Citrus Sinensis ID: 045729


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MRLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLRLL
ccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccEEcccEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccEEEEcccccccccccccEEEccccccEEcccccccccccccEEEccccccEEEcccccccccc
ccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccHcccccccccccccccccccccccEEEEEEEEEcEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccc
mrlsiffvPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLtnnwsisypictwigiscgsrhqrvtalnlsdiglggtipphlgnlTFLVSLDVAhnnfrghlpnELGQLRRLRFIRFGfnklsgsipTWIGVLSKLQTLRlynnsftgpipnslfnlskLEVFNAMYNvidgnipsrignfsspfilNLGYNNLQGLLTIFGRLRLL
MRLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFnklsgsiptWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLRLL
MRLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFIlnlgynnlqgllTIFGRLRLL
**LSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLR**
***SIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRS**T**WSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLRLL
MRLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLRLL
*RLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRL***
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLSIFFVPMLFLQYLIMASLAMTTLNNLTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTIFGRLRLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.697 0.150 0.418 3e-34
C0LGT6 1031 LRR receptor-like serine/ no no 0.926 0.195 0.372 4e-31
Q9SD62 1025 Putative receptor-like pr no no 0.816 0.173 0.351 5e-26
Q42371 976 LRR receptor-like serine/ no no 0.821 0.183 0.368 6e-24
P93194 1109 Receptor-like protein kin N/A no 0.816 0.160 0.355 4e-22
Q9LVP0 1102 Probable leucine-rich rep no no 0.922 0.182 0.313 7e-22
O49318 1124 Probable leucine-rich rep no no 0.912 0.177 0.337 9e-22
O65440 992 Leucine-rich repeat recep no no 0.935 0.205 0.336 4e-21
Q9FK10 601 Probable inactive recepto no no 0.793 0.287 0.365 8e-21
Q9FL63 614 Inactive leucine-rich rep no no 0.908 0.322 0.354 4e-20
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  145 bits (365), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 112/177 (63%)

Query: 31  ADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIP 90
            D+ ALL FK++V + + V+ ++W+ S+P+C W G++CG +++RVT L L  + LGG I 
Sbjct: 24  TDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGGVIS 83

Query: 91  PHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTL 150
           P +GNL+FLVSLD+  N F G +P E+GQL RL ++  G N L G IP  +   S+L  L
Sbjct: 84  PSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNL 143

Query: 151 RLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQG 207
           RL +N   G +P+ L +L+ L   N   N + G +P+ +GN +    L L +NNL+G
Sbjct: 144 RLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEG 200





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description
>sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL63|Y5410_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At5g24100 OS=Arabidopsis thaliana GN=At5g24100 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
255583729 383 serine-threonine protein kinase, plant-t 0.903 0.514 0.492 9e-45
224115338255 predicted protein [Populus trichocarpa] 0.949 0.811 0.449 3e-44
449500845 982 PREDICTED: probable LRR receptor-like se 1.0 0.221 0.429 1e-43
359483198 1087 PREDICTED: probable LRR receptor-like se 0.922 0.184 0.490 8e-41
147773168 362 hypothetical protein VITISV_016304 [Viti 0.844 0.508 0.510 1e-40
449465016 1092 PREDICTED: probable LRR receptor-like se 0.899 0.179 0.451 2e-39
356510768 1214 PREDICTED: probable LRR receptor-like se 0.885 0.158 0.441 3e-38
255583725 973 serine-threonine protein kinase, plant-t 0.912 0.204 0.463 3e-38
224072373 1067 predicted protein [Populus trichocarpa] 0.866 0.177 0.468 4e-38
224072371230 predicted protein [Populus trichocarpa] 0.866 0.821 0.468 8e-38
>gi|255583729|ref|XP_002532618.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527674|gb|EEF29784.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 2/199 (1%)

Query: 10  MLFLQYLIMASLAMTTLNNLTADQSALLAFKARVV-DYRSVLTNNWSISYPICTWIGISC 68
           ++ L Y   ASL +  + NL  DQ  LLA K R++ D  ++L  NWS +  +CTW+G++C
Sbjct: 12  IMMLLYSFFASL-VEGVTNLATDQDGLLALKLRLIRDPNNLLATNWSTTTSVCTWVGVTC 70

Query: 69  GSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRF 128
           G+RH RV AL+LSD+GL GT+PPHLGNL+FLV +   +N+F G LPNEL +LRR++    
Sbjct: 71  GARHGRVAALDLSDMGLTGTVPPHLGNLSFLVFISFYNNSFHGSLPNELSKLRRMKTFWL 130

Query: 129 GFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSR 188
             N  SG IP+W+G  ++LQ L L  N FTG IP S FNLSKL  F+   N + G IP  
Sbjct: 131 TKNYFSGEIPSWLGSFARLQQLSLGFNKFTGVIPVSFFNLSKLNFFDLSSNKLQGYIPKA 190

Query: 189 IGNFSSPFILNLGYNNLQG 207
           IGN +S  IL+L  NN  G
Sbjct: 191 IGNLNSLRILSLEKNNFSG 209




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224115338|ref|XP_002317007.1| predicted protein [Populus trichocarpa] gi|222860072|gb|EEE97619.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449500845|ref|XP_004161209.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359483198|ref|XP_002271405.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147773168|emb|CAN71566.1| hypothetical protein VITISV_016304 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465016|ref|XP_004150225.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356510768|ref|XP_003524106.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|255583725|ref|XP_002532616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527672|gb|EEF29782.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224072373|ref|XP_002303705.1| predicted protein [Populus trichocarpa] gi|222841137|gb|EEE78684.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072371|ref|XP_002303704.1| predicted protein [Populus trichocarpa] gi|222841136|gb|EEE78683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.834 0.180 0.4 5.9e-31
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.844 0.181 0.361 2.6e-30
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.880 0.186 0.377 1.1e-28
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.825 0.178 0.369 9.6e-28
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.747 0.159 0.380 5.5e-27
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.729 0.195 0.407 3.9e-25
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.816 0.182 0.370 1.7e-23
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.839 0.306 0.333 4.6e-23
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.825 0.162 0.349 9.2e-23
TAIR|locus:2120412 992 BAM3 "BARELY ANY MERISTEM 3" [ 0.876 0.192 0.333 1.3e-22
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 352 (129.0 bits), Expect = 5.9e-31, P = 5.9e-31
 Identities = 74/185 (40%), Positives = 113/185 (61%)

Query:    11 LFLQYLIMASLAMTTLNNLT--ADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISC 68
             LFL     A + + T +  T   D+ ALL FK++V + + V+ ++W+ S+P+C W G++C
Sbjct:     3 LFLLLAFNALMLLET-HGFTDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTC 61

Query:    69 GSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRF 128
             G +++RVT L L  + LGG I P +GNL+FLVSLD+  N F G +P E+GQL RL ++  
Sbjct:    62 GRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDM 121

Query:   129 GFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSR 188
             G N L G IP  +   S+L  LRL +N   G +P+ L +L+ L   N   N + G +P+ 
Sbjct:   122 GINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTS 181

Query:   189 IGNFS 193
             +GN +
Sbjct:   182 LGNLT 186


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-23
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 98.4 bits (245), Expect = 9e-24
 Identities = 56/130 (43%), Positives = 72/130 (55%)

Query: 78  LNLSDIGLGGTIPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRRLRFIRFGFNKLSGSI 137
           L+L    L G IP  L NLT L  L +A N   G +P ELGQ++ L++I  G+N LSG I
Sbjct: 169 LDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEI 228

Query: 138 PTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFI 197
           P  IG L+ L  L L  N+ TGPIP+SL NL  L+      N + G IP  I +      
Sbjct: 229 PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS 288

Query: 198 LNLGYNNLQG 207
           L+L  N+L G
Sbjct: 289 LDLSDNSLSG 298


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
KOG0617264 consensus Ras suppressor protein (contains leucine 99.8
PLN03150623 hypothetical protein; Provisional 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
PLN03150623 hypothetical protein; Provisional 99.54
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.53
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.53
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.5
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.5
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.49
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.49
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.27
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.23
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.2
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.18
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.15
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.1
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.81
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.58
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.57
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.56
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.45
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.41
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.27
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.26
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.6
PRK15386 426 type III secretion protein GogB; Provisional 97.41
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.31
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.28
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.12
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.98
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.9
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.67
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.57
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.47
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.88
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.09
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.05
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.1
smart0037026 LRR Leucine-rich repeats, outliers. 93.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.6
smart0037026 LRR Leucine-rich repeats, outliers. 92.6
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.46
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 85.97
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.71
KOG1947 482 consensus Leucine rich repeat proteins, some prote 82.12
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.21
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.95  E-value=4e-27  Score=215.71  Aligned_cols=187  Identities=33%  Similarity=0.617  Sum_probs=132.2

Q ss_pred             ChHHHHHHHHHHHhccCCCCccCCCCCCCCCCCccceeeeCCCCCcEEEEEcCCCCCcccCCcCCCCCCCCCEEEccCCc
Q 045729           29 LTADQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVSLDVAHNN  108 (218)
Q Consensus        29 ~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~l~~l~l~~~~l~~~~~~~l~~l~~L~~L~l~~n~  108 (218)
                      .+.|..||++||+++.++...+.+ |+...++|.|.|+.|+. .++++.|++++|++++.+++.+..+++|+.|++++|.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~-w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSN-WNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCC-CCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCc
Confidence            458999999999999766666666 98878999999999985 4689999999999998888888889999999999998


Q ss_pred             ccccCCcccC-CCCCCcEEEccCccccc----------------------cCchhhcCCCCCCEEEccCCcccCCCCccc
Q 045729          109 FRGHLPNELG-QLRRLRFIRFGFNKLSG----------------------SIPTWIGVLSKLQTLRLYNNSFTGPIPNSL  165 (218)
Q Consensus       109 l~~~~p~~~~-~l~~L~~L~l~~n~l~~----------------------~~p~~~~~l~~L~~L~l~~n~l~~~~p~~l  165 (218)
                      +.+.+|..+. .+++|++|++++|.+++                      .+|..++.+++|++|++++|.+.+.+|..+
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~  184 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL  184 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhh
Confidence            8877876644 66666666666666654                      444445555555555555555555555555


Q ss_pred             cCCCCCcEEecccCcccccCCccCCCCCCCCEEEccCCcCcccCCC-CCCCCC
Q 045729          166 FNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNNLQGLLTI-FGRLRL  217 (218)
Q Consensus       166 ~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~-~~~l~~  217 (218)
                      .++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|. ++++++
T Consensus       185 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  237 (968)
T PLN00113        185 TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS  237 (968)
T ss_pred             hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCC
Confidence            5555666666666665555555566666666666666666554443 444443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-13
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-12
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 54/180 (30%), Positives = 84/180 (46%), Gaps = 34/180 (18%) Query: 42 RVVDYRSVLTNNWSISYPICTWIGISCGSRHQRVTALNLSDIGLGGTIPPHLGNLTFLVS 101 + + Y S+ N ++ P ++ +C +T L+LS G +PP G+ + L S Sbjct: 269 KSLQYLSLAENKFTGEIP--DFLSGAC----DTLTGLDLSGNHFYGAVPPFFGSCSLLES 322 Query: 102 LDVAHNNFRGHLP-NELGQLRRLRFIRFGFNKLSGSIPTWIGVLSK-------------- 146 L ++ NNF G LP + L ++R L+ + FN+ SG +P + LS Sbjct: 323 LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG 382 Query: 147 -------------LQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFS 193 LQ L L NN FTG IP +L N S+L + +N + G IPS +G+ S Sbjct: 383 PILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLS 442
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-15
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  146 bits (372), Expect = 2e-43
 Identities = 58/218 (26%), Positives = 91/218 (41%), Gaps = 32/218 (14%)

Query: 32  DQSALLAFKARVVDYRSVLTNNWSISYPICTWIGISCGSRHQ--RVTALNLSDIGLGGT- 88
           D+ ALL  K  + +  ++ +   +      TW+G+ C +  Q  RV  L+LS + L    
Sbjct: 7   DKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPY 66

Query: 89  --------------------------IPPHLGNLTFLVSLDVAHNNFRGHLPNELGQLRR 122
                                     IPP +  LT L  L + H N  G +P+ L Q++ 
Sbjct: 67  PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKT 126

Query: 123 LRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVF-NAMYNVI 181
           L  + F +N LSG++P  I  L  L  +    N  +G IP+S  + SKL        N +
Sbjct: 127 LVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL 186

Query: 182 DGNIPSRIGNFSSPFILNLGYNNLQGLL-TIFGRLRLL 218
            G IP    N  +   ++L  N L+G    +FG  +  
Sbjct: 187 TGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNT 223


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.84
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.84
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.82
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.82
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.81
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.8
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.79
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.78
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.78
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.71
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.68
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.68
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.63
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.63
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.63
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.63
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.61
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.53
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.52
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.42
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.4
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.33
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.98
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.58
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.51
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.47
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.64
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.9e-32  Score=219.29  Aligned_cols=186  Identities=30%  Similarity=0.523  Sum_probs=167.7

Q ss_pred             CCChHHHHHHHHHHHhccCCCCccCCCCCCCCCCCc--cceeeeCCCC--CcEEEEEcCCCCCcc--cCCcCCCCCCCCC
Q 045729           27 NNLTADQSALLAFKARVVDYRSVLTNNWSISYPICT--WIGISCGSRH--QRVTALNLSDIGLGG--TIPPHLGNLTFLV  100 (218)
Q Consensus        27 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~--~~l~~l~l~~~~l~~--~~~~~l~~l~~L~  100 (218)
                      .|.++|..||++||+++.++. .+.+ |..+.++|.  |.||.|+...  .+++.|+++++.+++  .+|+.+.++++|+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~-W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~   79 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSS-WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTT-CCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccC-CCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCCC
Confidence            367899999999999997665 6677 988778998  9999998643  789999999999998  8999999999999


Q ss_pred             EEEccC-CcccccCCcccCCCCCCcEEEccCccccccCchhhcCCCCCCEEEccCCcccCCCCccccCCCCCcEEecccC
Q 045729          101 SLDVAH-NNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYN  179 (218)
Q Consensus       101 ~L~l~~-n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~l~~l~~L~~L~L~~N  179 (218)
                      +|++++ |.+.+.+|..+.++++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..+..+++|++|++++|
T Consensus        80 ~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N  159 (313)
T 1ogq_A           80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             eeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCC
Confidence            999995 9999899999999999999999999999899999999999999999999999889999999999999999999


Q ss_pred             cccccCCccCCCCC-CCCEEEccCCcCcccCCC-CCC
Q 045729          180 VIDGNIPSRIGNFS-SPFILNLGYNNLQGLLTI-FGR  214 (218)
Q Consensus       180 ~l~~~~p~~~~~l~-~L~~L~L~~N~l~~~~p~-~~~  214 (218)
                      .+++.+|..++.++ +|++|++++|.+++.+|. ++.
T Consensus       160 ~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~  196 (313)
T 1ogq_A          160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN  196 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG
T ss_pred             cccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhC
Confidence            99989999999888 899999999998876664 444



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_ 284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 68.2 bits (165), Expect = 3e-14
 Identities = 51/179 (28%), Positives = 82/179 (45%), Gaps = 7/179 (3%)

Query: 32  DQSALLAFKARVVDYRSVLTNNWSISYP-ICTWIGISC--GSRHQRVTALNLSDIGLGG- 87
           D+ ALL  K  +    + L++    +     TW+G+ C   ++  RV  L+LS + L   
Sbjct: 7   DKQALLQIKKDL-GNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKP 65

Query: 88  -TIPPHLGNLTFLVSLDVAHN-NFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLS 145
             IP  L NL +L  L +    N  G +P  + +L +L ++      +SG+IP ++  + 
Sbjct: 66  YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK 125

Query: 146 KLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNVIDGNIPSRIGNFSSPFILNLGYNN 204
            L TL    N+ +G +P S+ +L  L       N I G IP   G+FS  F       N
Sbjct: 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN 184


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.57
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.19
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.12
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.1
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.01
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.89
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.63
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.6
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.9
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=3.1e-31  Score=211.19  Aligned_cols=186  Identities=31%  Similarity=0.545  Sum_probs=168.0

Q ss_pred             CChHHHHHHHHHHHhccCCCCccCCCCCCCCCCC--ccceeeeCCC--CCcEEEEEcCCCCCcc--cCCcCCCCCCCCCE
Q 045729           28 NLTADQSALLAFKARVVDYRSVLTNNWSISYPIC--TWIGISCGSR--HQRVTALNLSDIGLGG--TIPPHLGNLTFLVS  101 (218)
Q Consensus        28 ~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c--~w~gv~c~~~--~~~l~~l~l~~~~l~~--~~~~~l~~l~~L~~  101 (218)
                      |.++|+.||++||+++.++. .+.+ |..+++||  .|.||+|+..  ..+|+.|+++++++.|  .+|+.+.++++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~s-W~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSS-WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTT-CCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCC-CCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            67899999999999998764 5777 98888999  4999999863  3489999999999987  58899999999999


Q ss_pred             EEccC-CcccccCCcccCCCCCCcEEEccCccccccCchhhcCCCCCCEEEccCCcccCCCCccccCCCCCcEEecccCc
Q 045729          102 LDVAH-NNFRGHLPNELGQLRRLRFIRFGFNKLSGSIPTWIGVLSKLQTLRLYNNSFTGPIPNSLFNLSKLEVFNAMYNV  180 (218)
Q Consensus       102 L~l~~-n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~l~~l~~L~~L~L~~N~  180 (218)
                      |++++ |++.|.+|..+.++++|++|++++|++.+..+..+..+..|+++++++|.+.+.+|..+.+++.++.+++++|.
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~  160 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR  160 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccc
Confidence            99986 89999999999999999999999999998888889999999999999999998999999999999999999999


Q ss_pred             ccccCCccCCCCCCC-CEEEccCCcCcccCCC-CCCC
Q 045729          181 IDGNIPSRIGNFSSP-FILNLGYNNLQGLLTI-FGRL  215 (218)
Q Consensus       181 l~~~~p~~~~~l~~L-~~L~L~~N~l~~~~p~-~~~l  215 (218)
                      +.+.+|..++.+..+ +.+++++|++++.+|. ++.+
T Consensus       161 l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l  197 (313)
T d1ogqa_         161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL  197 (313)
T ss_dssp             CEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC
T ss_pred             ccccccccccccccccccccccccccccccccccccc
Confidence            999999999888775 8999999999988775 5444



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure