Citrus Sinensis ID: 045434

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLLQPSSSNSLNNSSSSAFTDIDSINLFNHFHHLLNGIWDLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQGESFSPKSPWQQLAAASSSTPSPPSMVPPPLTESSINNLADACSTSSSYGGSVVAAPSVWPELLLEDPLFHEIA
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHHcccccccccccHHHHHccHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHcc
mgrspccdesglkkgpwtsdedQKLVKYIQKHghgswralpklaglnrcgkscrlrwtnylrpdikrgkfsqEEEQTILNLHSILGNKwsaiaghlpgrtdneIKNFWNTHLKKKLIQmgfdpmthrprtdvfsslPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLlqpsssnslnnssssaftdidsinlfNHFHHLLNGiwdlqvpcsyqtplnknstdntvhgaefpvlsqgesfspkspwqqlaaassstpsppsmvpppltessinnladacstsssyggsvvaapsvwpellledplfheia
mgrspccdesglkkgpwtsdedQKLVKYIQKhghgswralpklaglnrcgkscrLRWTnylrpdikrgkfsqEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLLQPSSSNSLNNSSSSAFTDIDSINLFNHFHHLLNGIWDLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQGESFSPKSPWQQLAAASSSTPSPPSMVPPPLTESSINNLADACSTSSSYGGSVVAAPSVWPEllledplfheia
MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKlqylqyllqpsssnslnnssssAFTDIDSINLFNHFHHLLNGIWDLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQGESFSPKSPWQQLAAAssstpsppsmvpppLTESSINNLADACSTSSSYGGSVVAAPSVWPELLLEDPLFHEIA
***********************KLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLL*****************DIDSINLFNHFHHLLNGIWDLQVPCSYQTPL*********************************************************************GSVVAAPSVWPELLLEDPLF****
*GRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFD**********************************************************************************************************************************************************************************VWPELLLEDPLFHEI*
*************KGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLLQPS*********SSAFTDIDSINLFNHFHHLLNGIWDLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQ******************************LTESSINNLAD************VAAPSVWPELLLEDPLFHEIA
****PCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLLQ************SAFTDIDSINLFNHFHH**********************************************************************************************SVWPELLLEDPLFHEIA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTKLQYLQYLLQPSSSNSLNNSSSSAFTDIDSINLFNHFHHLLNGIWDLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQGESFSPKSPWQQLAAASSSTPSPPSMVPPPLTESSINNLADACSTSSSYGGSVVAAPSVWPELLLEDPLFHEIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q8GWP0360 Transcription factor MYB3 no no 0.588 0.516 0.575 2e-59
Q38851236 Transcription repressor M no no 0.556 0.745 0.510 6e-54
Q9SPG2366 Transcription factor MYB2 no no 0.405 0.349 0.679 8e-53
Q9SZP1282 Transcription repressor M no no 0.405 0.453 0.679 8e-53
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.405 0.435 0.687 1e-52
Q9S9K9257 Transcription factor MYB3 no no 0.401 0.494 0.685 1e-52
P81393232 Myb-related protein 308 O N/A no 0.481 0.655 0.596 2e-52
P81395274 Myb-related protein 330 O N/A no 0.401 0.463 0.685 2e-52
Q9FLR1336 Transcription factor MYB2 no no 0.405 0.380 0.687 4e-52
P80073 421 Myb-related protein Pp2 O N/A no 0.414 0.311 0.687 6e-52
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function desciption
 Score =  229 bits (585), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 139/193 (72%), Gaps = 7/193 (3%)

Query: 1   MGRSPCCDES-GLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTN 59
           MGRSPCCD+  G+KKGPW  +ED KL  YI ++G+G+WR+LPKLAGLNRCGKSCRLRW N
Sbjct: 1   MGRSPCCDQDKGVKKGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMN 60

Query: 60  YLRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQM 119
           YLRPDI+RGKFS  EE TI+ LH++LGNKWS IAGHLPGRTDNEIKN+WNTH++KKL+QM
Sbjct: 61  YLRPDIRRGKFSDGEESTIVRLHALLGNKWSKIAGHLPGRTDNEIKNYWNTHMRKKLLQM 120

Query: 120 GFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQA----EMTKLQYLQYLL 175
           G DP+TH PRT+  S  P L     L   + N  +    +        ++ KLQ +  +L
Sbjct: 121 GIDPVTHEPRTNDLS--PILDVSQMLAAAINNGQFGNNNLLNNNTALEDILKLQLIHKML 178

Query: 176 QPSSSNSLNNSSS 188
           Q  +  ++ N SS
Sbjct: 179 QIITPKAIPNISS 191

Arabidopsis thaliana (taxid: 3702)
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
224096171341 predicted protein [Populus trichocarpa] 0.949 0.879 0.638 1e-113
297742866330 unnamed protein product [Vitis vinifera] 0.946 0.906 0.610 1e-105
225462517330 PREDICTED: uncharacterized protein LOC10 0.946 0.906 0.608 1e-103
359494741346 PREDICTED: uncharacterized protein LOC10 0.933 0.852 0.609 1e-103
147765498330 hypothetical protein VITISV_036780 [Viti 0.946 0.906 0.605 1e-103
449451617344 PREDICTED: transcription factor MYB39-li 0.958 0.880 0.600 1e-101
224084666337 predicted protein [Populus trichocarpa] 0.952 0.893 0.576 2e-99
224083656196 predicted protein [Populus trichocarpa] 0.598 0.964 0.880 2e-95
224063233336 predicted protein [Populus trichocarpa] 0.939 0.883 0.566 1e-94
356510177342 PREDICTED: transcription factor MYB39-li 0.949 0.877 0.547 4e-94
>gi|224096171|ref|XP_002310560.1| predicted protein [Populus trichocarpa] gi|222853463|gb|EEE91010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/357 (63%), Positives = 258/357 (72%), Gaps = 57/357 (15%)

Query: 1   MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY 60
           MGRSPCCDESGLKKGPWTS+EDQKLVKYIQKHGHGSWRALPKL+GLNRCGKSCRLRWTNY
Sbjct: 1   MGRSPCCDESGLKKGPWTSEEDQKLVKYIQKHGHGSWRALPKLSGLNRCGKSCRLRWTNY 60

Query: 61  LRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMG 120
           LRPDIKRGKFSQEEEQTILNLHS+LGNKWSAIA HLPGRTDNEIKNFWNTHLKKKLIQMG
Sbjct: 61  LRPDIKRGKFSQEEEQTILNLHSVLGNKWSAIASHLPGRTDNEIKNFWNTHLKKKLIQMG 120

Query: 121 FDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQ---AEMTKLQYLQYLLQP 177
           FDPMTHRPRTD+FSSLPHLIALANLKEL+++H+ EE A+RLQ   A+M KLQYLQYLLQP
Sbjct: 121 FDPMTHRPRTDIFSSLPHLIALANLKELIDHHSLEEHALRLQTEAAQMAKLQYLQYLLQP 180

Query: 178 ---------SSSNSLNNSSSSAFTDIDSINLFNHFHHL-----------------LNGIW 211
                    +SSN+LNN  +   +DI++ NL N    L                 L GI 
Sbjct: 181 QPPAASNTATSSNNLNNIGT--LSDIEAFNLLNSLASLKDSPVSSLSQLDLPASSLQGIN 238

Query: 212 ----------DLQVPCSYQTPLNKNSTDNTVHGAEFPVLSQGESFSPKSPWQQLAAASSS 261
                     DLQ+PC+YQTP     T       E  V SQGE+ SP SP+Q  ++++  
Sbjct: 239 DISIPFSHLPDLQIPCNYQTP----PTKGMAQAPELTVFSQGEN-SPISPFQFPSSSTPF 293

Query: 262 TPSPPSMVPPPLTE--SSINNLADACSTSSSYGGSVVAAPSVWPELLLEDPLFHEIA 316
                    PP+T+  S +NNL DA ST SSYG  V   PSVW + LLEDP+FH+IA
Sbjct: 294 P----PSAVPPVTQISSMVNNLGDASST-SSYGEEV---PSVWHD-LLEDPMFHDIA 341

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742866|emb|CBI35631.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462517|ref|XP_002265296.1| PREDICTED: uncharacterized protein LOC100244550 [Vitis vinifera] gi|296090478|emb|CBI40674.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494741|ref|XP_002267758.2| PREDICTED: uncharacterized protein LOC100242842 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147765498|emb|CAN78108.1| hypothetical protein VITISV_036780 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449451617|ref|XP_004143558.1| PREDICTED: transcription factor MYB39-like [Cucumis sativus] gi|449523974|ref|XP_004168998.1| PREDICTED: transcription factor MYB39-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224084666|ref|XP_002307380.1| predicted protein [Populus trichocarpa] gi|222856829|gb|EEE94376.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083656|ref|XP_002307080.1| predicted protein [Populus trichocarpa] gi|222856529|gb|EEE94076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224063233|ref|XP_002301053.1| predicted protein [Populus trichocarpa] gi|222842779|gb|EEE80326.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510177|ref|XP_003523816.1| PREDICTED: transcription factor MYB39-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2023951365 MYB93 "myb domain protein 93" 0.474 0.410 0.873 8.4e-79
TAIR|locus:2145402334 MYB92 "myb domain protein 92" 0.528 0.5 0.745 1.6e-73
TAIR|locus:2171845310 MYB53 "myb domain protein 53" 0.528 0.538 0.75 1e-68
TAIR|locus:2075387321 MYB107 "myb domain protein 107 0.471 0.464 0.796 2.7e-68
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.471 0.443 0.789 1.2e-67
TAIR|locus:2150891326 MYB16 "myb domain protein 16" 0.503 0.487 0.660 5e-60
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.417 0.377 0.787 2.7e-59
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.518 0.506 0.614 8.8e-59
TAIR|locus:2102152388 MYB106 "myb domain protein 106 0.496 0.404 0.658 1.4e-57
TAIR|locus:2132957282 MYB41 "myb domain protein 41" 0.455 0.510 0.701 3.6e-57
TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 731 (262.4 bits), Expect = 8.4e-79, Sum P(2) = 8.4e-79
 Identities = 131/150 (87%), Positives = 141/150 (94%)

Query:     1 MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY 60
             MGRSPCCDE+GLKKGPWT +EDQKL+ YI KHGHGSWRALPKLA LNRCGKSCRLRWTNY
Sbjct:     1 MGRSPCCDENGLKKGPWTPEEDQKLIDYIHKHGHGSWRALPKLADLNRCGKSCRLRWTNY 60

Query:    61 LRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMG 120
             LRPDIKRGKFS EEEQTIL+LHSILGNKWSAIA HL GRTDNEIKNFWNTHLKKKLIQMG
Sbjct:    61 LRPDIKRGKFSAEEEQTILHLHSILGNKWSAIATHLQGRTDNEIKNFWNTHLKKKLIQMG 120

Query:   121 FDPMTHRPRTDVFSSLPHLIALANLKELME 150
              DP+TH+PRTD+F+SLP LIALANLK+L+E
Sbjct:   121 IDPVTHQPRTDLFASLPQLIALANLKDLIE 150
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
TAIR|locus:2145402 MYB92 "myb domain protein 92" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171845 MYB53 "myb domain protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150891 MYB16 "myb domain protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102152 MYB106 "myb domain protein 106" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132957 MYB41 "myb domain protein 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-60
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-60
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 5e-17
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-15
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-05
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 5e-04
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 0.003
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  193 bits (492), Expect = 1e-60
 Identities = 81/125 (64%), Positives = 101/125 (80%)

Query: 4   SPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRP 63
           +PCC + G+K+GPWT +ED+ LV +I+K G G WR+LPK AGL RCGKSCRLRW NYLRP
Sbjct: 15  TPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRP 74

Query: 64  DIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDP 123
            +KRG  + +EE  IL LH +LGN+WS IAG +PGRTDNEIKN+WNTHL+KKL++ G DP
Sbjct: 75  SVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP 134

Query: 124 MTHRP 128
            TH+P
Sbjct: 135 QTHKP 139

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.94
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.93
PLN03212249 Transcription repressor MYB5; Provisional 99.93
PLN03091 459 hypothetical protein; Provisional 99.91
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.63
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.63
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.59
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.54
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.54
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.41
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.39
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.34
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.19
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.19
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.11
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.08
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.96
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.81
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.83
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.69
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.64
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.61
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.55
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.27
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.04
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.03
KOG1279506 consensus Chromatin remodeling factor subunit and 96.9
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.89
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.83
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.65
KOG1279506 consensus Chromatin remodeling factor subunit and 96.62
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.58
PRK13923170 putative spore coat protein regulator protein YlbO 96.5
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.04
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.56
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.31
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.18
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.15
PRK13923170 putative spore coat protein regulator protein YlbO 95.02
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.35
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 92.87
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.65
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.58
KOG4282345 consensus Transcription factor GT-2 and related pr 91.24
KOG2656445 consensus DNA methyltransferase 1-associated prote 91.0
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 90.23
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 81.27
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 80.64
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.9e-37  Score=297.73  Aligned_cols=132  Identities=64%  Similarity=1.210  Sum_probs=127.9

Q ss_pred             CCCCCccCCCCCCCCCCCHHHHHHHHHHHHHhCCCCccccccccccccccccccccccccccCCCCCCCCCHHHHHHHHH
Q 045434            1 MGRSPCCDESGLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILN   80 (316)
Q Consensus         1 mgR~~~~~~~~lkkg~WT~EED~~L~~~V~k~G~~~W~~IA~~lgp~Rt~~qCr~Rw~~~L~p~lkkg~WT~EED~~Ll~   80 (316)
                      |||++||++..++||+||+|||++|+++|.+||..+|..||+.++++|+++|||+||.++|+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999889999999999999999999999999999999999


Q ss_pred             HHHHhCCchhhhhccCCCCCHHHHHHHHHHHhHHHhhhCCCCCCCCCccchh
Q 045434           81 LHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDV  132 (316)
Q Consensus        81 lv~~~G~~W~~IA~~lpgRT~~qcr~Rw~~~L~~~l~~~~~t~eed~~l~~l  132 (316)
                      ++++||.+|..||+.|+|||+++||+||+.+|++++++.+..+.+++++.+.
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~  132 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEV  132 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCcccc
Confidence            9999999999999999999999999999999999999999999888887654

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-24
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 3e-24
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-24
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-24
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-24
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 1e-17
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-11
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 5e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 5e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 1e-08
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 3e-08
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 4e-08
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-07
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (70%), Gaps = 3/106 (2%)
Query: 12  LKKGPWTSDEDQKLVKYIQKHGHGSWRALPK-LAGLNRCGKSCRLRWTNYLRPDIKRGKF 70
           L KGPWT +EDQK+++ ++K+G   W  + K L G  R GK CR RW N+L P++K+  +
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG--RLGKQCRERWHNHLNPEVKKSSW 62
Query: 71  SQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKL 116
           ++EE++ I   H +LGN+W+ IA  LPGRTDN +KN WN+ +K+K+
Sbjct: 63  TEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-72
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 3e-71
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 5e-70
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 8e-63
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-59
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 6e-37
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-57
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 5e-29
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-26
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 6e-23
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 8e-16
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 7e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-12
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 5e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-08
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-09
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-09
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 5e-09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 5e-09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 8e-09
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-07
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 3e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 3e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 6e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 7e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  217 bits (554), Expect = 4e-72
 Identities = 49/105 (46%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 12  LKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFS 71
           L KGPWT +EDQ+++K +QK+G   W  + K     R GK CR RW N+L P++K+  ++
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  QEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNTHLKKKL 116
           +EE++ I   H  LGN+W+ IA  LPGRTDN IKN WN+ +++K+
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.93
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.93
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.93
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.91
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.82
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.8
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.7
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.7
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.69
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.69
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.69
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.68
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.66
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.66
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.66
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.65
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.64
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.64
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.62
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.6
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.6
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.58
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.56
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.52
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.51
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.5
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.48
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.46
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.46
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.18
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.45
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.41
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.38
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.38
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.36
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.35
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.29
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.27
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.9
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.2
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.17
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.16
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.92
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.9
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.87
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.77
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.74
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.64
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.62
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.61
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.52
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.48
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.47
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.24
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.24
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.2
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.96
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.95
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.95
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.88
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.8
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.76
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.95
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.63
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.59
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.46
2crg_A70 Metastasis associated protein MTA3; transcription 97.42
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.34
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.29
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.88
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.76
2crg_A70 Metastasis associated protein MTA3; transcription 96.75
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.75
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.72
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.57
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.5
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.43
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.42
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.21
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.73
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 90.72
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 89.05
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 86.91
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 86.42
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=6.1e-43  Score=302.91  Aligned_cols=154  Identities=27%  Similarity=0.550  Sum_probs=110.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCccccccccccccccccccccccccccCCCCCCCCCHHHHHHHHHHHHHhCC-ch
Q 045434           11 GLKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSQEEEQTILNLHSILGN-KW   89 (316)
Q Consensus        11 ~lkkg~WT~EED~~L~~~V~k~G~~~W~~IA~~lgp~Rt~~qCr~Rw~~~L~p~lkkg~WT~EED~~Ll~lv~~~G~-~W   89 (316)
                      ++++++||+|||++|+++|.+||..+|..||+.+ ++|++.||++||.++|+|.+++++||+|||++|+++|.+||. +|
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l-~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYL-PNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHc-CCCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            3679999999999999999999988999999999 599999999999999999999999999999999999999996 69


Q ss_pred             hhhhccCCCCCHHHHHHHHHHHhHHHhhhCCCCCCCCCccchhhhcCChhhhHHHHHHhccCCChHHHHHHHHHHHHH
Q 045434           90 SAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLPHLIALANLKELMENHTWEEQAVRLQAEMTK  167 (316)
Q Consensus        90 ~~IA~~lpgRT~~qcr~Rw~~~L~~~l~~~~~t~eed~~l~~l~~~lg~~~~w~~Ia~~l~~rt~n~~k~r~q~~~~k  167 (316)
                      ..||..|+|||++||++||.++|++.+++++||++||..|+.++..+|  .+|+.||.+|+|||++++++||+.+++|
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g--~~W~~Ia~~l~gRt~~~~knr~~~~~r~  157 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLG--NRWAEIAKLLPGRTDNAIKNHWNSTMRR  157 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHC--SCHHHHHTTSTTCCHHHHHHHHHTTTCC
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHC--CCHHHHHHHCCCCCHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999  8999999999999999999999987655
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-22
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-12
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-20
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-11
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 6e-18
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-08
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 1e-17
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 7e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-15
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-15
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-09
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-13
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-12
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 4e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 0.001
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-08
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 6e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 1e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 85.5 bits (212), Expect = 3e-22
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 12 LKKGPWTSDEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPD 64
          L KGPWT +EDQ+L+K +QK+G   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.76
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.69
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.65
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.64
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.57
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.54
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.49
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.49
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.49
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.44
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.43
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.43
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.37
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.31
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.27
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.25
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.23
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.11
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.1
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.07
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.83
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.79
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.63
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.08
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.07
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.75
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.73
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.98
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.65
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.32
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.92
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.5
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.29
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.18
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 89.86
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 87.38
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.76  E-value=1.8e-19  Score=139.60  Aligned_cols=71  Identities=21%  Similarity=0.240  Sum_probs=66.7

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCc------hhhhhccCCCCCHHHHHHHHHHHhHHHhhhCCCCCCCCCccchhhhcCC
Q 045434           67 RGKFSQEEEQTILNLHSILGNK------WSAIAGHLPGRTDNEIKNFWNTHLKKKLIQMGFDPMTHRPRTDVFSSLP  137 (316)
Q Consensus        67 kg~WT~EED~~Ll~lv~~~G~~------W~~IA~~lpgRT~~qcr~Rw~~~L~~~l~~~~~t~eed~~l~~l~~~lg  137 (316)
                      |+.||+|||++|+++|.+||..      |..||+.|||||++|||+||+++|.|.++++.|+.+||+.+++.+..+.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~li   77 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLI   77 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhccc
Confidence            6899999999999999999964      9999999999999999999999999999999999999999999876654
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure