Citrus Sinensis ID: 045439


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYPTL
cccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHccccccHHHHHHcccccc
cccEEccccccccHHHHHHcccHHHHHHHHHccccHEEEEcccccccHHHHHHHcccHHHHHHHHHHcccHHHHHccccccEEEEEEEcccccEEccccHHHHHHHHcccccc
sliketdqylwtpIYYAAYHNQYQQIYVLLEidptasnivdkdqKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTqandhtvneqnVSVRHLLKYGYPTL
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANdhtvneqnvSVRHLLKYGYPTL
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTalhlaaarglaraNERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYPTL
******DQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGY***
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYP**
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYPTL
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYPTL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLIKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYGYPTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
Q9ZU96 532 Ankyrin repeat-containing yes no 0.752 0.159 0.302 0.0004
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function desciption
 Score = 43.5 bits (101), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 12  TPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERIISLAAKC 71
           +P+Y AA  +  + +  +L++DP+ + IV K+ K T+LH A   GL R  + +I   A  
Sbjct: 130 SPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGK-TSLHTAGRYGLLRIVKALIEKDAAI 188

Query: 72  YELVDDRGWNFFHYAMTQANDHTVNE 97
             + D +G    H A+   +   V E
Sbjct: 189 VGVKDKKGQTALHMAVKGRSLEVVEE 214





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
255551947 582 ankyrin repeat-containing protein, putat 0.831 0.161 0.474 2e-17
224127102 434 predicted protein [Populus trichocarpa] 0.849 0.221 0.443 2e-15
224107365186 predicted protein [Populus trichocarpa] 0.858 0.521 0.428 7e-14
224127079 394 predicted protein [Populus trichocarpa] 0.849 0.243 0.397 4e-13
224127106 575 predicted protein [Populus trichocarpa] 0.849 0.166 0.387 7e-13
224107373 391 predicted protein [Populus trichocarpa] 0.831 0.240 0.4 2e-12
224126975 381 predicted protein [Populus trichocarpa] 0.946 0.280 0.410 5e-12
224127104 405 predicted protein [Populus trichocarpa] 0.796 0.222 0.406 6e-12
224127098 399 predicted protein [Populus trichocarpa] 0.796 0.225 0.406 6e-12
224127077 276 predicted protein [Populus trichocarpa] 0.716 0.293 0.439 3e-11
>gi|255551947|ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (60%), Gaps = 5/99 (5%)

Query: 2   LIKETDQYLWTPIYYAAYHNQ-----YQQIYVLLEIDPTASNIVDKDQKMTALHLAAARG 56
           L  E ++  WTP++YAAY N      Y  +  LLE D +A+ +VDKD+K TALHLAA RG
Sbjct: 260 LTIEAEENGWTPLHYAAYGNDQNFGAYVIVQRLLECDKSAAYVVDKDRKRTALHLAACRG 319

Query: 57  LARANERIISLAAKCYELVDDRGWNFFHYAMTQANDHTV 95
             R  + IIS    C E+ DDRGWN  HYA+   ND  +
Sbjct: 320 NVRIMKEIISKCPDCCEIADDRGWNVLHYAVVSKNDEAL 358




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224127102|ref|XP_002329396.1| predicted protein [Populus trichocarpa] gi|222870446|gb|EEF07577.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224107365|ref|XP_002333523.1| predicted protein [Populus trichocarpa] gi|222837130|gb|EEE75509.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127079|ref|XP_002329386.1| predicted protein [Populus trichocarpa] gi|224127100|ref|XP_002329395.1| predicted protein [Populus trichocarpa] gi|222870436|gb|EEF07567.1| predicted protein [Populus trichocarpa] gi|222870445|gb|EEF07576.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224107373|ref|XP_002333525.1| predicted protein [Populus trichocarpa] gi|222837132|gb|EEE75511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126975|ref|XP_002329352.1| predicted protein [Populus trichocarpa] gi|222870402|gb|EEF07533.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127104|ref|XP_002329397.1| predicted protein [Populus trichocarpa] gi|222870447|gb|EEF07578.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127098|ref|XP_002329394.1| predicted protein [Populus trichocarpa] gi|222870444|gb|EEF07575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127077|ref|XP_002329385.1| predicted protein [Populus trichocarpa] gi|222870435|gb|EEF07566.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 47.8 bits (114), Expect = 3e-08
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 10/105 (9%)

Query: 5   ETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQKMTALHLAAARGLARANERI 64
             D+   TP++ AA +   + + +LLE      N  D D   T LHLAA  G     + +
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADV-NAKDND-GRTPLHLAAKNGHLEIVKLL 59

Query: 65  ISLAAKCYELVDDRGWNFFHYAMTQANDHTVNEQNVSVRHLLKYG 109
           +   A      D  G    H A  +  +  V      V+ LLK+G
Sbjct: 60  LEKGA-DVNARDKDGNTPLHLA-ARNGNLDV------VKLLLKHG 96


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.92
PHA02791 284 ankyrin-like protein; Provisional 99.89
PHA02741169 hypothetical protein; Provisional 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.87
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.87
PHA02874 434 ankyrin repeat protein; Provisional 99.87
PHA02878 477 ankyrin repeat protein; Provisional 99.87
PHA02791284 ankyrin-like protein; Provisional 99.87
PHA02884 300 ankyrin repeat protein; Provisional 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.86
PHA02946 446 ankyin-like protein; Provisional 99.86
PHA02878 477 ankyrin repeat protein; Provisional 99.85
PHA02875 413 ankyrin repeat protein; Provisional 99.85
PHA02875 413 ankyrin repeat protein; Provisional 99.85
PHA03100 480 ankyrin repeat protein; Provisional 99.85
PHA03095 471 ankyrin-like protein; Provisional 99.85
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.85
PHA02874 434 ankyrin repeat protein; Provisional 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.83
PHA02876 682 ankyrin repeat protein; Provisional 99.83
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.83
KOG0508 615 consensus Ankyrin repeat protein [General function 99.83
KOG0510 929 consensus Ankyrin repeat protein [General function 99.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.83
PHA02798 489 ankyrin-like protein; Provisional 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.82
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.82
PHA02876 682 ankyrin repeat protein; Provisional 99.8
PHA02798 489 ankyrin-like protein; Provisional 99.8
PHA03095 471 ankyrin-like protein; Provisional 99.8
PHA02946 446 ankyin-like protein; Provisional 99.8
KOG0510 929 consensus Ankyrin repeat protein [General function 99.8
PHA03100 480 ankyrin repeat protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.79
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.79
PHA02989 494 ankyrin repeat protein; Provisional 99.79
PHA02741169 hypothetical protein; Provisional 99.79
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.78
PHA02795 437 ankyrin-like protein; Provisional 99.78
KOG0508 615 consensus Ankyrin repeat protein [General function 99.77
PHA02884 300 ankyrin repeat protein; Provisional 99.77
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.76
PHA02730 672 ankyrin-like protein; Provisional 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
PHA02989 494 ankyrin repeat protein; Provisional 99.74
KOG0514452 consensus Ankyrin repeat protein [General function 99.73
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.71
PHA02795 437 ankyrin-like protein; Provisional 99.71
PHA02917 661 ankyrin-like protein; Provisional 99.71
PHA02917 661 ankyrin-like protein; Provisional 99.7
PHA02730 672 ankyrin-like protein; Provisional 99.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.69
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.68
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.68
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.67
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.67
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.67
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.65
PHA02792 631 ankyrin-like protein; Provisional 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.64
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.63
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.62
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.61
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.61
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.59
PHA02792 631 ankyrin-like protein; Provisional 99.58
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.57
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.56
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
KOG0514452 consensus Ankyrin repeat protein [General function 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.48
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.48
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.47
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.42
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.42
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.41
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.31
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.23
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.09
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.08
PF1360630 Ank_3: Ankyrin repeat 99.06
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.06
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.02
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.99
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.97
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.97
KOG0522 560 consensus Ankyrin repeat protein [General function 98.96
PF1360630 Ank_3: Ankyrin repeat 98.95
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.95
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.9
KOG0522 560 consensus Ankyrin repeat protein [General function 98.79
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.77
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.74
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG2384 223 consensus Major histocompatibility complex protein 98.66
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.54
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.5
KOG0511 516 consensus Ankyrin repeat protein [General function 98.46
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.37
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.28
KOG2384 223 consensus Major histocompatibility complex protein 98.03
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.95
KOG0511 516 consensus Ankyrin repeat protein [General function 97.88
KOG2505591 consensus Ankyrin repeat protein [General function 97.84
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.77
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.69
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.36
KOG2505 591 consensus Ankyrin repeat protein [General function 97.29
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.25
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 96.74
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.76
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.13
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 86.57
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=4.3e-28  Score=137.12  Aligned_cols=107  Identities=22%  Similarity=0.317  Sum_probs=80.8

Q ss_pred             cccCCCCCChHHHHHHHhCCHHHHHHHHhc-CCCCCcccccCC-CccHHHHHHHhCHHHHHHHHHhhccccccccCCCCC
Q 045439            3 IKETDQYLWTPIYYAAYHNQYQQIYVLLEI-DPTASNIVDKDQ-KMTALHLAAARGLARANERIISLAAKCYELVDDRGW   80 (113)
Q Consensus         3 ~~~~d~~g~t~l~~a~~~~~~~~~~~ll~~-~~~~~~~~~~~~-g~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~g~   80 (113)
                      ++.+|..||||||.|+..|+.++++.|+.+ |   ++.+..++ |.|+||+|+..++.+++++|++.|+. ++.+|..|.
T Consensus        65 ~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~---advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~-i~~kD~~~q  140 (226)
T KOG4412|consen   65 PDDKDDAGWTPLHIAASNGNDEVVKELLNRSG---ADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGAL-IRIKDKQGQ  140 (226)
T ss_pred             CCCccccCCchhhhhhhcCcHHHHHHHhcCCC---CCcceecCCCcceehhhhcCChhhHHHHHHhcCCC-CcccccccC
Confidence            466777788888888888888888888876 5   34444444 77888888888888888888888776 777888888


Q ss_pred             cHHHHHHHhCChhh---HHhccCCccccccCCCCCC
Q 045439           81 NFFHYAMTQANDHT---VNEQNVSVRHLLKYGYPTL  113 (113)
Q Consensus        81 t~l~~a~~~~~~~~---l~~~~~~~~~~~~~g~t~l  113 (113)
                      ||||-|+.-|..++   ++..++.+|..|++|+|||
T Consensus       141 tplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL  176 (226)
T KOG4412|consen  141 TPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPL  176 (226)
T ss_pred             chhHHHHhccchhhHHHHHhcCCCCCcccccCccHH
Confidence            88888877777743   4777788888888888876



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-05
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-05
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-04
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-04
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-04
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-05
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-05
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-05
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-04
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-04
2rfa_A 232 Transient receptor potential cation channel subfa 2e-04
2rfa_A232 Transient receptor potential cation channel subfa 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-04
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-04
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-04
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-04
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-04
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-04
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
 Score = 42.9 bits (101), Expect = 4e-06
 Identities = 20/96 (20%), Positives = 36/96 (37%), Gaps = 7/96 (7%)

Query: 3   IKETDQYLWTPIYYAAYHNQYQQIYVLLE--IDPTASNIVDKDQKMTALHLAAARGLARA 60
              TDQ   T +++A      + +  LL+  +     N  D     + LH+AA+ G    
Sbjct: 33  ATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPV---NDKDDAGW-SPLHIAASAGXDEI 88

Query: 61  NERIISLAAKCYELVDDRGWNFFHYAMTQANDHTVN 96
            + ++   A     V+  G    HYA ++       
Sbjct: 89  VKALLVKGAHVNA-VNQNGCTPLHYAASKNRHEIAV 123


>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.92
4b93_B 269 Ankyrin repeat domain-containing protein 27; endoc 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.91
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
3hra_A201 Ankyrin repeat family protein; structural protein; 99.9
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.9
2rfa_A232 Transient receptor potential cation channel subfa 99.9
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.9
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
2etb_A256 Transient receptor potential cation channel subfam 99.9
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.89
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.89
2pnn_A273 Transient receptor potential cation channel subfa 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.89
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.89
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.89
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.89
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.89
3hra_A201 Ankyrin repeat family protein; structural protein; 99.89
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.89
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.89
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.89
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 99.89
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.88
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.88
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.88
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.88
2pnn_A273 Transient receptor potential cation channel subfa 99.88
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.88
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.88
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.88
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.88
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.87
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.87
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.87
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.86
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.86
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.85
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.85
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.85
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.84
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.83
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.82
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.75
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.73
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.73
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.7
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.96  E-value=2e-28  Score=140.56  Aligned_cols=107  Identities=22%  Similarity=0.243  Sum_probs=96.8

Q ss_pred             cccCCCCCChHHHHHHHhCCHHHHHHHHhcCCCCCcccccCC-CccHHHHHHHhCHHHHHHHHHhhccccccccCCCCCc
Q 045439            3 IKETDQYLWTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQ-KMTALHLAAARGLARANERIISLAAKCYELVDDRGWN   81 (113)
Q Consensus         3 ~~~~d~~g~t~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~-g~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~g~t   81 (113)
                      ++.+|..|+||||+|+..++.+++++|++.|   ++++..+. |.||||+|+..++.+++++|+++|++ ++.+|..|+|
T Consensus        30 vn~~d~~g~t~l~~a~~~~~~~~~~~ll~~g---ad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gad-vn~~d~~G~T  105 (169)
T 4gpm_A           30 VNASDSDGRTPLHHAAENGHKEVVKLLISKG---ADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGAD-VNAKDSDGRT  105 (169)
T ss_dssp             TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT---CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTSCC
T ss_pred             CCCcCCCCCCHHHHHHHcCCHHHHHHHHhcc---cchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCC-CCCCCCCCCC
Confidence            5788999999999999999999999999999   45555555 99999999999999999999999999 8889999999


Q ss_pred             HHHHHHHhCChhh---HHhccCCccccccCCCCCC
Q 045439           82 FFHYAMTQANDHT---VNEQNVSVRHLLKYGYPTL  113 (113)
Q Consensus        82 ~l~~a~~~~~~~~---l~~~~~~~~~~~~~g~t~l  113 (113)
                      |||+|+..|+.++   ++..|++++.+|.+|+|||
T Consensus       106 pLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL  140 (169)
T 4gpm_A          106 PLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPL  140 (169)
T ss_dssp             HHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHH
T ss_pred             HHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHH
Confidence            9999999999865   4889999999999999986



>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-04
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-04
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.003
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.001
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.003
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 19/87 (21%), Positives = 30/87 (34%), Gaps = 4/87 (4%)

Query: 11 WTPIYYAAYHNQYQQIYVLLE--IDPTASNIVDKDQKMTALHLAAARGLARANERIISLA 68
           T ++ A  H     +  LL         ++ +     TALHLAA  G A   E++ + A
Sbjct: 10 DTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDL-GQTALHLAAILGEASTVEKLYA-A 67

Query: 69 AKCYELVDDRGWNFFHYAMTQANDHTV 95
               + +  G    H A         
Sbjct: 68 GAGVLVAERGGHTALHLACRVRAHTCA 94


>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.88
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.87
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.83
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.82
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.82
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.81
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.79
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.79
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.78
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.77
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.77
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.76
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.76
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.75
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.71
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.71
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.48
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.95  E-value=6.7e-28  Score=129.83  Aligned_cols=99  Identities=12%  Similarity=0.047  Sum_probs=90.8

Q ss_pred             ChHHHHHHHhCCHHHHHHHHhcCCCCCcccccCC-CccHHHHHHHhCHHHHHHHHHhhccccccccCCCCCcHHHHHHHh
Q 045439           11 WTPIYYAAYHNQYQQIYVLLEIDPTASNIVDKDQ-KMTALHLAAARGLARANERIISLAAKCYELVDDRGWNFFHYAMTQ   89 (113)
Q Consensus        11 ~t~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~-g~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~g~t~l~~a~~~   89 (113)
                      .|||++|+..|+.+++++|++.|   ++++..+. |+||+|+|+..++.+++++|++.|++ ++.+|..|+||||+|+..
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g---~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~d-in~~d~~g~tpLh~A~~~   78 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKG---EDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD-INAPDKHHITPLLSAVYE   78 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTT---CCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCT-TTCCSSSCSCHHHHHHTT
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhh---hccccccccccccccccccccccccccccccccce-eeecccccccchhhhhhc
Confidence            48999999999999999999999   45555555 99999999999999999999999999 788999999999999999


Q ss_pred             CChhh---HHhccCCccccccCCCCCC
Q 045439           90 ANDHT---VNEQNVSVRHLLKYGYPTL  113 (113)
Q Consensus        90 ~~~~~---l~~~~~~~~~~~~~g~t~l  113 (113)
                      |+.++   +++.|++++.+|.+|+|||
T Consensus        79 ~~~~~v~~Ll~~Gad~~~~d~~G~t~l  105 (118)
T d1myoa_          79 GHVSCVKLLLSKGADKTVKGPDGLTAL  105 (118)
T ss_dssp             TCCHHHHHHHTTCCCSSSSSSSTCCCC
T ss_pred             CchhhhhhhhcccccceeeCCCCCCHH
Confidence            99865   5889999999999999997



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure