Citrus Sinensis ID: 045477


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVDDVD
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHHHccEEEEEcccc
ccccHHccHHHHHHHHHcccHHHHHHHHHHHccHHHHHHcccccccEcHHHHHccccccccccHHHHHHHHHHHHHHcccEEEEEEccc
MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAkagpgaklsASEIAaqlpatknkdapTMLDRILGLLASYGIVECSVDDVD
maneardenFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQlpatknkdapTMLDRILGLLASYGIVECSVDDVD
MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVDDVD
********NFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGA********************TMLDRILGLLASYGIVECSV****
********NFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVD***
MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVDDVD
******DENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVD***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVECSVDDVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query89 2.2.26 [Sep-21-2011]
Q00763 365 Caffeic acid 3-O-methyltr N/A no 0.910 0.221 0.585 5e-18
Q43046 365 Caffeic acid 3-O-methyltr N/A no 0.910 0.221 0.585 5e-18
Q9FQY8 359 Caffeic acid 3-O-methyltr N/A no 0.910 0.225 0.524 8e-18
Q43047 364 Caffeic acid 3-O-methyltr N/A no 0.910 0.222 0.585 1e-17
O81646 359 Caffeic acid 3-O-methyltr N/A no 0.910 0.225 0.512 1e-17
Q41086 364 Caffeic acid 3-O-methyltr N/A no 0.910 0.222 0.560 1e-16
Q8LL87 350 Caffeic acid 3-O-methyltr N/A no 0.932 0.237 0.511 2e-16
Q8W013 363 Caffeic acid 3-O-methyltr N/A no 0.842 0.206 0.552 3e-16
Q43239 354 Caffeic acid 3-O-methyltr N/A no 0.988 0.248 0.443 4e-16
P46484 366 Caffeic acid 3-O-methyltr N/A no 0.853 0.207 0.545 5e-16
>sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 58/82 (70%), Gaps = 1/82 (1%)

Query: 7  DENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPT 66
          +E   +A ++   SVL M +K  I L L EI+AKAGPGA LS SEIA+ LP TKN DAP 
Sbjct: 17 EEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLP-TKNPDAPV 75

Query: 67 MLDRILGLLASYGIVECSVDDV 88
          MLDRIL LLASY I+ CS+ D+
Sbjct: 76 MLDRILRLLASYSILTCSLKDL 97




Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.
Populus tremuloides (taxid: 3693)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 Back     alignment and function description
>sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 Back     alignment and function description
>sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 Back     alignment and function description
>sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 Back     alignment and function description
>sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 Back     alignment and function description
>sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q43239|COMT1_ZINEL Caffeic acid 3-O-methyltransferase OS=Zinnia elegans PE=2 SV=1 Back     alignment and function description
>sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
224128073 358 catechol o-methyltransferase related [Po 0.932 0.231 0.678 1e-23
145695037 353 O-methyltransferase [Citrus sinensis x C 0.898 0.226 0.654 9e-22
224068173 359 catechol o-methyltransferase [Populus tr 0.932 0.231 0.607 3e-20
255548061 359 o-methyltransferase, putative [Ricinus c 0.977 0.242 0.528 5e-19
255548067 351 o-methyltransferase, putative [Ricinus c 0.977 0.247 0.528 5e-19
71482940 362 S-methyltransferase [Catharanthus roseus 0.955 0.234 0.523 1e-17
224061505 371 caffeic acid 3-O-methyltransferase [Popu 0.955 0.229 0.551 2e-17
403324062138 caffeate O-methyltransferase, partial [P 0.910 0.586 0.597 3e-17
268528131 356 caffeic acid O-methyltransferase 3 [Goss 0.898 0.224 0.604 5e-17
403324026138 caffeate O-methyltransferase, partial [P 0.910 0.586 0.585 6e-17
>gi|224128073|ref|XP_002320237.1| catechol o-methyltransferase related [Populus trichocarpa] gi|118481911|gb|ABK92890.1| unknown [Populus trichocarpa] gi|222861010|gb|EEE98552.1| catechol o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 69/84 (82%), Gaps = 1/84 (1%)

Query: 3  NEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNK 62
          +EA+DENF YA ++ + SVL MTM + I LG+FEIIAKAGP AKLSAS++AAQLP TKN 
Sbjct: 13 DEAKDENFGYAMQLALSSVLPMTMYSAIQLGIFEIIAKAGPDAKLSASDVAAQLP-TKNP 71

Query: 63 DAPTMLDRILGLLASYGIVECSVD 86
          DAP MLDRIL LLAS+ ++ CSVD
Sbjct: 72 DAPMMLDRILRLLASHDVLGCSVD 95




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|145695037|gb|ABP94018.1| O-methyltransferase [Citrus sinensis x Citrus reticulata] Back     alignment and taxonomy information
>gi|224068173|ref|XP_002302676.1| catechol o-methyltransferase [Populus trichocarpa] gi|222844402|gb|EEE81949.1| catechol o-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548061|ref|XP_002515087.1| o-methyltransferase, putative [Ricinus communis] gi|223545567|gb|EEF47071.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255548067|ref|XP_002515090.1| o-methyltransferase, putative [Ricinus communis] gi|223545570|gb|EEF47074.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|71482940|gb|AAZ32409.1| S-methyltransferase [Catharanthus roseus] Back     alignment and taxonomy information
>gi|224061505|ref|XP_002300513.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa] gi|222847771|gb|EEE85318.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|403324062|gb|AFR39620.1| caffeate O-methyltransferase, partial [Populus nigra] gi|403324066|gb|AFR39622.1| caffeate O-methyltransferase, partial [Populus nigra] gi|403324072|gb|AFR39625.1| caffeate O-methyltransferase, partial [Populus nigra] gi|403324080|gb|AFR39629.1| caffeate O-methyltransferase, partial [Populus nigra] gi|403324084|gb|AFR39631.1| caffeate O-methyltransferase, partial [Populus nigra] Back     alignment and taxonomy information
>gi|268528131|gb|ACZ06242.1| caffeic acid O-methyltransferase 3 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|403324026|gb|AFR39602.1| caffeate O-methyltransferase, partial [Populus alba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
UNIPROTKB|Q84N28 360 OMT1 "Flavone O-methyltransfer 0.966 0.238 0.448 1e-13
TAIR|locus:2153423 363 OMT1 "AT5G54160" [Arabidopsis 0.842 0.206 0.487 2.2e-12
UNIPROTKB|Q6ZD89 368 ROMT-9 "Flavone 3'-O-methyltra 0.977 0.236 0.419 2.9e-11
UNIPROTKB|P93324 372 P93324 "Isoliquiritigenin 2'-O 0.988 0.236 0.422 1.3e-10
TAIR|locus:2038026 352 AT1G33030 [Arabidopsis thalian 0.853 0.215 0.432 4.1e-09
TAIR|locus:2199582 373 IGMT4 "indole glucosinolate O- 0.797 0.190 0.432 7.6e-09
TAIR|locus:2199597 373 IGMT3 "indole glucosinolate O- 0.797 0.190 0.432 4.4e-08
TAIR|locus:2199587 373 IGMT2 "indole glucosinolate O- 0.797 0.190 0.432 4.4e-08
TAIR|locus:2204695 381 AT1G77530 [Arabidopsis thalian 0.674 0.157 0.475 4.6e-08
TAIR|locus:2199607 373 IGMT1 "indole glucosinolate O- 0.797 0.190 0.405 5.7e-08
UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 1.0e-13, P = 1.0e-13
 Identities = 39/87 (44%), Positives = 57/87 (65%)

Query:     1 MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATK 60
             MA  A +E   YA ++   S+L MT+K  I LGL E +  AG G  L+ +E+AA+LP+T 
Sbjct:     8 MAASADEEACMYALQLVSSSILPMTLKNAIELGLLETLVAAG-GKLLTPAEVAAKLPSTA 66

Query:    61 NKDAPTMLDRILGLLASYGIVECSVDD 87
             N  A  M+DR+L LLASY +V C++++
Sbjct:    67 NPAAADMVDRMLRLLASYNVVSCTMEE 93




GO:0009611 "response to wounding" evidence=IDA
GO:0009723 "response to ethylene stimulus" evidence=IDA
GO:0009751 "response to salicylic acid stimulus" evidence=IDA
GO:0042542 "response to hydrogen peroxide" evidence=IDA
TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZD89 ROMT-9 "Flavone 3'-O-methyltransferase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P93324 P93324 "Isoliquiritigenin 2'-O-methyltransferase" [Medicago sativa (taxid:3879)] Back     alignment and assigned GO terms
TAIR|locus:2038026 AT1G33030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199582 IGMT4 "indole glucosinolate O-methyltransferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199597 IGMT3 "indole glucosinolate O-methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199587 IGMT2 "indole glucosinolate O-methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199607 IGMT1 "indole glucosinolate O-methyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
COMT4
SubName- Full=Putative uncharacterized protein; (358 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
pfam0810050 pfam08100, Dimerisation, Dimerisation domain 1e-14
>gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain Back     alignment and domain information
 Score = 61.4 bits (150), Expect = 1e-14
 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 3/53 (5%)

Query: 24 MTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLA 76
          M +K  I LG+ +IIAK   G  LS SE+A++LP T N +AP MLDR+L LLA
Sbjct: 1  MVLKCAIELGIPDIIAKH--GKPLSPSELASKLP-TVNPEAPVMLDRLLRLLA 50


This domain is found at the N-terminus of a variety of plant O-methyltransferases. It has been shown to mediate dimerisation of these proteins. Length = 50

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 89
PF0810051 Dimerisation: Dimerisation domain; InterPro: IPR01 99.71
KOG3178 342 consensus Hydroxyindole-O-methyltransferase and re 99.36
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.23
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 98.2
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 97.65
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 97.36
PRK11569 274 transcriptional repressor IclR; Provisional 97.33
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 97.27
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 97.22
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 97.18
COG1414 246 IclR Transcriptional regulator [Transcription] 97.17
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 97.11
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 97.09
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 97.08
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 97.06
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 97.05
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 97.03
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 97.01
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 96.99
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 96.94
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 96.84
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 96.74
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 96.66
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 96.64
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 96.56
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 96.53
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 96.5
PRK10857 164 DNA-binding transcriptional regulator IscR; Provis 96.44
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 96.37
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 96.28
COG1959150 Predicted transcriptional regulator [Transcription 96.25
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 96.22
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 96.18
PRK06474 178 hypothetical protein; Provisional 96.17
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 96.15
PRK03573144 transcriptional regulator SlyA; Provisional 96.14
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 95.98
COG3355126 Predicted transcriptional regulator [Transcription 95.89
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 95.88
COG4190144 Predicted transcriptional regulator [Transcription 95.83
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 95.81
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 95.74
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 95.64
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 95.58
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 95.56
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 95.54
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 95.47
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 95.45
PRK11639169 zinc uptake transcriptional repressor; Provisional 95.45
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 95.35
PF06163127 DUF977: Bacterial protein of unknown function (DUF 95.28
PRK09462148 fur ferric uptake regulator; Provisional 95.2
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 95.18
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 95.18
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 95.18
PRK06266 178 transcription initiation factor E subunit alpha; V 95.16
TIGR02702 203 SufR_cyano iron-sulfur cluster biosynthesis transc 95.15
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 95.13
PRK11014141 transcriptional repressor NsrR; Provisional 95.1
PRK10870176 transcriptional repressor MprA; Provisional 94.88
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 94.84
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 94.77
PRK11920153 rirA iron-responsive transcriptional regulator; Re 94.74
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 94.62
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 94.59
COG1510177 Predicted transcriptional regulators [Transcriptio 94.51
COG2512258 Predicted membrane-associated trancriptional regul 94.49
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 94.32
PHA00738108 putative HTH transcription regulator 94.16
PRK11169164 leucine-responsive transcriptional regulator; Prov 94.12
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 94.04
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 93.95
COG1522154 Lrp Transcriptional regulators [Transcription] 93.91
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 93.88
PF0418275 B-block_TFIIIC: B-block binding subunit of TFIIIC; 93.85
PRK13777185 transcriptional regulator Hpr; Provisional 93.78
COG1846126 MarR Transcriptional regulators [Transcription] 93.61
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 93.11
PRK03902142 manganese transport transcriptional regulator; Pro 93.09
PRK1543178 ferrous iron transport protein FeoC; Provisional 93.05
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 93.02
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 93.0
PRK11050152 manganese transport regulator MntR; Provisional 92.96
PRK13509 251 transcriptional repressor UlaR; Provisional 92.96
COG2345 218 Predicted transcriptional regulator [Transcription 92.81
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 92.8
COG1378 247 Predicted transcriptional regulators [Transcriptio 92.73
COG4565224 CitB Response regulator of citrate/malate metaboli 92.71
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 92.42
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 92.1
TIGR00498 199 lexA SOS regulatory protein LexA. LexA acts as a h 91.96
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 91.88
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 91.6
COG1675 176 TFA1 Transcription initiation factor IIE, alpha su 91.39
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provis 91.35
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 91.3
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 91.25
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 91.21
PF03965115 Penicillinase_R: Penicillinase repressor; InterPro 91.07
PRK0933486 30S ribosomal protein S25e; Provisional 90.83
PRK10046225 dpiA two-component response regulator DpiA; Provis 90.8
PRK00215 205 LexA repressor; Validated 90.72
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 90.66
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 90.54
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 90.51
PF0738190 DUF1495: Winged helix DNA-binding domain (DUF1495) 90.49
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 90.32
PRK04214412 rbn ribonuclease BN/unknown domain fusion protein; 90.25
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 90.08
PF1000792 DUF2250: Uncharacterized protein conserved in arch 89.9
PF0822162 HTH_9: RNA polymerase III subunit RPC82 helix-turn 89.75
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 89.67
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 89.52
PRK14096528 pgi glucose-6-phosphate isomerase; Provisional 89.46
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 89.43
PRK11161235 fumarate/nitrate reduction transcriptional regulat 89.42
PRK04424 185 fatty acid biosynthesis transcriptional regulator; 89.08
PRK00135188 scpB segregation and condensation protein B; Revie 88.83
PHA02943 165 hypothetical protein; Provisional 88.67
PRK14165 217 winged helix-turn-helix domain-containing protein/ 88.62
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 88.3
PRK09391230 fixK transcriptional regulator FixK; Provisional 88.07
PRK11534 224 DNA-binding transcriptional regulator CsiR; Provis 88.03
PF12793115 SgrR_N: Sugar transport-related sRNA regulator N-t 88.0
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 87.84
PF1373055 HTH_36: Helix-turn-helix domain 87.65
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.31
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 87.11
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 86.89
PRK09954 362 putative kinase; Provisional 86.51
COG4189 308 Predicted transcriptional regulator [Transcription 86.11
PRK0138199 Trp operon repressor; Provisional 86.0
TIGR00331 337 hrcA heat shock gene repressor HrcA. In Bacillus s 85.93
COG1802 230 GntR Transcriptional regulators [Transcription] 85.84
smart00531147 TFIIE Transcription initiation factor IIE. 85.77
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 85.72
TIGR03338 212 phnR_burk phosphonate utilization associated trans 85.65
PF1066860 Phage_terminase: Phage terminase small subunit; In 84.42
PRK09775 442 putative DNA-binding transcriptional regulator; Pr 84.35
COG3413215 Predicted DNA binding protein [General function pr 84.32
PRK11886 319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 84.25
PRK00082 339 hrcA heat-inducible transcription repressor; Provi 83.68
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 83.43
PRK11414 221 colanic acid/biofilm transcriptional regulator; Pr 83.32
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 83.32
PRK13239 206 alkylmercury lyase; Provisional 83.25
PF1232477 HTH_15: Helix-turn-helix domain of alkylmercury ly 83.24
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 82.9
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 82.88
PF1351852 HTH_28: Helix-turn-helix domain 82.23
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 82.16
PRK12423 202 LexA repressor; Provisional 82.13
PF1344363 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 82.03
PRK11511127 DNA-binding transcriptional activator MarA; Provis 81.82
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 81.61
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 81.45
PRK11642 813 exoribonuclease R; Provisional 81.12
PF0558472 Sulfolobus_pRN: Sulfolobus plasmid regulatory prot 80.78
PHA0259183 hypothetical protein; Provisional 80.76
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 80.75
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 80.24
>PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases Back     alignment and domain information
Probab=99.71  E-value=1.4e-17  Score=94.56  Aligned_cols=51  Identities=57%  Similarity=0.862  Sum_probs=45.8

Q ss_pred             HHHHHHHHhChHHHHHhcCCCCCCCHHHHHhhCCCCCCCCCcchHHHHHHHHh
Q 045477           24 MTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLA   76 (89)
Q Consensus        24 ~aL~~av~LgIfd~l~~~g~~~~~t~~eLA~~~~~~~~~~d~~~l~RlLR~L~   76 (89)
                      ++||+|+||||||+|+++| ++|+|++||+++++ ..||.++..|+|+||+|+
T Consensus         1 MaLk~aveLgI~dii~~~g-~~~ls~~eia~~l~-~~~p~~~~~L~RimR~L~   51 (51)
T PF08100_consen    1 MALKCAVELGIPDIIHNAG-GGPLSLSEIAARLP-TSNPSAPPMLDRIMRLLV   51 (51)
T ss_dssp             HHHHHHHHTTHHHHHHHHT-TS-BEHHHHHHTST-CT-TTHHHHHHHHHHHHH
T ss_pred             CcHHHHHHcCcHHHHHHcC-CCCCCHHHHHHHcC-CCCcchHHHHHHHHHHhC
Confidence            6899999999999999987 58999999999999 788889999999999996



It has been shown to mediate dimerisation of these proteins [].; GO: 0008168 methyltransferase activity, 0046983 protein dimerization activity; PDB: 1ZGJ_A 1ZG3_A 1ZHF_A 1ZGA_A 2QYO_A 1KYW_A 1KYZ_A 3REO_D 1FPX_A 1FP2_A ....

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>COG4190 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function Back     alignment and domain information
>PF08221 HTH_9: RNA polymerase III subunit RPC82 helix-turn-helix domain; InterPro: IPR013197 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PRK14096 pgi glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PRK00135 scpB segregation and condensation protein B; Reviewed Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>PF12793 SgrR_N: Sugar transport-related sRNA regulator N-term Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>TIGR00331 hrcA heat shock gene repressor HrcA Back     alignment and domain information
>COG1802 GntR Transcriptional regulators [Transcription] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PRK09775 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11414 colanic acid/biofilm transcriptional regulator; Provisional Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>PRK13239 alkylmercury lyase; Provisional Back     alignment and domain information
>PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
1kyw_A 365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 8e-17
3p9c_A 364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 2e-15
3reo_A 368 Monolignol O-Methyltransferase (Momt) Length = 368 9e-12
1fp1_D 372 Crystal Structure Analysis Of Chalcone O-Methyltran 6e-11
1fpq_A 372 Crystal Structure Analysis Of Selenomethionine Subs 3e-06
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure

Iteration: 1

Score = 82.0 bits (201), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 43/74 (58%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Query: 12 YAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRI 71 +A ++ SVL M +K+ + L L EIIAKAGPGA++S EIA+QLP T N DAP MLDR+ Sbjct: 22 FAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLPTT-NPDAPVMLDRM 80 Query: 72 LGLLASYGIVECSV 85 L LLA Y I+ CSV Sbjct: 81 LRLLACYIILTCSV 94
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 3e-19
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 4e-19
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 5e-19
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 6e-15
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 2e-13
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 6e-13
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 1e-12
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 2e-12
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 3e-12
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 4e-12
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 1e-10
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 2e-10
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 3e-10
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 4e-09
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 9e-09
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
 Score = 78.7 bits (194), Expect = 3e-19
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 2/90 (2%)

Query: 1   MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAG-PGAKLSASEIAAQLPAT 59
             + + +E   +A ++   +VL M +KA I L + EI+AK+  P   +S +EIAAQLP T
Sbjct: 13  PTHSSDEEANLFAMQLASAAVLPMALKAAIELDVLEIMAKSVPPSGYISPAEIAAQLP-T 71

Query: 60  KNKDAPTMLDRILGLLASYGIVECSVDDVD 89
            N +AP MLDR+L LLASY +V  ++ ++ 
Sbjct: 72  TNPEAPVMLDRVLRLLASYSVVTYTLRELP 101


>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 99.67
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.66
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 99.66
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.55
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 99.54
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 99.53
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 99.51
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.51
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 99.51
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 99.48
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.45
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 99.44
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 99.39
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.37
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.36
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.29
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 97.5
3r0a_A123 Putative transcriptional regulator; structural gen 97.32
2hr3_A147 Probable transcriptional regulator; MCSG, structur 97.26
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 97.21
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 97.18
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 97.17
1qbj_A81 Protein (double-stranded RNA specific adenosine D 97.16
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 97.12
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 97.1
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 97.05
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 97.04
1y0u_A96 Arsenical resistance operon repressor, putative; s 97.03
3ech_A142 MEXR, multidrug resistance operon repressor; winge 97.03
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 97.0
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 96.99
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 96.98
1mkm_A 249 ICLR transcriptional regulator; structural genomic 96.93
1sfx_A109 Conserved hypothetical protein AF2008; structural 96.92
1s3j_A155 YUSO protein; structural genomics, MARR transcript 96.92
2jt1_A77 PEFI protein; solution structure, winged helix-tur 96.91
2gxg_A146 146AA long hypothetical transcriptional regulator; 96.91
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 96.9
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 96.89
2nnn_A140 Probable transcriptional regulator; structural gen 96.89
2fe3_A145 Peroxide operon regulator; oxidative stress regula 96.85
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 96.83
3bja_A139 Transcriptional regulator, MARR family, putative; 96.82
3bdd_A142 Regulatory protein MARR; putative multiple antibio 96.81
1ku9_A152 Hypothetical protein MJ223; putative transcription 96.8
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 96.8
3boq_A160 Transcriptional regulator, MARR family; MARR famil 96.8
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 96.79
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 96.78
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 96.77
3e6m_A161 MARR family transcriptional regulator; APC88769, s 96.77
3f3x_A144 Transcriptional regulator, MARR family, putative; 96.77
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 96.76
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.76
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 96.76
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 96.74
3f6o_A118 Probable transcriptional regulator, ARSR family pr 96.72
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 96.72
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 96.72
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 96.71
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 96.7
2eth_A154 Transcriptional regulator, putative, MAR family; M 96.69
3oop_A143 LIN2960 protein; protein structure initiative, PSI 96.69
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 96.67
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 96.67
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 96.65
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 96.65
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 96.64
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 96.63
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 96.62
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 96.62
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 96.61
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 96.6
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 96.59
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 96.58
3jth_A98 Transcription activator HLYU; transcription factor 96.57
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 96.56
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 96.55
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 96.55
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 96.54
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 96.54
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 96.52
3lwf_A159 LIN1550 protein, putative transcriptional regulato 96.51
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 96.5
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 96.49
2nyx_A168 Probable transcriptional regulatory protein, RV14; 96.48
3nqo_A189 MARR-family transcriptional regulator; structural 96.47
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 96.47
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 96.41
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 96.4
2g7u_A 257 Transcriptional regulator; ICLR family, structural 96.38
3cjn_A162 Transcriptional regulator, MARR family; silicibact 96.38
4aik_A151 Transcriptional regulator SLYA; transcription, tra 96.36
2pex_A153 Transcriptional regulator OHRR; transcription regu 96.36
1z91_A147 Organic hydroperoxide resistance transcriptional; 96.35
2frh_A127 SARA, staphylococcal accessory regulator A; winged 96.35
3s2w_A159 Transcriptional regulator, MARR family; structural 96.33
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 96.3
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 96.29
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 96.26
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 96.24
2w25_A150 Probable transcriptional regulatory protein; trans 96.21
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, st 96.18
2kko_A108 Possible transcriptional regulatory protein (possi 96.15
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 96.13
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 96.12
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 96.1
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 96.05
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 96.04
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 96.03
2pg4_A95 Uncharacterized protein; structural genomics, join 96.01
3f6v_A151 Possible transcriptional regulator, ARSR family pr 96.0
1ylf_A149 RRF2 family protein; structural genomics, transcri 95.99
3k69_A162 Putative transcription regulator; putative transcr 95.94
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 95.94
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 95.89
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 95.87
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 95.85
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 95.85
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 95.84
2fxa_A 207 Protease production regulatory protein HPR; protea 95.77
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 95.77
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 95.73
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 95.72
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 95.7
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 95.62
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 95.61
4fx0_A148 Probable transcriptional repressor protein; helix- 95.57
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 95.56
2ia0_A 171 Putative HTH-type transcriptional regulator PF086; 95.53
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 95.51
1yyv_A131 Putative transcriptional regulator; reductive meth 95.46
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 95.45
2hoe_A 380 N-acetylglucosamine kinase; TM1224, structural gen 95.45
2wte_A244 CSA3; antiviral protein, viral resistance, winged 95.45
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 95.39
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 95.38
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, str 95.29
1p6r_A82 Penicillinase repressor; transcription regulation, 95.27
2p4w_A 202 Transcriptional regulatory protein ARSR family; ar 95.26
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 95.25
3i4p_A 162 Transcriptional regulator, ASNC family; PSI, struc 95.22
1xd7_A145 YWNA; structural genomics, protein structure initi 95.22
1bja_A95 Transcription regulatory protein MOTA; activation 95.13
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 95.11
3df8_A111 Possible HXLR family transcriptional factor; APC89 95.06
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 94.96
1z6r_A 406 MLC protein; transcriptional repressor, ROK family 94.87
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 94.85
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 94.84
2obp_A96 Putative DNA-binding protein; structural genomics, 94.69
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 94.69
2w57_A150 Ferric uptake regulation protein; gene regulation, 94.64
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 94.58
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 94.55
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 94.49
1z05_A 429 Transcriptional regulator, ROK family; structural 94.49
1hsj_A487 Fusion protein consisting of staphylococcus access 94.38
4ets_A162 Ferric uptake regulation protein; metal binding pr 94.34
2vn2_A128 DNAD, chromosome replication initiation protein; D 94.33
1okr_A123 MECI, methicillin resistance regulatory protein ME 94.25
2qm3_A 373 Predicted methyltransferase; putative methyltransf 94.24
2h09_A155 Transcriptional regulator MNTR; transcription regu 94.1
1p4x_A 250 Staphylococcal accessory regulator A homologue; wi 93.91
4g6q_A 182 Putative uncharacterized protein; structural genom 93.78
1jhg_A101 Trp operon repressor; complex (regulatory protein- 93.62
1j5y_A 187 Transcriptional regulator, biotin repressor famil; 93.41
2qlz_A 232 Transcription factor PF0095; 2.50A {Pyrococcus fur 92.95
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 92.82
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 92.52
3cta_A 230 Riboflavin kinase; structural genomics, transferas 92.1
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 92.04
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 91.29
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 91.27
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 91.08
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 91.02
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 90.98
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 90.83
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 90.74
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 90.73
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 90.73
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 90.43
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 90.28
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 90.27
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 90.26
3b02_A195 Transcriptional regulator, CRP family; structural 90.05
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 90.0
1ft9_A222 Carbon monoxide oxidation system transcription reg 89.95
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 89.94
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 89.88
4esf_A117 PADR-like transcriptional regulator; PADR family, 89.81
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 89.77
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 89.76
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 89.54
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 89.42
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 89.41
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 89.24
1stz_A 338 Heat-inducible transcription repressor HRCA homol; 89.17
1yg2_A 179 Gene activator APHA; virulence factor, winged heli 89.11
3by6_A126 Predicted transcriptional regulator; structural ge 88.74
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 88.64
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 88.36
3frw_A107 Putative Trp repressor protein; structural genomic 88.34
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 88.28
3c7j_A 237 Transcriptional regulator, GNTR family; structural 88.23
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 88.22
1bia_A 321 BIRA bifunctional protein; transcription regulatio 87.94
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 87.78
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 87.69
2z99_A219 Putative uncharacterized protein; winged helix dom 87.63
3f8b_A116 Transcriptional regulator, PADR-like family; winge 87.42
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 87.35
3lsg_A103 Two-component response regulator YESN; structural 87.17
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 87.01
2gqq_A163 Leucine-responsive regulatory protein; helix-turn- 86.73
1xma_A145 Predicted transcriptional regulator; southea colla 86.49
2k9s_A107 Arabinose operon regulatory protein; activator, ar 86.37
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 86.35
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 86.34
3mn2_A108 Probable ARAC family transcriptional regulator; st 86.3
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 86.07
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 86.01
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 85.96
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 85.7
3oou_A108 LIN2118 protein; protein structure initiative, PSI 85.42
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 85.34
1t6s_A162 Conserved hypothetical protein; A winged helix-tur 85.16
2vxz_A 165 Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py 84.66
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 84.24
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 83.92
2o0m_A 345 Transcriptional regulator, SORC family; structural 83.51
2qq9_A 226 Diphtheria toxin repressor; regulator, DTXR, helix 83.46
3sxy_A 218 Transcriptional regulator, GNTR family; transcript 83.27
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 83.07
2fq3_A104 Transcription regulatory protein SWI3; four-helix 82.95
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 82.88
1lva_A258 Selenocysteine-specific elongation factor; winged- 82.39
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 82.28
3ic7_A126 Putative transcriptional regulator; helix-turn-hel 81.91
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 81.88
2hs5_A 239 Putative transcriptional regulator GNTR; APC6050, 80.89
1bl0_A129 Protein (multiple antibiotic resistance protein), 80.82
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 80.81
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.67  E-value=1.3e-16  Score=117.07  Aligned_cols=78  Identities=18%  Similarity=0.336  Sum_probs=70.6

Q ss_pred             CchhHhhHHHHHHHHHHHhHHHHHHHHHHHHhChHHHHHhcCCCCCCCHHHHHhhCCCCCCCCCcchHHHHHHHHhccCc
Q 045477            1 MANEARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGI   80 (89)
Q Consensus         1 ~~~~~~~~~~~~~~~l~~~~~~~~aL~~av~LgIfd~l~~~g~~~~~t~~eLA~~~~~~~~~~d~~~l~RlLR~L~s~gi   80 (89)
                      |++. +++.+..+++++.||+.+++|++|++|||||+|++.+  +|+|++|||++++ +    ++..++|+||+|++.|+
T Consensus         1 M~~~-e~~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~--~p~t~~eLA~~~g-~----~~~~l~rlLr~L~~~gl   72 (353)
T 4a6d_A            1 MGSS-EDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAP--GPLDVAAVAAGVR-A----SAHGTELLLDICVSLKL   72 (353)
T ss_dssp             CCTT-SCHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSS--SCBCHHHHHHHHT-C----CHHHHHHHHHHHHHTTS
T ss_pred             CCCh-hHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCC--CCCCHHHHHHhhC-c----CHHHHHHHHHHHHHCCC
Confidence            5554 4588888999999999999999999999999999865  8999999999999 9    99999999999999999


Q ss_pred             eeeecc
Q 045477           81 VECSVD   86 (89)
Q Consensus        81 ~~e~~~   86 (89)
                      |++..+
T Consensus        73 l~~~~~   78 (353)
T 4a6d_A           73 LKVETR   78 (353)
T ss_dssp             EEEEEE
T ss_pred             EEEecc
Confidence            986543



>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Back     alignment and structure
>1stz_A Heat-inducible transcription repressor HRCA homol; circe element, structural genomics, BSGC structure FUN NIH, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.51 d.110.2.3 Back     alignment and structure
>1yg2_A Gene activator APHA; virulence factor, winged helix, transcripti factor, transcription; 2.20A {Vibrio cholerae} SCOP: a.4.5.61 Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3c7j_A Transcriptional regulator, GNTR family; structural genomics, PSI-2, protein structure initiative, midwest center for STR genomics; HET: MSE; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>2z99_A Putative uncharacterized protein; winged helix domain, cell cycle, cell division, chromosome partition, cytoplasm; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3f8b_A Transcriptional regulator, PADR-like family; winged helix turn helix, transcription regulator; 2.00A {Lactococcus lactis subsp} SCOP: a.4.5.0 PDB: 3f8c_A* 3f8f_A* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>2gqq_A Leucine-responsive regulatory protein; helix-turn-helix, transcription; 3.20A {Escherichia coli} PDB: 2l4a_A Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1t6s_A Conserved hypothetical protein; A winged helix-turn-helix, structural genomics, BSGC structu by NIH, protein structure initiative, PSI; 1.95A {Chlorobium tepidum tls} SCOP: a.4.5.60 a.4.5.60 Back     alignment and structure
>2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3sxy_A Transcriptional regulator, GNTR family; transcription factor, metal-binding, structur genomics, PSI-2, protein structure initiative; 1.65A {Thermotoga maritima} PDB: 3dbw_A 3fms_A* Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>2hs5_A Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RH structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} SCOP: a.4.5.6 a.78.1.1 Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 89
d1fp1d1110 a.4.5.29 (D:19-128) Chalcone O-methyltransferase { 4e-27
d1kyza1107 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic 5e-26
d1fp2a1101 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase 1e-11
d1qzza192 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase R 1e-07
d1tw3a185 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransfer 3e-05
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Plant O-methyltransferase, N-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
 Score = 93.3 bits (232), Expect = 4e-27
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 2/88 (2%)

Query: 4  EARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAG-PGAKLSASEIAAQLPA-TKN 61
          +  D     A  +T   V    + A I+L LFEIIAKA  PGA +S SEIA++LPA T++
Sbjct: 1  QTEDSACLSAMVLTTNLVYPAVLNAAIDLNLFEIIAKATPPGAFMSPSEIASKLPASTQH 60

Query: 62 KDAPTMLDRILGLLASYGIVECSVDDVD 89
           D P  LDR+L LLASY ++  +   ++
Sbjct: 61 SDLPNRLDRMLRLLASYSVLTSTTRTIE 88


>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 Back     information, alignment and structure
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 92 Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
d1kyza1107 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.89
d1fp2a1101 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.89
d1fp1d1110 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.87
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 99.74
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.74
d1mkma175 Transcriptional regulator IclR, N-terminal domain 98.11
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 97.63
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 97.4
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 97.3
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 97.27
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 97.24
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 97.14
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 97.13
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 97.07
d1xd7a_127 Hypothetical protein ywnA {Bacillus subtilis [TaxI 97.03
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 97.02
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 96.93
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 96.92
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 96.88
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 96.86
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii 96.57
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 96.53
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 96.5
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 96.48
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 96.46
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 96.45
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 96.38
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 96.37
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 96.37
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 96.29
d2dk5a178 DNA-directed RNA polymerase III subunit RPC6, RPO3 96.27
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 96.16
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 96.08
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 96.06
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 96.06
d2p4wa1 194 Transcriptional regulatory protein PF1790 {Pyrococ 96.05
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 95.98
d1z91a1137 Organic hydroperoxide resistance transcriptional r 95.96
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 95.89
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 95.89
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 95.88
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 95.83
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 95.81
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 95.7
d2g9wa1122 Hypothetical protein Rv1846c {Mycobacterium tuberc 95.67
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 95.65
d1q1ha_88 Transcription factor E/IIe-alpha, N-terminal domai 95.54
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.45
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 95.38
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 95.11
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 94.34
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 94.34
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 94.25
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 94.23
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 94.23
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 93.97
d1i5za169 Catabolite gene activator protein (CAP), C-termina 93.79
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 93.57
d1okra_120 Methicillin resistance regulatory protein MecI {St 93.24
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 93.06
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 92.94
d2obpa181 Putative DNA-binding protein ReutB4095 {Ralstonia 92.79
d1zyba173 Probable transcription regulator BT4300, C-termina 92.55
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 92.06
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 92.02
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 91.85
d1hw1a174 Fatty acid responsive transcription factor FadR, N 91.79
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 91.49
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 91.24
d2fq3a185 Transcription regulatory protein swi3 {Baker's yea 90.88
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 90.71
d1p6ra_82 Penicillinase repressor BlaI {Bacillus licheniform 90.46
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 88.79
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 88.5
d2dw4a1102 Lysine-specific histone demethylase 1, LSD1 {Human 88.37
d1j75a_57 Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} 88.12
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 87.23
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 86.69
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 85.41
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 84.79
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 84.6
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 83.71
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 83.44
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 83.34
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 81.76
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 80.55
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginos 80.13
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Plant O-methyltransferase, N-terminal domain
domain: Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.89  E-value=9.7e-24  Score=133.44  Aligned_cols=82  Identities=54%  Similarity=0.807  Sum_probs=75.3

Q ss_pred             hHhhHHHHHHHHHHHhHHHHHHHHHHHHhChHHHHHhcCCCCCCCHHHHHhhCCCCCCCCCcchHHHHHHHHhccCceee
Q 045477            4 EARDENFAYAFEVTMGSVLHMTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC   83 (89)
Q Consensus         4 ~~~~~~~~~~~~l~~~~~~~~aL~~av~LgIfd~l~~~g~~~~~t~~eLA~~~~~~~~~~d~~~l~RlLR~L~s~gi~~e   83 (89)
                      -++++.+.+.++++++++.|++||+|++|||||+|+++|++.++|+.||+.+++ ..||+.+..|+||||+|+++|+|++
T Consensus         2 ~~dee~~l~a~~L~~~~v~pmaLk~AieLgI~DiI~~~G~~~~ls~~eia~~l~-~~~p~~~~~L~RilR~Las~~vf~~   80 (107)
T d1kyza1           2 ISDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEIASQLP-TTNPDAPVMLDRMLRLLACYIILTC   80 (107)
T ss_dssp             CCHHHHHHHHHHHHTTTHHHHHHHHHHHTTHHHHHHTTCTTCCBCHHHHHHTSS-CCCTTHHHHHHHHHHHHHHTTSEEE
T ss_pred             cccHHHHHHHHHHHHhhHHHHHHHHHHHcCCHHHHHHcCCCCCCCHHHHHHhcC-CCCCcchHHHHHHHHHHHhcCceEE
Confidence            367888899999999999999999999999999999998778999999999999 8888888899999999999999997


Q ss_pred             ecc
Q 045477           84 SVD   86 (89)
Q Consensus        84 ~~~   86 (89)
                      +.+
T Consensus        81 ~~~   83 (107)
T d1kyza1          81 SVR   83 (107)
T ss_dssp             EEE
T ss_pred             eee
Confidence            643



>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure