Citrus Sinensis ID: 045424


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MLKPSSSKNNKKPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGGGHDHRA
ccccccccccccccccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccccccEEEccEEccccccccccccccccEEEEEEEcccccccccc
cccccccccccccccEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHccccccEEEEEEcccEccccccHHHcccccccEEEEEHHcccccccccc
mlkpsssknnkkpqHLINLIIKSqdgdkrffQFNHDVEIKRLLIKYCetksqpfkstpflingnrfdysktadqlglkdgdeIDAMYHafggghdhra
mlkpsssknnkkpqhLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCEtksqpfkstpflingnrfDYSKTADQLGLKDGDEIDAMYHAFGGGHDHRA
MLkpsssknnkkpQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGGGHDHRA
***************LINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAF********
******************LIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGG******
***********KPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGGGHDHRA
************PQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAF********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKPSSSKNNKKPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGGGHDHRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q9FLP6103 Small ubiquitin-related m yes no 0.908 0.864 0.417 1e-14
P55857100 Small ubiquitin-related m no no 0.775 0.76 0.421 1e-12
P55852100 Small ubiquitin-related m no no 0.734 0.72 0.430 4e-12
O13351117 Ubiquitin-like protein pm yes no 0.897 0.752 0.306 7e-08
B3H5R897 Putative small ubiquitin- no no 0.897 0.907 0.329 1e-07
Q9FLP5111 Small ubiquitin-related m no no 0.928 0.819 0.340 1e-07
Q3E8A895 Putative small ubiquitin- no no 0.846 0.873 0.352 4e-06
Q9MZD5101 Small ubiquitin-related m N/A no 0.928 0.900 0.322 1e-05
Q8VZI7108 Small ubiquitin-related m no no 0.887 0.805 0.274 3e-05
A7WLI095 Small ubiquitin-related m yes no 0.775 0.8 0.302 4e-05
>sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 Back     alignment and function desciption
 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 57/91 (62%), Gaps = 2/91 (2%)

Query: 5  SSSKNNKKPQHL--INLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLIN 62
          ++ + +KKP     INL +K QDG++ FF+     ++K+L+  YC+ +S  F S  FL +
Sbjct: 3  ATPEEDKKPDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFD 62

Query: 63 GNRFDYSKTADQLGLKDGDEIDAMYHAFGGG 93
          G R    +T D+L ++DGDEIDAM H  GGG
Sbjct: 63 GRRLRAEQTPDELEMEDGDEIDAMLHQTGGG 93




Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1.
Arabidopsis thaliana (taxid: 3702)
>sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 Back     alignment and function description
>sp|P55852|SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana GN=SUMO1 PE=1 SV=2 Back     alignment and function description
>sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 Back     alignment and function description
>sp|B3H5R8|SUMO8_ARATH Putative small ubiquitin-related modifier 8 OS=Arabidopsis thaliana GN=SUMO8 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLP5|SUMO3_ARATH Small ubiquitin-related modifier 3 OS=Arabidopsis thaliana GN=SUMO3 PE=1 SV=1 Back     alignment and function description
>sp|Q3E8A8|SUMO7_ARATH Putative small ubiquitin-related modifier 7 OS=Arabidopsis thaliana GN=SUMO7 PE=1 SV=2 Back     alignment and function description
>sp|Q9MZD5|SUMO1_CERNI Small ubiquitin-related modifier 1 OS=Cervus nippon GN=SUMO1 PE=3 SV=1 Back     alignment and function description
>sp|Q8VZI7|SUMO5_ARATH Small ubiquitin-related modifier 5 OS=Arabidopsis thaliana GN=SUMO5 PE=1 SV=1 Back     alignment and function description
>sp|A7WLI0|SUMO4_PIG Small ubiquitin-related modifier 4 OS=Sus scrofa GN=SUMO4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
359477951127 PREDICTED: small ubiquitin-related modif 0.846 0.653 0.435 3e-14
29820525294 unnamed protein product [Vitis vinifera] 0.846 0.882 0.435 4e-14
351726472103 uncharacterized protein LOC100305708 [Gl 0.908 0.864 0.434 7e-14
356567836114 PREDICTED: small ubiquitin-related modif 0.908 0.780 0.434 9e-14
224132216108 predicted protein [Populus trichocarpa] 0.795 0.722 0.448 1e-13
388494242103 unknown [Lotus japonicus] gi|388509240|g 0.918 0.873 0.410 1e-13
255560123108 conserved hypothetical protein [Ricinus 0.908 0.824 0.413 2e-13
15240471103 small ubiquitin-related modifier 2 [Arab 0.908 0.864 0.417 5e-13
225447135101 PREDICTED: uncharacterized protein LOC10 0.918 0.891 0.419 7e-13
115441853101 Os01g0918200 [Oryza sativa Japonica Grou 0.775 0.752 0.460 1e-12
>gi|359477951|ref|XP_003632045.1| PREDICTED: small ubiquitin-related modifier 2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 56/85 (65%), Gaps = 2/85 (2%)

Query: 11  KKP--QHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDY 68
           K+P  Q  I + +KSQDG + +F+ N    ++RLL+ YC+  +  +K+  F+ NGNR   
Sbjct: 39  KRPLDQSTIEVKVKSQDGRQLYFRINRSTPLQRLLVAYCQQINIDYKTMQFVYNGNRVTA 98

Query: 69  SKTADQLGLKDGDEIDAMYHAFGGG 93
            +T +QLG++DGDEIDA+ H  GGG
Sbjct: 99  KQTPEQLGMEDGDEIDALTHQMGGG 123




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|298205252|emb|CBI17311.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351726472|ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycine max] gi|255626371|gb|ACU13530.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356567836|ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224132216|ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|118487404|gb|ABK95530.1| unknown [Populus trichocarpa] gi|222862057|gb|EEE99599.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388494242|gb|AFK35187.1| unknown [Lotus japonicus] gi|388509240|gb|AFK42686.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255560123|ref|XP_002521079.1| conserved hypothetical protein [Ricinus communis] gi|223539648|gb|EEF41230.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|15240471|ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|75171511|sp|Q9FLP6.1|SUMO2_ARATH RecName: Full=Small ubiquitin-related modifier 2; Short=AtSUMO2 gi|9758113|dbj|BAB08585.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|19715611|gb|AAL91628.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21360423|gb|AAM47327.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21537401|gb|AAM61742.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|22652844|gb|AAN03846.1| small ubiquitin-like modifier 2 [Arabidopsis thaliana] gi|332009210|gb|AED96593.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225447135|ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267064 [Vitis vinifera] gi|297739210|emb|CBI28861.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|115441853|ref|NP_001045206.1| Os01g0918200 [Oryza sativa Japonica Group] gi|19386771|dbj|BAB86152.1| putative SUMO protein [Oryza sativa Japonica Group] gi|113534737|dbj|BAF07120.1| Os01g0918200 [Oryza sativa Japonica Group] gi|125528872|gb|EAY76986.1| hypothetical protein OsI_04942 [Oryza sativa Indica Group] gi|215692894|dbj|BAG88314.1| unnamed protein product [Oryza sativa Japonica Group] gi|215736955|dbj|BAG95884.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
TAIR|locus:2116332100 SUMO1 "AT4G26840" [Arabidopsis 0.775 0.76 0.434 1.3e-13
TAIR|locus:2161675116 SUMO2 "small ubiquitin-like mo 0.755 0.637 0.426 1.9e-12
GENEDB_PFALCIPARUM|PFE0285c100 PFE0285c "ubiquitin-like prote 0.795 0.78 0.354 1.1e-09
UNIPROTKB|Q8I444100 PfSUMO "Small ubiquitin-relate 0.795 0.78 0.354 1.1e-09
TAIR|locus:2161695111 SUMO3 "small ubiquitin-like mo 0.785 0.693 0.379 2.2e-09
POMBASE|SPBC365.06117 pmt3 "SUMO" [Schizosaccharomyc 0.795 0.666 0.329 1.6e-08
TAIR|locus:451510373597 AT5G55856 "AT5G55856" [Arabido 0.775 0.783 0.328 3.3e-08
TAIR|locus:50495484995 AT5G55855 [Arabidopsis thalian 0.816 0.842 0.345 1.4e-07
UNIPROTKB|Q9MZD5101 SUMO1 "Small ubiquitin-related 0.785 0.762 0.320 7.8e-07
UNIPROTKB|F1P3Q1102 SUMO1 "Small ubiquitin-related 0.785 0.754 0.307 4.3e-06
TAIR|locus:2116332 SUMO1 "AT4G26840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 33/76 (43%), Positives = 48/76 (63%)

Query:    17 INLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLG 76
             INL +K QDG++ FF+     ++K+L+  YC+ +S    S  FL +G R    +T D+L 
Sbjct:    18 INLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELD 77

Query:    77 LKDGDEIDAMYHAFGG 92
             ++DGDEIDAM H  GG
Sbjct:    78 MEDGDEIDAMLHQTGG 93




GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0016925 "protein sumoylation" evidence=IEP;RCA;IDA
GO:0031386 "protein tag" evidence=IDA
GO:0009408 "response to heat" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0010286 "heat acclimation" evidence=IMP
GO:0043433 "negative regulation of sequence-specific DNA binding transcription factor activity" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2161675 SUMO2 "small ubiquitin-like modifier 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFE0285c PFE0285c "ubiquitin-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I444 PfSUMO "Small ubiquitin-related modifier, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TAIR|locus:2161695 SUMO3 "small ubiquitin-like modifier 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC365.06 pmt3 "SUMO" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:4515103735 AT5G55856 "AT5G55856" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954849 AT5G55855 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9MZD5 SUMO1 "Small ubiquitin-related modifier 1" [Cervus nippon (taxid:9863)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3Q1 SUMO1 "Small ubiquitin-related modifier 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DEP7SUMO1_XENTRNo assigned EC number0.30850.92850.8921yesno
Q5E9D1SUMO1_BOVINNo assigned EC number0.31180.92850.9009yesno
P63165SUMO1_HUMANNo assigned EC number0.31180.92850.9009yesno
Q5I0H3SUMO1_RATNo assigned EC number0.31180.92850.9009yesno
Q8QGH2SUMO1_CHICKNo assigned EC number0.31180.92850.9009yesno
Q9FLP6SUMO2_ARATHNo assigned EC number0.41750.90810.8640yesno
Q7SZR5SUMO1_DANRENo assigned EC number0.31110.91830.9yesno
P63166SUMO1_MOUSENo assigned EC number0.31180.92850.9009yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
cd0176387 cd01763, Sumo, Small ubiquitin-related modifier (S 3e-14
COG5227103 COG5227, SMT3, Ubiquitin-like protein (sentrin) [P 2e-09
pfam1197672 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO- 2e-08
>gnl|CDD|176359 cd01763, Sumo, Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
 Score = 61.9 bits (151), Expect = 3e-14
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 5  SSSKNNKKPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGN 64
            S   +  +H INL +K QDG++ FF+      +K+L+  YC+ +     S  FL +G 
Sbjct: 1  EKSGKGEISEH-INLKVKGQDGNEVFFKIKRSTPLKKLMEAYCQRQGLSMNSVRFLFDGQ 59

Query: 65 RFDYSKTADQLGLKDGDEIDAMYHAFGG 92
          R   ++T D LG++DGDEI+ M    GG
Sbjct: 60 RIRDNQTPDDLGMEDGDEIEVMLEQTGG 87


Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability. SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases. Length = 87

>gnl|CDD|227552 COG5227, SMT3, Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|192903 pfam11976, Rad60-SLD, Ubiquitin-2 like Rad60 SUMO-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 100.0
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 99.97
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.96
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.91
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.66
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.5
PTZ0004476 ubiquitin; Provisional 99.5
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.46
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.46
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.43
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.42
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.41
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.39
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.36
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.34
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.34
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.29
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.29
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.28
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.23
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.23
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.22
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.21
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.13
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.04
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.03
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 98.93
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 98.83
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 98.83
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 98.75
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 98.74
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 98.73
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 98.62
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 98.45
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.44
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 98.37
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 98.28
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.28
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.23
PLN02560 308 enoyl-CoA reductase 98.1
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.03
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 97.88
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 97.88
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 97.77
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 97.68
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 97.65
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 97.63
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.55
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 97.53
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.4
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 96.76
PRK0836470 sulfur carrier protein ThiS; Provisional 96.73
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 96.71
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.63
COG541781 Uncharacterized small protein [Function unknown] 96.4
PRK0648865 sulfur carrier protein ThiS; Validated 96.4
PRK0643767 hypothetical protein; Provisional 96.34
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 96.27
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 96.19
PRK0744070 hypothetical protein; Provisional 96.15
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 96.12
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 96.09
smart0045570 RBD Raf-like Ras-binding domain. 95.89
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 95.88
PF13019162 Telomere_Sde2: Telomere stability and silencing 95.86
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 95.79
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 95.77
PF12436249 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp 95.74
PRK0694465 sulfur carrier protein ThiS; Provisional 95.62
PRK0586365 sulfur carrier protein ThiS; Provisional 95.49
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 95.36
PRK0565966 sulfur carrier protein ThiS; Validated 95.35
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 95.31
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 95.25
PRK0608384 sulfur carrier protein ThiS; Provisional 95.09
PRK0805366 sulfur carrier protein ThiS; Provisional 94.99
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 94.99
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 94.22
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 94.2
PLN0279982 Molybdopterin synthase sulfur carrier subunit 93.99
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 93.98
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 93.63
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 93.59
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 93.56
PRK0769667 sulfur carrier protein ThiS; Provisional 93.49
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 93.23
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 93.19
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 93.09
KOG3439116 consensus Protein conjugation factor involved in a 92.87
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 92.65
PF0411087 APG12: Ubiquitin-like autophagy protein Apg12 ; In 92.53
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 92.51
PF0367176 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: 92.38
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 92.35
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 92.31
cd0176682 Ufm1 Urm1-like ubiquitin domain. Ufm1 (ubiquitin-f 92.21
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 91.99
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 91.97
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 91.94
cd0161287 APG12_C Ubiquitin-like domain of APG12. APG12_C Th 91.92
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 91.73
PF12754 309 Blt1: Cell-cycle control medial ring component; In 91.6
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 91.02
cd0599281 PB1 The PB1 domain is a modular domain mediating s 90.5
PF0882584 E2_bind: E2 binding domain; InterPro: IPR014929 E1 90.03
COG210468 ThiS Sulfur transfer protein involved in thiamine 90.01
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 89.14
PRK11840 326 bifunctional sulfur carrier protein/thiazole synth 88.03
TIGR02958 452 sec_mycoba_snm4 secretion protein snm4. Members of 87.72
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 86.26
PF0623485 TmoB: Toluene-4-monooxygenase system protein B (Tm 85.63
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 85.16
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 84.31
PRK1113081 moaD molybdopterin synthase small subunit; Provisi 84.22
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 84.22
cd01611112 GABARAP Ubiquitin domain of GABA-receptor-associat 83.77
PF0360760 DCX: Doublecortin; InterPro: IPR003533 X-linked li 81.45
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3.9e-33  Score=180.15  Aligned_cols=81  Identities=33%  Similarity=0.591  Sum_probs=79.1

Q ss_pred             CCcEEEEEEccCCCEEEEEEcCccHHHHHHHHHHHhcCCCCcceeEEECCeecCCCCChhhcCCCCCCEEEEEceecCCC
Q 045424           14 QHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFGGG   93 (98)
Q Consensus        14 ~~~I~I~v~~~~g~~~~f~Ik~~t~l~kL~~~y~~~~g~~~~~~rF~fdG~~l~~~~Tp~~l~medgD~Idv~~~q~GG~   93 (98)
                      ..+|+|+|+++++..+.|+||++|||+|||++||++.|++.+++||+|||.+|.+.+||++|+|||||+|+|+.+|+||.
T Consensus        18 ~~hi~LKV~gqd~~~~~Fkikr~t~LkKLM~aYc~r~Gl~~~s~RFlFdG~rI~~~~TP~~L~mEd~D~Iev~~~q~gG~   97 (99)
T KOG1769|consen   18 SEHINLKVKGQDGSVVVFKIKRHTPLKKLMKAYCERQGLSMNSLRFLFDGQRIRETHTPADLEMEDGDEIEVVQEQTGGF   97 (99)
T ss_pred             cceEEEEEecCCCCEEEEEeecCChHHHHHHHHHHHcCCccceEEEEECCcCcCCCCChhhhCCcCCcEEEEEeecccCC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999996


Q ss_pred             c
Q 045424           94 H   94 (98)
Q Consensus        94 ~   94 (98)
                      .
T Consensus        98 ~   98 (99)
T KOG1769|consen   98 G   98 (99)
T ss_pred             C
Confidence            4



>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>KOG3439 consensus Protein conjugation factor involved in autophagy [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>cd01766 Ufm1 Urm1-like ubiquitin domain Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd01612 APG12_C Ubiquitin-like domain of APG12 Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>PF06234 TmoB: Toluene-4-monooxygenase system protein B (TmoB); InterPro: IPR009355 This family consists of several Toluene-4-monooxygenase system protein B (TmoB) sequences Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PRK11130 moaD molybdopterin synthase small subunit; Provisional Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information
>PF03607 DCX: Doublecortin; InterPro: IPR003533 X-linked lissencephaly is a severe brain malformation affecting males Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
2k8h_A110 Solution Structure Of Sumo From Trypanosoma Brucei 2e-08
2iy1_B83 Senp1 (Mutant) Full Length Sumo1 Length = 83 4e-05
2iy0_B82 Senp1 (Mutant) Sumo1 Rangap Length = 82 4e-05
2io1_B94 Crystal Structure Of Human Senp2 In Complex With Pr 5e-05
2io3_B81 Crystal Structure Of Human Senp2 In Complex With Ra 6e-05
2io0_B91 Crystal Structure Of Human Senp2 In Complex With Pr 6e-05
2ckh_B79 Senp1-sumo2 Complex Length = 79 6e-05
1a5r_A103 Structure Determination Of The Small Ubiquitin-Rela 6e-05
3uin_B80 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 6e-05
2iyd_B81 Senp1 Covalent Complex With Sumo-2 Length = 81 7e-05
2d07_B93 Crystal Structure Of Sumo-3-Modified Thymine-Dna Gl 7e-05
2awt_A95 Solution Structure Of Human Small Ubiquitin-Like Mo 7e-05
2uyz_B79 Non-Covalent Complex Between Ubc9 And Sumo1 Length 1e-04
1z5s_B82 Crystal Structure Of A Complex Between Ubc9, Sumo-1 1e-04
2bf8_B77 Crystal Structure Of Sumo Modified Ubiquitin Conjug 1e-04
1tgz_B80 Structure Of Human Senp2 In Complex With Sumo-1 Len 1e-04
2g4d_B78 Crystal Structure Of Human Senp1 Mutant (C603s) In 1e-04
3kyc_D97 Human Sumo E1 Complex With A Sumo1-Amp Mimic Length 1e-04
1y8r_C97 Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Co 2e-04
2kqs_A99 Phosphorylation Of Sumo-Interacting Motif By Ck2 En 2e-04
1wz0_A104 Solution Structure Of Human Sumo-2 (Smt3b), A Ubiqu 5e-04
3kyd_D115 Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi 6e-04
1wm3_A72 Crystal Structure Of Human Sumo-2 Protein Length = 7e-04
1wm2_A78 Crystal Structure Of Human Sumo-2 Protein Length = 9e-04
>pdb|2K8H|A Chain A, Solution Structure Of Sumo From Trypanosoma Brucei Length = 110 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 43/77 (55%) Query: 16 LINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQL 75 L+ + + + DG + FF+ +K+L+ YC+ + S FL +G D +KT ++L Sbjct: 26 LVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETKTPEEL 85 Query: 76 GLKDGDEIDAMYHAFGG 92 G++D D IDAM GG Sbjct: 86 GMEDDDVIDAMVEQTGG 102
>pdb|2IY1|B Chain B, Senp1 (Mutant) Full Length Sumo1 Length = 83 Back     alignment and structure
>pdb|2IY0|B Chain B, Senp1 (Mutant) Sumo1 Rangap Length = 82 Back     alignment and structure
>pdb|2IO1|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-3 Length = 94 Back     alignment and structure
>pdb|2IO3|B Chain B, Crystal Structure Of Human Senp2 In Complex With Rangap1- Sumo-2 Length = 81 Back     alignment and structure
>pdb|2IO0|B Chain B, Crystal Structure Of Human Senp2 In Complex With Presumo-2 Length = 91 Back     alignment and structure
>pdb|2CKH|B Chain B, Senp1-sumo2 Complex Length = 79 Back     alignment and structure
>pdb|1A5R|A Chain A, Structure Determination Of The Small Ubiquitin-Related Modifier Sumo-1, Nmr, 10 Structures Length = 103 Back     alignment and structure
>pdb|3UIN|B Chain B, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Length = 80 Back     alignment and structure
>pdb|2IYD|B Chain B, Senp1 Covalent Complex With Sumo-2 Length = 81 Back     alignment and structure
>pdb|2D07|B Chain B, Crystal Structure Of Sumo-3-Modified Thymine-Dna Glycosylase Length = 93 Back     alignment and structure
>pdb|2AWT|A Chain A, Solution Structure Of Human Small Ubiquitin-Like Modifier Protein Isoform 2 (Sumo-2) Length = 95 Back     alignment and structure
>pdb|2UYZ|B Chain B, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 79 Back     alignment and structure
>pdb|1Z5S|B Chain B, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 82 Back     alignment and structure
>pdb|2BF8|B Chain B, Crystal Structure Of Sumo Modified Ubiquitin Conjugating Enzyme E2-25k Length = 77 Back     alignment and structure
>pdb|1TGZ|B Chain B, Structure Of Human Senp2 In Complex With Sumo-1 Length = 80 Back     alignment and structure
>pdb|2G4D|B Chain B, Crystal Structure Of Human Senp1 Mutant (C603s) In Complex With Sumo-1 Length = 78 Back     alignment and structure
>pdb|3KYC|D Chain D, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 97 Back     alignment and structure
>pdb|1Y8R|C Chain C, Sumo E1 Activating Enzyme Sae1-Sae2-Sumo1-Mg-Atp Complex Length = 97 Back     alignment and structure
>pdb|2KQS|A Chain A, Phosphorylation Of Sumo-Interacting Motif By Ck2 Enhances Daxx Sumo Binding Activity Length = 99 Back     alignment and structure
>pdb|1WZ0|A Chain A, Solution Structure Of Human Sumo-2 (Smt3b), A Ubiquitin- Like Protein Length = 104 Back     alignment and structure
>pdb|3KYD|D Chain D, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 115 Back     alignment and structure
>pdb|1WM3|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 72 Back     alignment and structure
>pdb|1WM2|A Chain A, Crystal Structure Of Human Sumo-2 Protein Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 2e-17
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 7e-17
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 3e-16
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 8e-16
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 2e-15
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 1e-14
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 1e-14
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 6e-14
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 1e-13
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 2e-13
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 2e-12
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 7e-12
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 4e-11
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 3e-10
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 8e-05
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 3e-04
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 5e-04
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 104 Back     alignment and structure
 Score = 69.9 bits (171), Expect = 2e-17
 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 1/93 (1%)

Query: 3   KPSSSKNNKKPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLIN 62
           KP      +   H INL +  QDG    F+      + +L+  YCE +    +   F  +
Sbjct: 12  KPKEGVKTENNDH-INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFD 70

Query: 63  GNRFDYSKTADQLGLKDGDEIDAMYHAFGGGHD 95
           G   + + T  QL ++D D ID       G   
Sbjct: 71  GQPINETDTPAQLEMEDEDTIDVFQQQTSGPSS 103


>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Length = 93 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Length = 110 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Length = 97 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Length = 94 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Length = 91 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Length = 79 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Length = 207 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} Length = 115 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Length = 72 Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Length = 227 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Length = 79 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Length = 82 Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 100.0
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.98
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.97
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 99.97
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.97
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.97
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.97
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.97
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 99.96
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 99.96
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 99.96
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 99.96
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.95
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.95
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.94
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 99.93
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 99.93
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 99.9
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.86
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.86
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.69
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.69
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.67
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.66
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.65
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.64
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.63
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.62
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.6
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.6
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.6
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.59
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.57
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.57
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.57
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.57
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.56
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.56
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.55
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.54
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.54
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.54
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.51
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.5
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.48
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.46
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.46
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.46
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.44
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.44
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.43
1we6_A111 Splicing factor, putative; structural genomics, ub 99.41
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.41
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.41
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.4
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.4
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.4
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.4
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.39
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.38
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.38
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.38
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.36
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.36
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.04
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.33
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.33
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.33
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.33
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.31
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.3
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.3
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.29
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.27
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.25
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.23
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.2
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.18
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.16
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.14
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.12
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.1
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.1
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.09
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.09
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.06
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.06
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.05
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.04
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.03
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.0
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 98.97
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 98.96
4ajy_B118 Transcription elongation factor B polypeptide 2; E 98.93
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 98.91
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.9
2kj6_A97 Tubulin folding cofactor B; methods development, N 98.88
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.82
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 98.81
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 98.8
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 98.77
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 98.74
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.72
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 98.62
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 98.42
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.4
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.08
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 98.03
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.61
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 97.32
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.27
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 97.24
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 97.2
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.17
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 97.12
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 97.09
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 96.72
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 96.54
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.53
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 96.43
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 96.41
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 96.31
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 96.01
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 95.84
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 95.13
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 95.12
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 95.06
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 94.52
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 94.39
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 94.24
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 94.01
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 93.96
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 93.93
2cu3_A64 Unknown function protein; thermus thermophilus HB8 93.81
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 93.73
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 93.08
1j0g_A92 Hypothetical protein 1810045K17; ubiquitin-like fo 92.63
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 92.51
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 92.45
1wz3_A96 Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla 92.02
2inc_C83 TOUB protein; DIIRON, 4-helix bundle, carboxylate 91.39
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 90.89
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 90.71
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 90.67
3w1s_C91 Ubiquitin-like protein ATG12; ubiquitin fold, E3-l 90.16
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 89.53
4gdk_A91 Ubiquitin-like protein ATG12; protein-protein conj 89.47
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 89.24
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 89.0
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 88.95
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 88.85
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 88.57
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 88.57
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 88.24
3u7z_A101 Putative metal binding protein rumgna_00854; the b 87.84
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 87.6
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 87.4
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 87.36
1zps_A138 PRA-CH, phosphoribosyl-AMP cyclohydrolase; histidi 86.67
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 86.45
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 85.99
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 85.39
3rui_B118 Autophagy-related protein 8; autophagosome formati 85.16
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 84.96
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 84.61
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 83.83
3ge3_C84 Toluene-4-monooxygenase system protein B; DIIRON h 83.77
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 81.54
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
Probab=100.00  E-value=6.1e-33  Score=183.80  Aligned_cols=83  Identities=28%  Similarity=0.524  Sum_probs=76.4

Q ss_pred             CCCCCCCcEEEEEEccCCCEEEEEEcCccHHHHHHHHHHHhcCCCCcceeEEECCeecCCCCChhhcCCCCCCEEEEEce
Q 045424            9 NNKKPQHLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYH   88 (98)
Q Consensus         9 ~~~~~~~~I~I~v~~~~g~~~~f~Ik~~t~l~kL~~~y~~~~g~~~~~~rF~fdG~~l~~~~Tp~~l~medgD~Idv~~~   88 (98)
                      .+++++++|+|+|++++|.++.|+|++++||++||++||++.|++.+++||+|||++|.+++||++|+|||||+|||+++
T Consensus        33 ~~k~~~~~I~LKV~~qdg~ev~fkIk~tt~L~KLm~aY~er~Gl~~~~irFlFDG~rI~~~~TP~dL~MEDgD~IdV~~~  112 (115)
T 3kyd_D           33 GDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE  112 (115)
T ss_dssp             ------CEEEEEEECTTSCEEEEEEETTSCTHHHHHHHHHHHTCCTTSEEEEETTEECCTTCCTTTTTCCTTCEEEEEEC
T ss_pred             cCCCCCCeEEEEEEcCCCCEEEEEEccCChHHHHHHHHHHHhCCChhhEEEEECCeECCCCCCHHHcCCCCCCEEEEEee
Confidence            35567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecC
Q 045424           89 AFG   91 (98)
Q Consensus        89 q~G   91 (98)
                      |+|
T Consensus       113 Q~G  115 (115)
T 3kyd_D          113 QCG  115 (115)
T ss_dssp             CCC
T ss_pred             ccC
Confidence            998



>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>1j0g_A Hypothetical protein 1810045K17; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.6 PDB: 1wxs_A 1l7y_A Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 Back     alignment and structure
>2inc_C TOUB protein; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: d.15.12.1 PDB: 2ind_C* 3n20_C* 1t0r_C 1t0s_C 1t0q_C* 3n1x_C 3n1y_C* 3n1z_C* 2rdb_C* 3rn9_C* 3rna_C 3rnb_C 3rnc_C 3rne_C 3rnf_C* 3rng_C Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>1zps_A PRA-CH, phosphoribosyl-AMP cyclohydrolase; histidine biosynthesis; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.168.1.1 Back     alignment and structure
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3ge3_C Toluene-4-monooxygenase system protein B; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} SCOP: d.15.12.0 PDB: 3dhh_C* 3dhg_C* 3dhi_C 3ge8_C 3i5j_C 3i63_C 3q14_C 3q2a_C* 3q3m_C* 3q3n_C* 3q3o_C* 3rmk_C* 3ri7_C* Back     alignment and structure
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 98
d1wm3a_72 d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 1e-12
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 1e-11
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 4e-08
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: SUMO-2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.9 bits (135), Expect = 1e-12
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 17 INLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLG 76
          INL +  QDG    F+      + +L+  YCE +    +   F  +G   + + T  QL 
Sbjct: 2  INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLE 61

Query: 77 LKDGDEIDA 85
          ++D D ID 
Sbjct: 62 MEDEDTIDV 70


>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.96
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.96
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.55
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.53
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.53
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.52
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.5
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.5
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.49
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.47
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.46
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.43
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.41
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.39
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.39
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.38
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.38
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.37
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.35
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.34
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.33
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.25
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.24
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.24
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.17
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.16
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.15
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.13
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.0
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 98.99
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 98.91
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 98.89
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.82
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 98.66
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 98.51
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 98.06
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 97.27
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.99
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.86
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 96.84
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 96.44
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 96.03
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.6
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 94.38
d2npta1105 Mitogen activated protein kinase kinase 5, Map2k5 94.0
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 92.88
d1j0ga_92 Hypothetical protein 1810045k17 {Mouse (Mus muscul 92.86
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 90.36
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 89.67
d1zpsa1124 Phosphoribosyl-AMP cyclohydrolase HisI {Methanobac 89.5
d1wfya_104 Regulator of G-protein signaling 14, RGS14 {Mouse 89.32
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 88.98
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 88.61
d3d32a1118 GABA(A) receptor associated protein GABARAP {Human 88.14
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 88.14
d1eo6a_116 Golgi-associated ATPase enhancer of 16 kD, Gate-16 87.84
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 87.07
d1tygb_65 Thiamin biosynthesis sulfur carrier protein ThiS { 87.0
d1v8ca187 MoaD-related protein, N-terminal domain {Thermus t 86.78
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 86.64
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 84.11
d1ryja_70 Hypothetical protein MTH1743 {Archaeon Methanobact 83.05
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: SUMO-1 (smt3 homologue)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=2.4e-30  Score=158.35  Aligned_cols=77  Identities=27%  Similarity=0.526  Sum_probs=75.5

Q ss_pred             CcEEEEEEccCCCEEEEEEcCccHHHHHHHHHHHhcCCCCcceeEEECCeecCCCCChhhcCCCCCCEEEEEceecC
Q 045424           15 HLINLIIKSQDGDKRFFQFNHDVEIKRLLIKYCETKSQPFKSTPFLINGNRFDYSKTADQLGLKDGDEIDAMYHAFG   91 (98)
Q Consensus        15 ~~I~I~v~~~~g~~~~f~Ik~~t~l~kL~~~y~~~~g~~~~~~rF~fdG~~l~~~~Tp~~l~medgD~Idv~~~q~G   91 (98)
                      ++|+|+|++++|..++|+|++++||++||++||++.|++.++++|+|+|.+|.+++||++|+|||||+|||+++|+|
T Consensus         1 e~I~ikv~~~dg~~v~f~v~~~t~l~kl~~~y~~~~~~~~~~~~f~fdG~~l~~~~T~~~l~~edgD~Idv~~~q~G   77 (77)
T d2uyzb1           1 EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG   77 (77)
T ss_dssp             CEEEEEEECTTCCEEEEEEETTSCTHHHHHHHHHHHTCCGGGEEEEETTEECCTTCCHHHHTCCTTEEEEEEECCCC
T ss_pred             CEEEEEEECCCCCEEEEEECCCChHHHHHHHHHHHhCCChhHEEEEECCEECCCCCCHHHcCCCCCCEEEEEEecCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999998



>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2npta1 d.15.2.2 (A:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j0ga_ d.15.1.6 (A:) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zpsa1 b.168.1.1 (A:8-131) Phosphoribosyl-AMP cyclohydrolase HisI {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure