	82.88
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	82.86
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	82.72
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	82.54
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	82.45
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	82.45
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	82.35
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	82.18
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	81.96
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	81.71
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	81.49
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	81.38
d1mkya2		186	Probable GTPase Der, N-terminal and middle domains	81.14
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	81.09
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	81.0
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	80.89
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	80.39
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	80.38
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	80.1

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=5e-33  Score=304.46  Aligned_cols=217  Identities=13%  Similarity=0.091  Sum_probs=170.6

Q ss_pred             cccCCccccchhhHHHHHHHHhcCCCCCCCCCCcEEEEEEcCCCChHHHHHHHHhcCcc--ccccCCceEEEEeCCccCH
Q 045318          177 LVNEAEVHGRDDDKKAIVELLLNDDLNADCDGGLFVIPIVGMGGLGKTTLAQLVYNDHM--VESHFDLKAWTCVSDDFDA  254 (1388)
Q Consensus       177 ~~~~~~~vGr~~~~~~l~~~l~~~~~~~~~~~~~~vv~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~~s~~~~~  254 (1388)
                      .+.++.++||+.++++|+++|.....     ...++|+|+||||+||||||+++|++.+  .+.+|++++||++++.++.
T Consensus        16 ~p~~~~~~gR~~~~~~i~~~L~~~~~-----~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~   90 (277)
T d2a5yb3          16 VPKQMTCYIREYHVDRVIKKLDEMCD-----LDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPK   90 (277)
T ss_dssp             CBCCCCSCCCHHHHHHHHHHHHHHTT-----SSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTT
T ss_pred             CCCCCceeCcHHHHHHHHHHHHhccC-----CCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCH
Confidence            33556789999999999999975322     4568999999999999999999998643  6778999999999999988


Q ss_pred             HHHHHHHHHHh---cCCCC-------CCCcHHHHHHHHHhhcCCceEEEEEeCCCCCChhhhhhhcccccCCCCCcEEEE
Q 045318          255 IKVTKAILRSI---CMHTD-------ADDDLNSLQVKLKDGLSRKKFLLVLDDMWNDNYGDWTSLRLPFVAGASGSKIIV  324 (1388)
Q Consensus       255 ~~~~~~i~~~l---~~~~~-------~~~~~~~~~~~l~~~l~~k~~LlVlDdv~~~~~~~~~~l~~~~~~~~~gs~iiv  324 (1388)
                      ..+...+...+   +....       ...+.......+.+.+.++|+|+||||||+.  ..|+.+.      ..||||||
T Consensus        91 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilv  162 (277)
T d2a5yb3          91 STFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLV  162 (277)
T ss_dssp             HHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEE
T ss_pred             HHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEE
Confidence            77766654433   22111       1122333445677889999999999999986  4555432      25899999


Q ss_pred             EcCChhHHhhcCCC-ceEeCCCCChhhHHHHHHHcccCCCCCCCCchHHHHHHHHHHHcCCChHHHHHHHHhhcCCCCHH
Q 045318          325 TTRNQSVASMMGSV-SAYELKKLTDDDCRLVFTQHSLGTKDFSNHQHLKEIGEEILKKCNGLPLAAKTLGGLLRGKSNPF  403 (1388)
Q Consensus       325 TtR~~~v~~~~~~~-~~~~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~~~~i~~~c~g~Plai~~~~~~l~~~~~~~  403 (1388)
                      |||++.|+..+... ..|+|++|+.+|||+||..++|...   ..+..++++++|+++|+|+|||++++|+.|+.+ +.+
T Consensus       163 TTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~---~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~  238 (277)
T d2a5yb3         163 TTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFE  238 (277)
T ss_dssp             EESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHH
T ss_pred             EeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCcc---CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHH
Confidence            99999999876554 6799999999999999999987543   234567899999999999999999999999877 566


Q ss_pred             HHHHHHh
Q 045318          404 DWRNVLN  410 (1388)
Q Consensus       404 ~w~~~~~  410 (1388)
                      .|.+..+
T Consensus       239 ~~~~~~~  245 (277)
T d2a5yb3         239 KMAQLNN  245 (277)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            7776554

PyMOL of d2a5yb3

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure