Citrus Sinensis ID: 045344
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 627 | ||||||
| 255578801 | 481 | Glucan endo-1,3-beta-glucosidase precurs | 0.682 | 0.889 | 0.623 | 1e-153 | |
| 15238256 | 485 | O-Glycosyl hydrolases family 17 protein | 0.681 | 0.880 | 0.602 | 1e-151 | |
| 297794073 | 485 | glycosyl hydrolase family 17 protein [Ar | 0.681 | 0.880 | 0.604 | 1e-150 | |
| 449448574 | 483 | PREDICTED: glucan endo-1,3-beta-glucosid | 0.708 | 0.919 | 0.572 | 1e-147 | |
| 449515825 | 483 | PREDICTED: glucan endo-1,3-beta-glucosid | 0.708 | 0.919 | 0.572 | 1e-147 | |
| 449527187 | 487 | PREDICTED: glucan endo-1,3-beta-glucosid | 0.709 | 0.913 | 0.546 | 1e-143 | |
| 449463994 | 487 | PREDICTED: glucan endo-1,3-beta-glucosid | 0.709 | 0.913 | 0.542 | 1e-142 | |
| 308079983 | 488 | uncharacterized protein LOC100502325 pre | 0.684 | 0.879 | 0.594 | 1e-141 | |
| 224096380 | 485 | predicted protein [Populus trichocarpa] | 0.704 | 0.911 | 0.560 | 1e-141 | |
| 225438519 | 481 | PREDICTED: glucan endo-1,3-beta-glucosid | 0.706 | 0.920 | 0.578 | 1e-141 |
| >gi|255578801|ref|XP_002530257.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] gi|223530223|gb|EEF32127.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 549 bits (1414), Expect = e-153, Method: Compositional matrix adjust.
Identities = 268/430 (62%), Positives = 327/430 (76%), Gaps = 2/430 (0%)
Query: 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLF 242
+GVNWGN+ASHPLP I+V+MLKDN I R KLFDAD +V LA +GIEVMVAIPN ML
Sbjct: 29 IGVNWGNIASHPLPPDIVVKMLKDNNINRVKLFDADAWTVNALAGSGIEVMVAIPNNMLQ 88
Query: 243 DMAVDYSNAQNWVKENVTRWVK-DGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQ 301
+A NA++WVKENVT +++ G V ++YVAVGNEPFL SYN S+ K TFPAL+NVQ+
Sbjct: 89 YIADSVDNAKDWVKENVTEYLRGQGGVDIRYVAVGNEPFLASYNGSYDKTTFPALQNVQK 148
Query: 302 ALVEAGHGKMVKATVPLNADVYEGTLPSDGVFRKDIKQHIDNILKNLHDNKSPFIVNIYP 361
AL E G G +KA+VPLNADVYEG LPS G FRKD++ + I+ +LHD+K+PFIVNIYP
Sbjct: 149 ALDEEGVGDKIKASVPLNADVYEGNLPSQGNFRKDVRDVMTKIVHHLHDHKAPFIVNIYP 208
Query: 362 FLSLYESPDFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIGE 421
F+SLY+S FP EYAFF+ G K +QDKN YTNV + NYDTL+ +LKKAG PD+KI++GE
Sbjct: 209 FISLYQSSSFPFEYAFFDGGGKKIQDKNVTYTNVFEANYDTLVWSLKKAGVPDLKILVGE 268
Query: 422 IGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGK 481
+GWPTDGH A + A+KFYDGL K LA + GTPLRPG DVYLFG LDED KS PG
Sbjct: 269 VGWPTDGHVYANANLAKKFYDGLLKTLAAKKGTPLRPGV-LDVYLFGLLDEDMKSNLPGN 327
Query: 482 FERHWGIFRFDGQPKFPIDFTGRGQNKMPVGAKGVKYYDHKWCVLDKGVTNFDLVDQQLF 541
FERHWGIFRFDG+PKF +DF+G+G +KM + AKGV+Y KWCVL+K V + ++ ++
Sbjct: 328 FERHWGIFRFDGRPKFAMDFSGQGNDKMLIEAKGVQYLPAKWCVLNKEVESKSMIPAEIS 387
Query: 542 KACQEGDCTATEPGSSCSGLDNLTKVSYAFNMYFQMNQQVNKACDFEGLALITDKNASVG 601
AC DC++ GSSC+ LD+ VSYAFNMYFQMN Q +ACDF GLA I +NAS G
Sbjct: 388 YACSLADCSSLAYGSSCNKLDSDGNVSYAFNMYFQMNNQDVQACDFSGLATIVTQNASRG 447
Query: 602 NCLFPIQIDS 611
CLFPIQI S
Sbjct: 448 TCLFPIQIVS 457
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15238256|ref|NP_201284.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana] gi|8843743|dbj|BAA97291.1| beta-1,3-glucanase [Arabidopsis thaliana] gi|332010568|gb|AED97951.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297794073|ref|XP_002864921.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. lyrata] gi|297310756|gb|EFH41180.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449448574|ref|XP_004142041.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449515825|ref|XP_004164948.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449527187|ref|XP_004170594.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449463994|ref|XP_004149714.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|308079983|ref|NP_001183732.1| uncharacterized protein LOC100502325 precursor [Zea mays] gi|238014242|gb|ACR38156.1| unknown [Zea mays] gi|413954510|gb|AFW87159.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|224096380|ref|XP_002310612.1| predicted protein [Populus trichocarpa] gi|222853515|gb|EEE91062.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225438519|ref|XP_002275701.1| PREDICTED: glucan endo-1,3-beta-glucosidase 8 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 627 | ||||||
| TAIR|locus:2177624 | 485 | AT5G64790 [Arabidopsis thalian | 0.684 | 0.884 | 0.599 | 6.1e-142 | |
| TAIR|locus:2047650 | 478 | AT2G19440 [Arabidopsis thalian | 0.725 | 0.951 | 0.550 | 4e-129 | |
| TAIR|locus:2010916 | 481 | AT1G64760 [Arabidopsis thalian | 0.704 | 0.918 | 0.548 | 1.4e-126 | |
| TAIR|locus:2172379 | 488 | AT5G18220 [Arabidopsis thalian | 0.673 | 0.864 | 0.560 | 9.9e-126 | |
| TAIR|locus:2095923 | 491 | AT3G04010 [Arabidopsis thalian | 0.676 | 0.863 | 0.553 | 1.3e-125 | |
| TAIR|locus:2126286 | 484 | AT4G31140 [Arabidopsis thalian | 0.673 | 0.871 | 0.491 | 1.8e-112 | |
| TAIR|locus:2087198 | 500 | AT3G24330 [Arabidopsis thalian | 0.684 | 0.858 | 0.504 | 9.7e-112 | |
| TAIR|locus:2155841 | 477 | AT5G58090 [Arabidopsis thalian | 0.706 | 0.928 | 0.481 | 1.2e-111 | |
| TAIR|locus:2147112 | 501 | AT5G20870 [Arabidopsis thalian | 0.687 | 0.860 | 0.494 | 6.8e-111 | |
| TAIR|locus:2130639 | 475 | AT4G17180 [Arabidopsis thalian | 0.681 | 0.898 | 0.451 | 2.7e-100 |
| TAIR|locus:2177624 AT5G64790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1388 (493.7 bits), Expect = 6.1e-142, P = 6.1e-142
Identities = 259/432 (59%), Positives = 322/432 (74%)
Query: 184 GVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLFD 243
GVNWGN+ASHPL I+VQMLKDN I + KLFDAD ++ LA TG+EVMV IPN +L
Sbjct: 29 GVNWGNIASHPLNPNIVVQMLKDNKINKVKLFDADSWTMNALAGTGMEVMVGIPNNLLES 88
Query: 244 MAVDYSNAQNWVKENVTRWVKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQAL 303
+A DY NA++WVKENVT++++ G V +KYVAVGNEPFL +YN SF+K TFPALKN+ +AL
Sbjct: 89 LADDYDNAKDWVKENVTQYIRKGGVDIKYVAVGNEPFLSAYNGSFLKTTFPALKNIHKAL 148
Query: 304 VEAGHGKMVKATVPLNADVYEGT--LPSDGVFRKDIKQHIDNILKNLHDNKSPFIVNIYP 361
EAGH ++KAT+P NA+VY+ PS+G FRKD+KQ + +I+ H+N PF VNIYP
Sbjct: 149 KEAGHTNIMKATIPQNAEVYQSANDKPSEGDFRKDVKQTMLDIVNFFHENDLPFTVNIYP 208
Query: 362 FLSLYESPDFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIGE 421
FLSLY + FPVE+AF + + + DK Y NV D NYDTL+ ALKKAG DMKII+GE
Sbjct: 209 FLSLYLNEHFPVEFAFLDGDGQTMTDKGKNYDNVFDANYDTLVYALKKAGIHDMKIIVGE 268
Query: 422 IGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGK 481
+GWPTDGHK A+ + A+KFY GL K+LAK GTP RP +VYLFGFLDED KSI PG
Sbjct: 269 VGWPTDGHKYASPKLAEKFYAGLMKRLAKDGGTPTRP-ERLEVYLFGFLDEDMKSILPGP 327
Query: 482 FERHWGIFRFDGQPKFPIDFTGRGQNKMPVGAKGVKYYDHKWCVLDKGVTNFDLVDQQLF 541
FERHWGIFR+DG PKF +DFTG+G+ +PV AKGV+Y + +WCV++K N D V L
Sbjct: 328 FERHWGIFRYDGTPKFMLDFTGQGRQMVPVAAKGVQYLEKQWCVVNKDTVNLDEVGPDLD 387
Query: 542 KACQEGDCTATEPGSSCSGLDNLTKVSYAFNMYFQMNQQVNKACDFEGLALITDKNASVG 601
AC GDCTA E GS+CS L + +SYAFNMYFQ+ Q +ACDF+G A+IT NASVG
Sbjct: 388 YACYHGDCTAMEAGSTCSKLTKVQNISYAFNMYFQIQDQDVRACDFKGAAMITKVNASVG 447
Query: 602 NCLFPIQIDSAA 613
+CLFP+QI S +
Sbjct: 448 SCLFPVQIVSGS 459
|
|
| TAIR|locus:2047650 AT2G19440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010916 AT1G64760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172379 AT5G18220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095923 AT3G04010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2126286 AT4G31140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087198 AT3G24330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155841 AT5G58090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147112 AT5G20870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130639 AT4G17180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 627 | |||
| pfam00332 | 310 | pfam00332, Glyco_hydro_17, Glycosyl hydrolases fam | 3e-59 | |
| smart00768 | 85 | smart00768, X8, Possibly involved in carbohydrate | 6e-22 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 5e-14 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 5e-12 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 3e-11 | |
| pfam07983 | 77 | pfam07983, X8, X8 domain | 1e-10 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 4e-08 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 5e-08 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 2e-06 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 4e-06 | |
| PHA02584 | 1229 | PHA02584, 34, long tail fiber, proximal subunit; P | 7e-06 | |
| COG5651 | 490 | COG5651, COG5651, PPE-repeat proteins [Cell motili | 1e-05 | |
| PHA02584 | 1229 | PHA02584, 34, long tail fiber, proximal subunit; P | 2e-05 | |
| pfam11593 | 381 | pfam11593, Med3, Mediator complex subunit 3 fungal | 5e-05 | |
| pfam11593 | 381 | pfam11593, Med3, Mediator complex subunit 3 fungal | 5e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 6e-05 | |
| pfam12810 | 248 | pfam12810, Gly_rich, Glycine rich protein | 1e-04 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 2e-04 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 2e-04 | |
| COG2931 | 510 | COG2931, COG2931, RTX toxins and related Ca2+-bind | 2e-04 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 4e-04 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 4e-04 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 4e-04 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 5e-04 | |
| PHA00370 | 297 | PHA00370, III, attachment protein | 5e-04 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 5e-04 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 6e-04 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 7e-04 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 7e-04 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 7e-04 | |
| PTZ00112 | 1164 | PTZ00112, PTZ00112, origin recognition complex 1 p | 7e-04 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 8e-04 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 8e-04 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 8e-04 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 8e-04 | |
| COG5651 | 490 | COG5651, COG5651, PPE-repeat proteins [Cell motili | 9e-04 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 9e-04 | |
| PHA02584 | 1229 | PHA02584, 34, long tail fiber, proximal subunit; P | 0.001 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.001 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 0.001 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.001 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.001 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 0.001 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 0.001 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 0.001 | |
| COG5651 | 490 | COG5651, COG5651, PPE-repeat proteins [Cell motili | 0.002 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.002 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 0.002 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 0.002 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 0.002 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 0.002 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.002 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.002 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.002 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.002 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 0.002 | |
| PRK08581 | 619 | PRK08581, PRK08581, N-acetylmuramoyl-L-alanine ami | 0.002 | |
| PHA02584 | 1229 | PHA02584, 34, long tail fiber, proximal subunit; P | 0.003 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.003 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 0.003 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.003 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.003 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.003 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.003 | |
| COG3210 | 1013 | COG3210, FhaB, Large exoproteins involved in heme | 0.003 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 0.003 | |
| COG3188 | 835 | COG3188, FimD, P pilus assembly protein, porin Pap | 0.003 | |
| pfam08601 | 344 | pfam08601, PAP1, Transcription factor PAP1 | 0.003 | |
| PTZ00470 | 522 | PTZ00470, PTZ00470, glycoside hydrolase family 47 | 0.004 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 0.004 | |
| PRK13914 | 481 | PRK13914, PRK13914, invasion associated secreted e | 0.004 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.004 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 0.004 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.004 | |
| pfam09580 | 169 | pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotei | 0.004 | |
| PTZ00287 | 1419 | PTZ00287, PTZ00287, 6-phosphofructokinase; Provisi | 0.004 | |
| PTZ00287 | 1419 | PTZ00287, PTZ00287, 6-phosphofructokinase; Provisi | 0.004 | |
| COG5099 | 777 | COG5099, COG5099, RNA-binding protein of the Puf f | 0.004 |
| >gnl|CDD|215863 pfam00332, Glyco_hydro_17, Glycosyl hydrolases family 17 | Back alignment and domain information |
|---|
Score = 200 bits (510), Expect = 3e-59
Identities = 108/321 (33%), Positives = 179/321 (55%), Gaps = 13/321 (4%)
Query: 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLF 242
+GV +G ++ +V + K N I+R +++D D ++K L +GI V++ +PN L
Sbjct: 1 IGVCYGVKGNNLPSPSDVVSLYKSNNIRRMRIYDPDTKALKALRGSGINVILGVPNDDLA 60
Query: 243 DMAVDYSNAQNWVKENVTRWVKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQA 302
++A SNA +WV++NV + VK++Y+AVGNE SF+ PA++N++ A
Sbjct: 61 ELAGSQSNAASWVQDNVRPYAPK--VKIRYIAVGNE-VSPGTTQSFL---VPAMRNIRNA 114
Query: 303 LVEAGHGKMVKATVPLNADVYEGTLP-SDGVFRKDIKQHIDNILKNLHDNKSPFIVNIYP 361
L AG G +K + + D+ + P S G FR + + +D I+ L +P + N+YP
Sbjct: 115 LTAAGLGNKIKVSTSVRFDILGNSFPPSYGSFRVETRSFMDPIIVFLAGTNAPLLANVYP 174
Query: 362 FLSLYESP-DFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIG 420
+ + +P D + YA F+ G + Y N+ D D + +AL+KAG P +++++
Sbjct: 175 YFAYSNNPRDISLNYALFQPGTTVVDGGL-GYQNLFDAMVDAVYAALEKAGGPSVEVVVS 233
Query: 421 EIGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPG 480
E GWP+DG AAT ++A+ + L + K GTP RPG + Y+F DE+ K
Sbjct: 234 ESGWPSDGGFAATIENARTYNQNLINHVKK--GTPKRPGWAIETYVFAMFDENQKP--GE 289
Query: 481 KFERHWGIFRFDGQPKFPIDF 501
E+H+G+F + QPK+PIDF
Sbjct: 290 SVEKHFGLFYPNKQPKYPIDF 310
|
Length = 310 |
| >gnl|CDD|197867 smart00768, X8, Possibly involved in carbohydrate binding | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219681 pfam07983, X8, X8 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222890 PHA02584, 34, long tail fiber, proximal subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|222890 PHA02584, 34, long tail fiber, proximal subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221143 pfam11593, Med3, Mediator complex subunit 3 fungal | Back alignment and domain information |
|---|
| >gnl|CDD|221143 pfam11593, Med3, Mediator complex subunit 3 fungal | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|221784 pfam12810, Gly_rich, Glycine rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225483 COG2931, COG2931, RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|164795 PHA00370, III, attachment protein | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|240274 PTZ00112, PTZ00112, origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222890 PHA02584, 34, long tail fiber, proximal subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222890 PHA02584, 34, long tail fiber, proximal subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|225751 COG3210, FhaB, Large exoproteins involved in heme utilization or adhesion [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|225729 COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|219927 pfam08601, PAP1, Transcription factor PAP1 | Back alignment and domain information |
|---|
| >gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237555 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|220296 pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) | Back alignment and domain information |
|---|
| >gnl|CDD|240345 PTZ00287, PTZ00287, 6-phosphofructokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240345 PTZ00287, PTZ00287, 6-phosphofructokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227430 COG5099, COG5099, RNA-binding protein of the Puf family, translational repressor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| PF00332 | 310 | Glyco_hydro_17: Glycosyl hydrolases family 17; Int | 100.0 | |
| COG5309 | 305 | Exo-beta-1,3-glucanase [Carbohydrate transport and | 100.0 | |
| smart00768 | 85 | X8 Possibly involved in carbohydrate binding. The | 99.93 | |
| PF07983 | 78 | X8: X8 domain; InterPro: IPR012946 The X8 domain [ | 99.81 | |
| PF03198 | 314 | Glyco_hydro_72: Glucanosyltransferase; InterPro: I | 99.22 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 99.18 | |
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 98.23 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 98.09 | |
| PRK10150 | 604 | beta-D-glucuronidase; Provisional | 98.02 | |
| smart00633 | 254 | Glyco_10 Glycosyl hydrolase family 10. | 97.74 | |
| PF11790 | 239 | Glyco_hydro_cc: Glycosyl hydrolase catalytic core; | 97.27 | |
| PF02836 | 298 | Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM | 97.21 | |
| PF00232 | 455 | Glyco_hydro_1: Glycosyl hydrolase family 1; InterP | 97.02 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 96.99 | |
| PLN02814 | 504 | beta-glucosidase | 95.62 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 95.62 | |
| PRK13511 | 469 | 6-phospho-beta-galactosidase; Provisional | 95.42 | |
| PLN02998 | 497 | beta-glucosidase | 95.41 | |
| PLN02849 | 503 | beta-glucosidase | 95.03 | |
| PRK15014 | 477 | 6-phospho-beta-glucosidase BglA; Provisional | 94.42 | |
| PRK09593 | 478 | arb 6-phospho-beta-glucosidase; Reviewed | 93.96 | |
| PRK09589 | 476 | celA 6-phospho-beta-glucosidase; Reviewed | 91.65 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 91.31 | |
| PF01229 | 486 | Glyco_hydro_39: Glycosyl hydrolases family 39; Int | 90.58 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 89.92 | |
| PRK10340 | 1021 | ebgA cryptic beta-D-galactosidase subunit alpha; R | 85.61 | |
| COG3934 | 587 | Endo-beta-mannanase [Carbohydrate transport and me | 85.25 | |
| PRK09525 | 1027 | lacZ beta-D-galactosidase; Reviewed | 84.31 |
| >PF00332 Glyco_hydro_17: Glycosyl hydrolases family 17; InterPro: IPR000490 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-83 Score=673.17 Aligned_cols=308 Identities=39% Similarity=0.747 Sum_probs=252.9
Q ss_pred ceeeeCCCCCCCCCHHHHHHHHHhCCCCEEEEecCChHHHHHHHhcCCEEEEeeCCChhhhhhhchHHHHHHHHHhhccc
Q 045344 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLFDMAVDYSNAQNWVKENVTRW 262 (627)
Q Consensus 183 iGVnYG~~~~nlpsp~~Vv~lLks~~i~~VRlYdaD~~VL~Ala~tgIkV~VGV~n~~l~~la~s~~~A~~Wv~~nV~~y 262 (627)
||||||+.|++||+|.+|++|||+++|++||||++|+.||+||++|||+|+|+|+|++|+++++++..|..||+++|.+|
T Consensus 1 iGvnyG~~~~nlp~p~~vv~l~ks~~i~~vri~d~~~~iL~a~a~S~i~v~v~vpN~~l~~la~~~~~A~~Wv~~nv~~~ 80 (310)
T PF00332_consen 1 IGVNYGRVGNNLPSPCKVVSLLKSNGITKVRIYDADPSILRAFAGSGIEVMVGVPNEDLASLASSQSAAGSWVRTNVLPY 80 (310)
T ss_dssp EEEEE---SSS---HHHHHHHHHHTT--EEEESS--HHHHHHHTTS--EEEEEE-GGGHHHHHHHHHHHHHHHHHHTCTC
T ss_pred CeEeccCccCCCCCHHHHHHHHHhcccccEEeecCcHHHHHHHhcCCceeeeccChHHHHHhccCHHHHhhhhhhccccc
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCceEEEEEecccccccCCCccchhhHHHHHHHHHHHHHHcCCCcceEEecccccccccc-cCCCCccccchhhHHH
Q 045344 263 VKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQALVEAGHGKMVKATVPLNADVYEG-TLPSDGVFRKDIKQHI 341 (627)
Q Consensus 263 ~p~~~t~I~~I~VGNEvL~~~~~~~~~~~Llpam~nI~~aL~~agl~~~IkVsT~~s~~vl~~-~pPS~g~F~~d~~~~l 341 (627)
+| .++|++|+||||++.... ...|||||+++|++|++++|+++|||+|++++++|.. ||||+|.|++++.++|
T Consensus 81 ~~--~~~i~~i~VGnEv~~~~~----~~~lvpAm~ni~~aL~~~~L~~~IkVst~~~~~vl~~s~PPS~g~F~~~~~~~~ 154 (310)
T PF00332_consen 81 LP--AVNIRYIAVGNEVLTGTD----NAYLVPAMQNIHNALTAAGLSDQIKVSTPHSMDVLSNSFPPSAGVFRSDIASVM 154 (310)
T ss_dssp TT--TSEEEEEEEEES-TCCSG----GGGHHHHHHHHHHHHHHTT-TTTSEEEEEEEGGGEEE-SSGGG-EESHHHHHHH
T ss_pred Cc--ccceeeeecccccccCcc----ceeeccHHHHHHHHHHhcCcCCcceeccccccccccccCCCccCcccccchhhh
Confidence 97 599999999999987532 2289999999999999999998999999999999998 9999999999999999
Q ss_pred HHHHHHhhhcCCCceeccCcccccCCCC-CCCccccccccCCcccccCCccchhhhhhhHHHHHHHHHHhCCCCceEEEc
Q 045344 342 DNILKNLHDNKSPFIVNIYPFLSLYESP-DFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIG 420 (627)
Q Consensus 342 ~~lldFL~~t~sp~~vNiYPff~~~~~~-~i~ldyAlF~~~~~~v~D~g~~YtNlfDaqvDav~~Am~k~g~~~~~VvIt 420 (627)
+++++||.+|+||||+|+||||++..+| .|+|+||+|++....+ |++++|++|||+|+|++++||+|+|+++++||||
T Consensus 155 ~~~l~fL~~t~spf~vN~yPyfa~~~~~~~~~l~yAlf~~~~~~~-D~~~~y~nlfDa~~da~~~a~~~~g~~~~~vvv~ 233 (310)
T PF00332_consen 155 DPLLKFLDGTNSPFMVNVYPYFAYQNNPQNISLDYALFQPNSGVV-DGGLAYTNLFDAMVDAVYAAMEKLGFPNVPVVVG 233 (310)
T ss_dssp HHHHHHHHHHT--EEEE--HHHHHHHSTTTS-HHHHTT-SSS-SE-ETTEEESSHHHHHHHHHHHHHHTTT-TT--EEEE
T ss_pred hHHHHHhhccCCCceeccchhhhccCCcccCCccccccccccccc-ccchhhhHHHHHHHHHHHHHHHHhCCCCceeEEe
Confidence 9999999999999999999999999997 8999999999987555 9999999999999999999999999999999999
Q ss_pred eeccCCCCCCCCCHHHHHHHHHHHHHHHHhcCCCCCCCCCcccEEEEeeeccccccCCCCCcccceeeeecCCCCccccc
Q 045344 421 EIGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGKFERHWGIFRFDGQPKFPID 500 (627)
Q Consensus 421 ETGWPS~G~~~AS~~NA~~y~~nli~~~~s~~GTP~rPg~~ie~yiFelFDE~wK~~~pg~~Er~wGLF~~dgtpKy~l~ 500 (627)
||||||+|+..|++++|++|++++++|+. +|||+||+..+++||||||||+||++ ..+|||||||++||+|||+|+
T Consensus 234 ETGWPs~G~~~a~~~nA~~~~~nl~~~~~--~gt~~~~~~~~~~y~F~~FdE~~K~~--~~~E~~wGlf~~d~~~ky~~~ 309 (310)
T PF00332_consen 234 ETGWPSAGDPGATPENAQAYNQNLIKHVL--KGTPLRPGNGIDVYIFEAFDENWKPG--PEVERHWGLFYPDGTPKYDLD 309 (310)
T ss_dssp EE---SSSSTTCSHHHHHHHHHHHHHHCC--GBBSSSBSS---EEES-SB--TTSSS--SGGGGG--SB-TTSSBSS---
T ss_pred ccccccCCCCCCCcchhHHHHHHHHHHHh--CCCcccCCCCCeEEEEEEecCcCCCC--CcccceeeeECCCCCeecCCC
Confidence 99999999999999999999999999997 59999999889999999999999973 249999999999999999998
Q ss_pred c
Q 045344 501 F 501 (627)
Q Consensus 501 ~ 501 (627)
|
T Consensus 310 f 310 (310)
T PF00332_consen 310 F 310 (310)
T ss_dssp -
T ss_pred C
Confidence 6
|
2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 17 GH17 from CAZY comprises enzymes with several known activities; endo-1,3-beta-glucosidase (3.2.1.39 from EC); lichenase (3.2.1.73 from EC); exo-1,3-glucanase (3.2.1.58 from EC). Currently these enzymes have only been found in plants and in fungi. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1AQ0_B 1GHR_A 1GHS_B 2CYG_A 3UR8_A 3UR7_B 3EM5_C 3F55_D. |
| >COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00768 X8 Possibly involved in carbohydrate binding | Back alignment and domain information |
|---|
| >PF07983 X8: X8 domain; InterPro: IPR012946 The X8 domain [] contains 6 conserved cysteine residues that presumably form three disulphide bridges | Back alignment and domain information |
|---|
| >PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10150 beta-D-glucuronidase; Provisional | Back alignment and domain information |
|---|
| >smart00633 Glyco_10 Glycosyl hydrolase family 10 | Back alignment and domain information |
|---|
| >PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK13511 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PLN02998 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >PRK15014 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >PRK09593 arb 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PRK09589 celA 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09525 lacZ beta-D-galactosidase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 627 | ||||
| 3ur7_A | 323 | Higher-density Crystal Structure Of Potato Endo-1,3 | 1e-40 | ||
| 4gzi_A | 323 | Active-site Mutant Of Potato Endo-1,3-beta-glucanas | 6e-40 | ||
| 3em5_A | 316 | Crystal Structure Of A Native Endo Beta-1,3-Glucana | 8e-40 | ||
| 2cyg_A | 312 | Crystal Structure At 1.45- Resolution Of The Major | 2e-39 | ||
| 1aq0_A | 306 | Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space G | 4e-39 | ||
| 1ghs_A | 306 | The Three-Dimensional Structures Of Two Plant Beta- | 2e-32 | ||
| 2jon_A | 101 | Solution Structure Of The C-Terminal Domain Ole E 9 | 4e-07 |
| >pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase Length = 323 | Back alignment and structure |
|
| >pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose Length = 323 | Back alignment and structure |
| >pdb|3EM5|A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis Length = 316 | Back alignment and structure |
| >pdb|2CYG|A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome Length = 312 | Back alignment and structure |
| >pdb|1AQ0|A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group Length = 306 | Back alignment and structure |
| >pdb|1GHS|A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities Length = 306 | Back alignment and structure |
| >pdb|2JON|A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 Length = 101 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 627 | |||
| 1aq0_A | 306 | 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl | 9e-77 | |
| 3ur8_A | 323 | Glucan endo-1,3-beta-D-glucosidase; glucoside hydr | 5e-75 | |
| 2cyg_A | 312 | Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be | 1e-74 | |
| 3em5_A | 316 | Beta-1,3-glucanase; glycoprotein, rossmann fold, ( | 2e-73 | |
| 1ghs_A | 306 | 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg | 3e-69 | |
| 2jon_A | 101 | Beta-1,3-glucanase; olive pollen, allergen; NMR {O | 5e-23 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 2e-13 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 5e-13 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 1e-12 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 1e-12 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 2e-12 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 6e-12 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 3e-11 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 3e-11 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 6e-11 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 2e-10 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 5e-09 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 6e-06 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 2e-05 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 9e-05 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 1e-08 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 2e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 4e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 5e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 1e-05 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 9e-05 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 2e-04 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 3e-07 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 6e-07 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 7e-07 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 8e-07 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 3e-06 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 9e-06 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 1e-05 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 2e-05 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 4e-05 | |
| 3pr7_A | 311 | USPA1; beta-roll and coiled-coil, adhesin, extrace | 7e-04 | |
| 2xqh_A | 281 | Immunoglobulin-binding protein EIBD; cell adhesion | 2e-06 | |
| 2xqh_A | 281 | Immunoglobulin-binding protein EIBD; cell adhesion | 3e-05 | |
| 2xqh_A | 281 | Immunoglobulin-binding protein EIBD; cell adhesion | 5e-05 | |
| 2xqh_A | 281 | Immunoglobulin-binding protein EIBD; cell adhesion | 8e-05 | |
| 2xqh_A | 281 | Immunoglobulin-binding protein EIBD; cell adhesion | 5e-04 | |
| 1ru4_A | 400 | Pectate lyase, PEL9A; parallel beta-helix; 1.60A { | 3e-06 | |
| 1ru4_A | 400 | Pectate lyase, PEL9A; parallel beta-helix; 1.60A { | 8e-05 | |
| 1ru4_A | 400 | Pectate lyase, PEL9A; parallel beta-helix; 1.60A { | 2e-04 | |
| 1ru4_A | 400 | Pectate lyase, PEL9A; parallel beta-helix; 1.60A { | 7e-04 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 5e-06 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 6e-06 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 3e-05 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 4e-05 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 5e-05 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 6e-05 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 1e-04 | |
| 3gqn_A | 772 | Preneck appendage protein; beta helix, beta barrel | 6e-06 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 3e-05 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 7e-05 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 3e-04 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 5e-04 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 8e-04 | |
| 3laa_A | 200 | Haemagluttinin family protein; niaid, seattle stru | 5e-05 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 6e-05 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 9e-05 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 1e-04 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 1e-04 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 2e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 2e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 3e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 4e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 5e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 6e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 7e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 8e-04 | |
| 1wxr_A | 1048 | Haemoglobin protease; hemoglobine protease, autotr | 9e-04 | |
| 2qub_A | 615 | Extracellular lipase; beta roll, alpha/beta hydrol | 2e-04 | |
| 2qub_A | 615 | Extracellular lipase; beta roll, alpha/beta hydrol | 5e-04 | |
| 3sze_A | 968 | Serine protease ESPP; parallel beta-helix, hydrola | 2e-04 | |
| 1dbg_A | 506 | Chondroitinase B; beta helix, polysaccharide lyase | 2e-04 | |
| 1dbg_A | 506 | Chondroitinase B; beta helix, polysaccharide lyase | 3e-04 | |
| 3gw6_A | 275 | Endo-N-acetylneuraminidase; chaperone, glycosidase | 2e-04 | |
| 2dck_A | 354 | Xylanase J; family 11, xylan binding domain (XBM), | 3e-04 | |
| 2dck_A | 354 | Xylanase J; family 11, xylan binding domain (XBM), | 3e-04 | |
| 3syj_A | 1011 | Adhesion and penetration protein autotransporter; | 4e-04 | |
| 1k7i_A | 479 | PROC, secreted protease C; metalloprotease, hydrol | 4e-04 | |
| 1ocy_A | 198 | Bacteriophage T4 short tail fibre; structural prot | 5e-04 | |
| 1ocy_A | 198 | Bacteriophage T4 short tail fibre; structural prot | 7e-04 |
| >1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Length = 306 | Back alignment and structure |
|---|
Score = 246 bits (628), Expect = 9e-77
Identities = 98/320 (30%), Positives = 163/320 (50%), Gaps = 15/320 (4%)
Query: 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLF 242
+GV +G A++ A +V M K NGIK +L+ ++ +++ + TGI V+V PN +L
Sbjct: 1 IGVCYGMSANNLPAASTVVSMFKSNGIKSMRLYAPNQAALQAVGGTGINVVVGAPNDVLS 60
Query: 243 DMAVDYSNAQNWVKENVTRWVKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQA 302
++A + A +WVK N+ + V +YV VGNE ++ PA+KNV A
Sbjct: 61 NLAASPAAAASWVKSNIQAY---PKVSFRYVCVGNEV-----AGGATRNLVPAMKNVHGA 112
Query: 303 LVEAGHGKMVKATVPLNADVYEGTLPSDGVFRKDIKQHIDNILKNLHDNKSPFIVNIYPF 362
LV AG G + T A + + PS G F + + +++ L +P + NIYP+
Sbjct: 113 LVAAGLGHIKVTTSVSQAILGVFSPPSAGSFTGEAAAFMGPVVQFLARTNAPLMANIYPY 172
Query: 363 LSLYESPD-FPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIGE 421
L+ +P + YA F ++D + Y N+ D D +A+ K G +K+++ E
Sbjct: 173 LAWAYNPSAMDMGYALFNASGTVVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSE 232
Query: 422 IGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGK 481
GWP+ G AAT +A+ + L + + GTP PG + Y+F +E+ K
Sbjct: 233 SGWPSGGGTAATPANARFYNQHLINHVGR--GTPRHPGA-IETYIFAMFNENQK---DSG 286
Query: 482 FERHWGIFRFDGQPKFPIDF 501
E++WG+F + Q +PI+F
Sbjct: 287 VEQNWGLFYPNMQHVYPINF 306
|
| >3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Length = 323 | Back alignment and structure |
|---|
| >2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Length = 312 | Back alignment and structure |
|---|
| >3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} PDB: 3f55_A* Length = 316 | Back alignment and structure |
|---|
| >1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Length = 306 | Back alignment and structure |
|---|
| >2jon_A Beta-1,3-glucanase; olive pollen, allergen; NMR {Olea europaea} Length = 101 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Length = 562 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Length = 555 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >3pr7_A USPA1; beta-roll and coiled-coil, adhesin, extracellular, membrane; 2.94A {Moraxella catarrhalis} Length = 311 | Back alignment and structure |
|---|
| >2xqh_A Immunoglobulin-binding protein EIBD; cell adhesion, virulence, beta-helix; 1.99A {Escherichia coli} Length = 281 | Back alignment and structure |
|---|
| >2xqh_A Immunoglobulin-binding protein EIBD; cell adhesion, virulence, beta-helix; 1.99A {Escherichia coli} Length = 281 | Back alignment and structure |
|---|
| >2xqh_A Immunoglobulin-binding protein EIBD; cell adhesion, virulence, beta-helix; 1.99A {Escherichia coli} Length = 281 | Back alignment and structure |
|---|
| >2xqh_A Immunoglobulin-binding protein EIBD; cell adhesion, virulence, beta-helix; 1.99A {Escherichia coli} Length = 281 | Back alignment and structure |
|---|
| >2xqh_A Immunoglobulin-binding protein EIBD; cell adhesion, virulence, beta-helix; 1.99A {Escherichia coli} Length = 281 | Back alignment and structure |
|---|
| >1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Length = 400 | Back alignment and structure |
|---|
| >1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Length = 400 | Back alignment and structure |
|---|
| >1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Length = 400 | Back alignment and structure |
|---|
| >1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9 Length = 400 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Length = 551 | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Length = 617 | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Length = 617 | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Length = 617 | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Length = 617 | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Length = 617 | Back alignment and structure |
|---|
| >3laa_A Haemagluttinin family protein; niaid, seattle structural genomics center for infectious DIS ssgcid, melioidosis; 1.35A {Burkholderia pseudomallei} PDB: 3la9_A Length = 200 | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Length = 1048 | Back alignment and structure |
|---|
| >2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Length = 615 | Back alignment and structure |
|---|
| >2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Length = 615 | Back alignment and structure |
|---|
| >3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} Length = 968 | Back alignment and structure |
|---|
| >1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* Length = 506 | Back alignment and structure |
|---|
| >1dbg_A Chondroitinase B; beta helix, polysaccharide lyase, dematan sulfate; HET: MAN RAM GCU MXY G4D BGC; 1.70A {Pedobacter heparinus} SCOP: b.80.1.4 PDB: 1dbo_A* 1ofl_A* 1ofm_A* Length = 506 | Back alignment and structure |
|---|
| >3gw6_A Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F} Length = 275 | Back alignment and structure |
|---|
| >2dck_A Xylanase J; family 11, xylan binding domain (XBM), beta-jelly roll, ALKA xylanase, hydrolase; 2.10A {Bacillus SP} PDB: 2dcj_A Length = 354 | Back alignment and structure |
|---|
| >2dck_A Xylanase J; family 11, xylan binding domain (XBM), beta-jelly roll, ALKA xylanase, hydrolase; 2.10A {Bacillus SP} PDB: 2dcj_A Length = 354 | Back alignment and structure |
|---|
| >3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Length = 1011 | Back alignment and structure |
|---|
| >1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 | Back alignment and structure |
|---|
| >1ocy_A Bacteriophage T4 short tail fibre; structural protein, fibrous protein, LIPO-polysaccharide binding, bacteriophage structural protein; HET: CIT; 1.5A {Bacteriophage T4} SCOP: d.231.1.1 Length = 198 | Back alignment and structure |
|---|
| >1ocy_A Bacteriophage T4 short tail fibre; structural protein, fibrous protein, LIPO-polysaccharide binding, bacteriophage structural protein; HET: CIT; 1.5A {Bacteriophage T4} SCOP: d.231.1.1 Length = 198 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| 3em5_A | 316 | Beta-1,3-glucanase; glycoprotein, rossmann fold, ( | 100.0 | |
| 3ur8_A | 323 | Glucan endo-1,3-beta-D-glucosidase; glucoside hydr | 100.0 | |
| 2cyg_A | 312 | Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be | 100.0 | |
| 1aq0_A | 306 | 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl | 100.0 | |
| 1ghs_A | 306 | 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg | 100.0 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 100.0 | |
| 2jon_A | 101 | Beta-1,3-glucanase; olive pollen, allergen; NMR {O | 99.96 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 99.58 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 99.55 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 99.47 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 99.0 | |
| 4ekj_A | 500 | Beta-xylosidase; TIM-barrel fold, hemicellulase, h | 98.76 | |
| 3hn3_A | 613 | Beta-G1, beta-glucuronidase; lysosomal enzyme, aci | 98.66 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 98.58 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 98.57 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 98.56 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 98.53 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 98.47 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 98.47 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 98.37 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 98.36 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 98.36 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 98.33 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 98.31 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 98.3 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 98.26 | |
| 3fn9_A | 692 | Putative beta-galactosidase; structural genomics, | 98.25 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 98.24 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 98.21 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 98.17 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 98.17 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 98.16 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 98.11 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 98.08 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 98.06 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 98.06 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 98.03 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 98.0 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 97.99 | |
| 1n82_A | 331 | Xylanase, intra-cellular xylanase; hydrolase; 1.45 | 97.88 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 97.88 | |
| 1nq6_A | 302 | XYS1; glycoside hydrolase family 10, xylanase, xyl | 97.86 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 97.83 | |
| 3cui_A | 315 | EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine | 97.81 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 97.8 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 97.73 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 97.72 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 97.71 | |
| 1w32_A | 348 | Endo-1,4-beta-xylanase A precursor; mutant, calciu | 97.6 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 97.6 | |
| 1r85_A | 379 | Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A | 97.6 | |
| 1xyz_A | 347 | 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola | 97.6 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 97.57 | |
| 1ur1_A | 378 | Endoxylanase; hydrolase, family 10, glycoside hydr | 97.57 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 97.57 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 97.55 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 97.55 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 97.54 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 97.53 | |
| 2uwf_A | 356 | Endoxylanase, alkaline active endoxylanase; hydrol | 97.52 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 97.51 | |
| 2dep_A | 356 | Xylanase B, thermostable celloxylanase; glycosidas | 97.47 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 97.46 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 97.46 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 97.41 | |
| 1us2_A | 530 | Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca | 97.38 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 97.36 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 97.35 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 97.34 | |
| 1v0l_A | 313 | Endo-1,4-beta-xylanase A; glycoside hydrolase fami | 97.3 | |
| 1gnx_A | 479 | Beta-glucosidase; hydrolase, glycosyltransferase, | 97.25 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 97.1 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 96.98 | |
| 1i1w_A | 303 | Endo-1,4-beta-xylanase; xylan degradation, hydrola | 96.84 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 96.83 | |
| 1qw9_A | 502 | Arabinosidase, alpha-L-arabinofuranosidase; hydrol | 96.82 | |
| 1ta3_B | 303 | Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), | 96.79 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 96.76 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 96.76 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 96.64 | |
| 2c7f_A | 513 | Alpha-L-arabinofuranosidase; glycosidase, xylan, a | 96.64 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 96.6 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 96.56 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 96.56 | |
| 3niy_A | 341 | Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 | 96.51 | |
| 4b3l_A | 479 | Beta-glucosidase; hydrolase, glycosidase, carbohyd | 96.44 | |
| 1qvb_A | 481 | Beta-glycosidase; TIM-barrel, thermostable, hydrol | 96.36 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 96.36 | |
| 2y2w_A | 574 | Arabinofuranosidase; hydrolase, arabinoxylan, glyc | 96.28 | |
| 2vrq_A | 496 | Alpha-L-arabinofuranosidase; hydrolase, glycosidas | 96.25 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 96.22 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 96.2 | |
| 1e4m_M | 501 | Myrosinase MA1; hydrolase, family 1 glycosyl hydro | 96.18 | |
| 1v02_A | 565 | Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri | 96.13 | |
| 3bga_A | 1010 | Beta-galactosidase; NYSGXRC, protein structure ini | 95.96 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 95.96 | |
| 1yq2_A | 1024 | Beta-galactosidase; glycosyl hydrolase family 2, T | 95.96 | |
| 3qom_A | 481 | 6-phospho-beta-glucosidase; structural genomics, P | 95.94 | |
| 3u7b_A | 327 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 95.79 | |
| 2dga_A | 565 | Beta-glucosidase; alpha/beta barrel, hydrolase; 1. | 95.73 | |
| 3vny_A | 488 | Beta-glucuronidase; TIM barrel, greek-KEY, glycosi | 95.71 | |
| 1cbg_A | 490 | Cyanogenic beta-glucosidase; hydrolase (O-glycosyl | 95.68 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 95.64 | |
| 3vii_A | 487 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 95.54 | |
| 4dde_A | 480 | 6-phospho-beta-glucosidase; structural genomics, P | 95.43 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 95.41 | |
| 4aw7_A | 591 | GH86A beta-porphyranase; hydrolase, porphyran-hexa | 95.4 | |
| 2jf7_A | 532 | Strictosidine-O-beta-D-glucosidase; alkaloid, hydr | 95.26 | |
| 2e3z_A | 465 | Beta-glucosidase; TIM barrel, glycoside hydrolase | 95.07 | |
| 3ahy_A | 473 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 94.86 | |
| 4f8x_A | 335 | Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET | 94.34 | |
| 3gm8_A | 801 | Glycoside hydrolase family 2, candidate beta-GLYC; | 94.33 | |
| 3emz_A | 331 | Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba | 94.12 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 93.69 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 93.65 | |
| 3ug3_A | 504 | Alpha-L-arabinofuranosidase; TIM barrel, hydrolase | 93.51 | |
| 4ha4_A | 489 | Beta-galactosidase; TIM barrel, beta-glycosidase, | 92.95 | |
| 2w5f_A | 540 | Endo-1,4-beta-xylanase Y; cellulosome, glycosidase | 92.37 | |
| 1uwi_A | 489 | Beta-galactosidase; hydrolase, beta-glycosidase, g | 91.84 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 91.07 | |
| 3ptm_A | 505 | Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly | 89.87 | |
| 3ik2_A | 517 | Endoglucanase A; TIM-like barrel, hydrolase; 2.20A | 89.14 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 88.2 | |
| 3oba_A | 1032 | Beta-galactosidase; TIM barrel, tetramer, GH2, gly | 87.07 | |
| 4inf_A | 373 | Metal-dependent hydrolase; amidohydrolase, metal b | 87.01 | |
| 2wnw_A | 447 | Activated by transcription factor SSRB; hydrolase, | 86.53 | |
| 2nt0_A | 497 | Glucosylceramidase; cerezyme, glucocerebrosidase, | 83.3 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 82.29 | |
| 3gyc_A | 393 | Putative glycoside hydrolase; YP_001304622.1, stru | 81.92 | |
| 3clw_A | 507 | Conserved exported protein; structural genomics, u | 80.03 |
| >3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-93 Score=743.88 Aligned_cols=313 Identities=29% Similarity=0.603 Sum_probs=296.0
Q ss_pred cceeeeCCCCCCCCCHHHHHHHHHhCCCCEEEEecCChHHHHHHHhcCCEEEEeeCCChhhhhhhchHHHHHHHHHhhcc
Q 045344 182 DVGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLFDMAVDYSNAQNWVKENVTR 261 (627)
Q Consensus 182 ~iGVnYG~~~~nlpsp~~Vv~lLks~~i~~VRlYdaD~~VL~Ala~tgIkV~VGV~n~~l~~la~s~~~A~~Wv~~nV~~ 261 (627)
.||||||+.+++||+|++||+|||+++|++||||++|+.||+||+++||+|+||||++++++++ ++++|.+||+++|.+
T Consensus 1 ~iGvnyG~~~~nlp~p~~vv~llks~gi~~VRlYdaD~~vL~Al~~sgi~v~vGV~n~~l~~la-~~~~A~~WV~~nV~~ 79 (316)
T 3em5_A 1 EVGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQSLT-NPSNAKSWVQKNVRG 79 (316)
T ss_dssp CCEEECCCCCTTCCCHHHHHHHHHHTTCCEEECSSCCHHHHHHHTTCCCEEEEEECGGGHHHHT-SHHHHHHHHHHHTGG
T ss_pred CeeEEcCcCCCCCCCHHHHHHHHHHcCCCEEEEecCCHHHHHHhhcCCceEEEecccchhhhcc-CHHHHHHHHHHhhhh
Confidence 3899999999999999999999999999999999999999999999999999999999999999 889999999999999
Q ss_pred cccCCCceEEEEEecccccccCCC-ccchhhHHHHHHHHHHHHHHcCCCcceEEecccccccccc-cCCCCccccchhhH
Q 045344 262 WVKDGSVKLKYVAVGNEPFLKSYN-DSFVKDTFPALKNVQQALVEAGHGKMVKATVPLNADVYEG-TLPSDGVFRKDIKQ 339 (627)
Q Consensus 262 y~p~~~t~I~~I~VGNEvL~~~~~-~~~~~~Llpam~nI~~aL~~agl~~~IkVsT~~s~~vl~~-~pPS~g~F~~d~~~ 339 (627)
|+| .++|++|+||||+|.+.+. ...++.|+|||++||++|+++||+++|||||++++++|.. ||||+|.||+++.+
T Consensus 80 y~p--~~~I~~IaVGNEvl~~~~~t~~~~~~LvpAm~nv~~AL~~aGL~~~IkVsT~~s~~vl~~s~pPS~g~F~~~~~~ 157 (316)
T 3em5_A 80 FWS--SVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRS 157 (316)
T ss_dssp GTT--TSCEEEEEEEESCCTTCTTTGGGHHHHHHHHHHHHHHHHHTTCTTTSEEEEEECTTSEEECSSGGGCEECGGGHH
T ss_pred cCC--CceEEEEEEecccccCCCccccCHHHHHHHHHHHHHHHHHCCCCCceEEEecccccccccCCCCCCceechhHHH
Confidence 987 6999999999999987531 1127899999999999999999998999999999999998 99999999999999
Q ss_pred HHHHHHHHhhhcCCCceeccCcccccCCCC-CCCccccccccCCcccccCCccchhhhhhhHHHHHHHHHHhCCCCceEE
Q 045344 340 HIDNILKNLHDNKSPFIVNIYPFLSLYESP-DFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKII 418 (627)
Q Consensus 340 ~l~~lldFL~~t~sp~~vNiYPff~~~~~~-~i~ldyAlF~~~~~~v~D~g~~YtNlfDaqvDav~~Am~k~g~~~~~Vv 418 (627)
+|+|||+||++++||||||+||||+|..+| +|+|+||||++....+.|++++|+||||||+|++++||+|+|+++++||
T Consensus 158 ~~~pil~fL~~~~sp~~vN~YPyf~~~~~~~~i~l~yAlf~~~~~~~~~~~~~Y~nlfDa~~Da~~~Al~~~g~~~~~v~ 237 (316)
T 3em5_A 158 YLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVV 237 (316)
T ss_dssp HHHHHHHHHHHTTCCEEEECCHHHHHHHCTTTSCHHHHTTCCSSCSEEETTEEECSHHHHHHHHHHHHHHHTTCTTCCEE
T ss_pred HHHHHHHHHHhcCCeeEeecchhhhccCCCCCcCchhhcccCCCcccCCCCccHHHHHHHHHHHHHHHHHHcCCCCCceE
Confidence 999999999999999999999999999887 8999999999976666778999999999999999999999999999999
Q ss_pred EceeccCCCCCCCCCHHHHHHHHHHHHHHHHhcCCCCCCCCCcccEEEEeeeccccccCCCCCcccceeeeecCCCCccc
Q 045344 419 IGEIGWPTDGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGKFERHWGIFRFDGQPKFP 498 (627)
Q Consensus 419 ItETGWPS~G~~~AS~~NA~~y~~nli~~~~s~~GTP~rPg~~ie~yiFelFDE~wK~~~pg~~Er~wGLF~~dgtpKy~ 498 (627)
|+||||||+|+..||++||++|+++|+||+ ..|||+|||..+++||||||||+||+ +.+|||||||++|++|||+
T Consensus 238 V~EtGWPs~G~~~as~~na~~y~~~li~~~--~~GTP~rp~~~~~~y~F~lfDe~~K~---~~~E~~~Glf~~d~~~ky~ 312 (316)
T 3em5_A 238 VSESGWPSAGAFAATFDNGRTYLSNLIQHV--KRGTPKRPKRAIETYLFAMFDENKKQ---PEVEKHFGLFFPNKWQKYN 312 (316)
T ss_dssp EEEECCCSSSSTTCCHHHHHHHHHHHHHHT--TSCCSSSCSSCCCEEESCSBCCTTCS---SGGGGCCCSBCTTSCBSSC
T ss_pred eccccCCCCCCCCCCHHHHHHHHHHHHHhc--cCCCCCCCCCCceEEEEEeecCCCCC---CCCCceeeEECCCCCEeec
Confidence 999999999999999999999999999999 46999999988999999999999996 4689999999999999999
Q ss_pred cccC
Q 045344 499 IDFT 502 (627)
Q Consensus 499 l~~~ 502 (627)
|+|+
T Consensus 313 l~~~ 316 (316)
T 3em5_A 313 LNFS 316 (316)
T ss_dssp CCCC
T ss_pred CCCC
Confidence 9873
|
| >3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A | Back alignment and structure |
|---|
| >2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A | Back alignment and structure |
|---|
| >1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >2jon_A Beta-1,3-glucanase; olive pollen, allergen; NMR {Olea europaea} | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A | Back alignment and structure |
|---|
| >1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A | Back alignment and structure |
|---|
| >1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A | Back alignment and structure |
|---|
| >4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} | Back alignment and structure |
|---|
| >2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* | Back alignment and structure |
|---|
| >3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A | Back alignment and structure |
|---|
| >3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* | Back alignment and structure |
|---|
| >3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} | Back alignment and structure |
|---|
| >4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} | Back alignment and structure |
|---|
| >3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A | Back alignment and structure |
|---|
| >4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A | Back alignment and structure |
|---|
| >2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* | Back alignment and structure |
|---|
| >1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* | Back alignment and structure |
|---|
| >3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A | Back alignment and structure |
|---|
| >4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* | Back alignment and structure |
|---|
| >2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 627 | ||||
| d2cyga1 | 312 | c.1.8.3 (A:29-340) Plant beta-glucanases {Banana ( | 2e-81 | |
| d1aq0a_ | 306 | c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu | 1e-76 | |
| d1ghsa_ | 306 | c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu | 1e-72 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 5e-06 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 2e-05 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 2e-05 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 5e-05 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 5e-05 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 7e-05 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 2e-04 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 3e-04 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 0.002 | |
| d1ofla_ | 481 | b.80.1.4 (A:) Chondroitinase B {Pedobacter heparin | 0.002 | |
| d1ru4a_ | 400 | b.80.1.9 (A:) Pectate transeliminase {Erwinia chry | 9e-06 | |
| d1ru4a_ | 400 | b.80.1.9 (A:) Pectate transeliminase {Erwinia chry | 3e-05 | |
| d1ru4a_ | 400 | b.80.1.9 (A:) Pectate transeliminase {Erwinia chry | 4e-05 | |
| d1ru4a_ | 400 | b.80.1.9 (A:) Pectate transeliminase {Erwinia chry | 6e-05 |
| >d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Length = 312 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-glycanases domain: Plant beta-glucanases species: Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]
Score = 257 bits (657), Expect = 2e-81
Identities = 94/322 (29%), Positives = 171/322 (53%), Gaps = 13/322 (4%)
Query: 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLF 242
+GV +G L ++ P +V + K N I R +L+D ++ +++ L ++ I+V++ +P +
Sbjct: 1 IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQ 60
Query: 243 DMAVDYSNAQNWVKENVTRWVKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQA 302
+A + S A +W++ NV + SV +Y+AVGNE S ++ PA++N+ A
Sbjct: 61 SLASNPSAAGDWIRRNVVAYW--PSVSFRYIAVGNELIPGSDLAQYI---LPAMRNIYNA 115
Query: 303 LVEAGHGKMVKATVPLNADVYEGTL-PSDGVFRKDIKQHIDNILKNLHDNKSPFIVNIYP 361
L AG +K + ++ V + PS G F + ++ I++ L N +P +VN+YP
Sbjct: 116 LSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYLSPIVQFLASNGAPLLVNVYP 175
Query: 362 FLSLYESPDF-PVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIG 420
+ S +P + YA F +QD Y N+ D D + +AL++ G ++ +++
Sbjct: 176 YFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVS 235
Query: 421 EIGWPT-DGHKAATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAP 479
E GWP+ G A++ +AQ + L + + GTP RPG E + Y+F +E+ K
Sbjct: 236 ESGWPSAGGGAEASTSNAQTYNQNLIRHVGG--GTPRRPGKEIEAYIFEMFNENQK---A 290
Query: 480 GKFERHWGIFRFDGQPKFPIDF 501
G E+++G+F + QP + I F
Sbjct: 291 GGIEQNFGLFYPNKQPVYQISF 312
|
| >d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Length = 306 | Back information, alignment and structure |
|---|
| >d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Length = 306 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ofla_ b.80.1.4 (A:) Chondroitinase B {Pedobacter heparinus [TaxId: 984]} Length = 481 | Back information, alignment and structure |
|---|
| >d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Length = 400 | Back information, alignment and structure |
|---|
| >d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Length = 400 | Back information, alignment and structure |
|---|
| >d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Length = 400 | Back information, alignment and structure |
|---|
| >d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Length = 400 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 627 | |||
| d2cyga1 | 312 | Plant beta-glucanases {Banana (Musa acuminata), 1, | 100.0 | |
| d1aq0a_ | 306 | Plant beta-glucanases {Barley (Hordeum vulgare), 1 | 100.0 | |
| d1ghsa_ | 306 | Plant beta-glucanases {Barley (Hordeum vulgare), 1 | 100.0 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 99.27 | |
| d1uhva2 | 346 | Beta-D-xylosidase, catalytic domain {Thermoanaerob | 99.2 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 99.17 | |
| d1bhga3 | 304 | beta-Glucuronidase, domain 3 {Human (Homo sapiens) | 98.89 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 98.83 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 98.69 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 98.59 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 98.58 | |
| d1xyza_ | 320 | Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 | 98.55 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 98.51 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 98.37 | |
| d1vbua1 | 324 | Xylanase {Thermotoga maritima [TaxId: 2336]} | 98.31 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 98.26 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 98.21 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 98.14 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 98.14 | |
| d1fh9a_ | 312 | Xylanase A, catalytic core {Cellulomonas fimi [Tax | 98.12 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 98.08 | |
| d1nq6a_ | 302 | Xylanase A, catalytic core {Streptomyces halstedii | 98.04 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 98.01 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 97.99 | |
| d1n82a_ | 330 | Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId | 97.82 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 97.75 | |
| d1qoxa_ | 449 | Beta-glucosidase A {Bacillus circulans, subsp. alk | 97.59 | |
| d1us3a2 | 364 | Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] | 97.57 | |
| d1yq2a5 | 297 | beta-Galactosidase, domain 3 {Arthrobacter sp. c2- | 97.49 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 97.36 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 97.35 | |
| d1v0la_ | 302 | Xylanase A, catalytic core {Streptomyces lividans | 97.3 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 97.26 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 97.03 | |
| d1jz8a5 | 292 | beta-Galactosidase, domain 3 {Escherichia coli [Ta | 96.96 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 96.9 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 96.85 | |
| d1v02a_ | 484 | Plant beta-glucosidase (myrosinase) {Sorghum bicol | 96.77 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 96.66 | |
| d1pbga_ | 468 | 6-phospho-beta-D-galactosidase, PGAL {Lactococcus | 96.58 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 96.19 | |
| d1e4mm_ | 499 | Plant beta-glucosidase (myrosinase) {White mustard | 96.18 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 95.85 | |
| d1qw9a2 | 367 | Alpha-L-arabinofuranosidase, catalytic domain {Bac | 95.48 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 95.3 | |
| d2je8a5 | 348 | Five-domain beta-mannosidase, domain 3 {Bacteroide | 95.14 | |
| d1qvba_ | 481 | beta-Glycosidase {Archaeon Thermosphaera aggregans | 94.82 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 94.26 | |
| d2v3ga1 | 273 | Endoglucanase H N-terminal domain {Clostridium the | 94.21 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 94.11 | |
| d1uwsa_ | 489 | beta-Glycosidase {Archaeon Sulfolobus solfataricus | 93.59 | |
| d2nt0a2 | 354 | Glucosylceramidase, catalytic domain {Human (Homo | 92.48 | |
| d2f6ka1 | 306 | Putative amidohydrolase LP2961 {Lactobacillus plan | 92.39 | |
| d1ta3b_ | 301 | Xylanase A, catalytic core {Emericella nidulans (A | 91.3 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 90.46 | |
| d1i1wa_ | 303 | Xylanase A, catalytic core {Thermoascus aurantiacu | 90.2 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 86.84 | |
| d1nofa2 | 277 | Glycosyl hydrolase family 5 xylanase, catalytic do | 85.51 | |
| d1ur1a_ | 350 | Xylanase {Cellvibrio mixtus [TaxId: 39650]} | 85.04 | |
| d2dvta1 | 325 | Thermophilic reversible gamma-resorcylate decarbox | 80.68 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 80.12 |
| >d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-glycanases domain: Plant beta-glucanases species: Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]
Probab=100.00 E-value=1.6e-82 Score=662.14 Aligned_cols=309 Identities=30% Similarity=0.628 Sum_probs=294.3
Q ss_pred ceeeeCCCCCCCCCHHHHHHHHHhCCCCEEEEecCChHHHHHHHhcCCEEEEeeCCChhhhhhhchHHHHHHHHHhhccc
Q 045344 183 VGVNWGNLASHPLPAKIIVQMLKDNGIKRAKLFDADETSVKELAHTGIEVMVAIPNGMLFDMAVDYSNAQNWVKENVTRW 262 (627)
Q Consensus 183 iGVnYG~~~~nlpsp~~Vv~lLks~~i~~VRlYdaD~~VL~Ala~tgIkV~VGV~n~~l~~la~s~~~A~~Wv~~nV~~y 262 (627)
||||||++|++||||++|++|||+++|++||||++||+||+||+++||+||||||++++.+++++++.|++||+++|++|
T Consensus 1 ~gi~yg~~~~nlps~~~vv~lLk~~~i~~IRlY~~d~~vL~A~~~tgi~v~lGv~n~~l~~~~~~~~~a~~wv~~~v~~~ 80 (312)
T d2cyga1 1 IGVCYGMLGNNLPPPSEVVSLYKSNNIARMRLYDPNQAALQALRNSNIQVLLDVPRSDVQSLASNPSAAGDWIRRNVVAY 80 (312)
T ss_dssp CEEECCCCCSSCCCHHHHHHHHHHTTCCEEEESSCCHHHHHHHTTSCCEEEEEECHHHHHHHHHCTTHHHHHHHHHTGGG
T ss_pred CeeeCCCccCCCCCHHHHHHHHHhCCCCEEEEeCCCHHHHHHHHhcCCEEEEeeccchhhhccCCHHHHHHHHHHHHhcc
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCCceEEEEEecccccccCCCccchhhHHHHHHHHHHHHHHcCCCcceEEecccccccccc-cCCCCccccchhhHHH
Q 045344 263 VKDGSVKLKYVAVGNEPFLKSYNDSFVKDTFPALKNVQQALVEAGHGKMVKATVPLNADVYEG-TLPSDGVFRKDIKQHI 341 (627)
Q Consensus 263 ~p~~~t~I~~I~VGNEvL~~~~~~~~~~~Llpam~nI~~aL~~agl~~~IkVsT~~s~~vl~~-~pPS~g~F~~d~~~~l 341 (627)
+| .++|++|+||||+|.+++ ....+||+|+++|++|+++||.+.||+++++++++|.. +|||++.|++++.++|
T Consensus 81 ~~--~~~I~~IaVGNE~l~~~~---~~~~~lpa~~~~~~aL~~~g~~~~i~~t~~~~~~~~~~s~p~sa~~~~~~~~~~l 155 (312)
T d2cyga1 81 WP--SVSFRYIAVGNELIPGSD---LAQYILPAMRNIYNALSSAGLQNQIKVSTAVDTGVLGTSYPPSAGAFSSAAQAYL 155 (312)
T ss_dssp TT--TSEEEEEEEEESCTTTST---TGGGHHHHHHHHHHHHHHTTCTTTSEEEEEEEGGGBSCCSSGGGCCBCHHHHHHH
T ss_pred CC--CceEEEEEecCEEeeCCc---CchhhcccHHHHHHHHHHCCCCCCceeeeeeeeeccccCCCCccccccchhHHHH
Confidence 86 689999999999998753 46789999999999999999999999999999999988 9999999999999999
Q ss_pred HHHHHHhhhcCCCceeccCcccccCCCC-CCCccccccccCCcccccCCccchhhhhhhHHHHHHHHHHhCCCCceEEEc
Q 045344 342 DNILKNLHDNKSPFIVNIYPFLSLYESP-DFPVEYAFFEEGAKGLQDKNHRYTNVLDGNYDTLLSALKKAGYPDMKIIIG 420 (627)
Q Consensus 342 ~~lldFL~~t~sp~~vNiYPff~~~~~~-~i~ldyAlF~~~~~~v~D~g~~YtNlfDaqvDav~~Am~k~g~~~~~VvIt 420 (627)
+++||||+.++||||+|+||||++..++ .++|+||+|++....+.|+++.|+++||+|+|++++||+|+|+++|+|+|+
T Consensus 156 ~~~~~fl~~~~~~~~~n~ypy~~~~~~~~~~~l~~a~f~~~~~~~~~~~~~y~n~~d~~~d~~~~a~~~~g~~~~~ivI~ 235 (312)
T d2cyga1 156 SPIVQFLASNGAPLLVNVYPYFSYTGNPGQISLPYALFTASGVVVQDGRFSYQNLFDAIVDAVFAALERVGGANVAVVVS 235 (312)
T ss_dssp HHHHHHHHHHTCCEEEECCHHHHHHHSTTTSCHHHHHTCCCSCSEEETTEEECSHHHHHHHHHHHHHHTTTCTTCCEEEE
T ss_pred HHHHHHHHhcCCeeeEeccchhhhccCcccccchhhhccCCCccccccHHHHHHHHHHHHHHHHHHHHHhCCCCCceEEe
Confidence 9999999999999999999999999888 799999999998777788899999999999999999999999999999999
Q ss_pred eeccCCCCCC-CCCHHHHHHHHHHHHHHHHhcCCCCCCCCCcccEEEEeeeccccccCCCCCcccceeeeecCCCCcccc
Q 045344 421 EIGWPTDGHK-AATSQSAQKFYDGLFKKLAKRDGTPLRPGTEFDVYLFGFLDEDAKSIAPGKFERHWGIFRFDGQPKFPI 499 (627)
Q Consensus 421 ETGWPS~G~~-~AS~~NA~~y~~nli~~~~s~~GTP~rPg~~ie~yiFelFDE~wK~~~pg~~Er~wGLF~~dgtpKy~l 499 (627)
||||||+|+. .|++++|++|+++|++|+. +|||+||+..+++||||||||+||+ |++|||||||++||+|||+|
T Consensus 236 EtGWPs~G~~~~as~~na~~y~~~l~~~~~--~gtp~~~~~~i~~f~FeaFDE~wK~---G~~E~~wGlf~~d~~~ky~l 310 (312)
T d2cyga1 236 ESGWPSAGGGAEASTSNAQTYNQNLIRHVG--GGTPRRPGKEIEAYIFEMFNENQKA---GGIEQNFGLFYPNKQPVYQI 310 (312)
T ss_dssp EECCCSSSSSTTSSHHHHHHHHHHHHHHGG--GCCSSSCSSCCCEEESCSBCCTTSC---SSGGGCCCSBCTTSCBSSCC
T ss_pred cCCcccCCCCCCCCHHHHHHHHHHHHHHHh--cCCCCCCCCCccEEEEeEeCCCCCC---CCccCccccCCCCCCEecCC
Confidence 9999999975 6999999999999999994 5999999989999999999999994 56999999999999999999
Q ss_pred cc
Q 045344 500 DF 501 (627)
Q Consensus 500 ~~ 501 (627)
+|
T Consensus 311 ~f 312 (312)
T d2cyga1 311 SF 312 (312)
T ss_dssp CC
T ss_pred CC
Confidence 86
|
| >d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} | Back information, alignment and structure |
|---|
| >d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|