Citrus Sinensis ID: 045778

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRAIVQHSRSVTESEVVEYDSKW
cccHHHHHccccccccccccccccccccEEEEEEEcccccccccccEEEEEcccEEEEEcccccccccccccEEEcccEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccccc
cHHHHHHHHcccccccccccEEEccccccccHHHHccccEcccEEEEEEEcccEEEEEEcccccEcccccccEEEcccEEEEEccccccEEEEEEcccHHHHHHHHHHHHHHHHHccccccccccccccccc
menvwrassgqdpnpvdykgiefwsqpgeigpankarrlhqnlapplvhlkqgehlwfkdshnitrgstprgfipvgtcltvkcaedgeytmysvadtekekgERINSIGRAIVQHSRSVTESEVVEYDSKW
menvwrassgqdpnpvDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITrgstprgfipvGTCLTVKCAEDGEYTMYSVadtekekgeRINSIGraivqhsrsvtesevveydskw
MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRAIVQHSRSVTESEVVEYDSKW
*****************YKGIEFWS*************LHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVA************************************
*************************QPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSH*****STPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRA********************
***********DPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRAIVQ*****************
*******SSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRAIVQH******S***E*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEYTMYSVADTEKEKGERINSIGRAIVQHSRSVTESEVVEYDSKW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q9ST43145 Pleckstrin homology domai yes no 0.992 0.903 0.527 6e-33
>sp|Q9ST43|PH1_ARATH Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana GN=PH1 PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 92/144 (63%), Gaps = 13/144 (9%)

Query: 1   MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKD 60
           ME++WR ++GQDP+  DY+GIEFWS P   G   K     +        LK+G+ LWFKD
Sbjct: 1   MESIWRIATGQDPSREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKD 60

Query: 61  SHNI-TRGSTPRGFIPVGTCLTVKCAED------------GEYTMYSVADTEKEKGERIN 107
                 RGSTPRG I VG CLTVK AED            G YTM+ +AD EKEK E IN
Sbjct: 61  QAAAGIRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSSGSYTMFFIADNEKEKEEWIN 120

Query: 108 SIGRAIVQHSRSVTESEVVEYDSK 131
           SIGR+IVQHSRSVT+SEV++YD +
Sbjct: 121 SIGRSIVQHSRSVTDSEVLDYDHR 144
Binds specifically to phosphatidylinositol 3-phosphate (PtdIns3P), but not to other phosphoinositides.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
449450806149 PREDICTED: pleckstrin homology domain-co 0.984 0.872 0.534 5e-33
297822693145 hypothetical protein ARALYDRAFT_481886 [ 0.992 0.903 0.541 3e-32
224106281143 predicted protein [Populus trichocarpa] 0.977 0.902 0.542 6e-32
225434632143 PREDICTED: pleckstrin homology domain-co 0.984 0.909 0.531 1e-31
255569315144 plekhh protein, putative [Ricinus commun 0.977 0.895 0.542 3e-31
18402122145 Pleckstrin homology domain-containing pr 0.992 0.903 0.527 4e-31
224059304144 predicted protein [Populus trichocarpa] 0.977 0.895 0.535 5e-31
5926716145 AtPH1 [Arabidopsis thaliana] 0.992 0.903 0.527 7e-31
356501146148 PREDICTED: pleckstrin homology domain-co 0.977 0.871 0.5 1e-29
351723457146 uncharacterized protein LOC100527890 [Gl 0.977 0.883 0.492 2e-29
>gi|449450806|ref|XP_004143153.1| PREDICTED: pleckstrin homology domain-containing protein 1-like isoform 1 [Cucumis sativus] gi|449530337|ref|XP_004172152.1| PREDICTED: pleckstrin homology domain-containing protein 1-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 14/144 (9%)

Query: 1   MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKD 60
           ME++WRA++GQDP+P DYKG+EFW+ P   G  NK     +        LK+G+  WFKD
Sbjct: 6   MESLWRAATGQDPSPEDYKGVEFWTSPERAGWLNKQGEYLRTWRRRWFVLKRGKLFWFKD 65

Query: 61  SHNITRGSTPRGFIPVGTCLTVKCAED-------------GEYTMYSVADTEKEKGERIN 107
           S  +TR S PRG IPV TCLTVK AED             G+ TMY +A++E+EK E IN
Sbjct: 66  SI-VTRASIPRGVIPVNTCLTVKGAEDILHKPCAFELSTTGQDTMYFIAESEREKEEWIN 124

Query: 108 SIGRAIVQHSRSVTESEVVEYDSK 131
           SIGR+IVQ+SRSVTESEVV+YD++
Sbjct: 125 SIGRSIVQNSRSVTESEVVDYDNR 148

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297822693|ref|XP_002879229.1| hypothetical protein ARALYDRAFT_481886 [Arabidopsis lyrata subsp. lyrata] gi|297325068|gb|EFH55488.1| hypothetical protein ARALYDRAFT_481886 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224106281|ref|XP_002314112.1| predicted protein [Populus trichocarpa] gi|222850520|gb|EEE88067.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434632|ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569315|ref|XP_002525625.1| plekhh protein, putative [Ricinus communis] gi|223535061|gb|EEF36743.1| plekhh protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18402122|ref|NP_565687.1| Pleckstrin homology domain-containing protein 1 [Arabidopsis thaliana] gi|54036216|sp|Q9ST43.2|PH1_ARATH RecName: Full=Pleckstrin homology domain-containing protein 1; Short=AtPH1 gi|3582339|gb|AAC35236.1| expressed protein [Arabidopsis thaliana] gi|15215632|gb|AAK91361.1| At2g29700/T27A16.20 [Arabidopsis thaliana] gi|20334886|gb|AAM16199.1| At2g29700/T27A16.20 [Arabidopsis thaliana] gi|21537127|gb|AAM61468.1| AtPH1 [Arabidopsis thaliana] gi|330253201|gb|AEC08295.1| Pleckstrin homology domain-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224059304|ref|XP_002299816.1| predicted protein [Populus trichocarpa] gi|118483582|gb|ABK93688.1| unknown [Populus trichocarpa] gi|222847074|gb|EEE84621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|5926716|dbj|BAA84651.1| AtPH1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356501146|ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|351723457|ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:2060625145 PH1 "pleckstrin homologue 1" [ 0.992 0.903 0.527 6.9e-31
TAIR|locus:2166349144 AT5G05710 [Arabidopsis thalian 0.984 0.902 0.486 9.4e-27
TAIR|locus:2060625 PH1 "pleckstrin homologue 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
 Identities = 76/144 (52%), Positives = 92/144 (63%)

Query:     1 MENVWRASSGQDPNPVDYKGIEFWSQPGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKD 60
             ME++WR ++GQDP+  DY+GIEFWS P   G   K     +        LK+G+ LWFKD
Sbjct:     1 MESIWRIATGQDPSREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKD 60

Query:    61 SHNI-TRGSTPRGFIPVGTCLTVKCAED------------GEYTMYSVADTEKEKGERIN 107
                   RGSTPRG I VG CLTVK AED            G YTM+ +AD EKEK E IN
Sbjct:    61 QAAAGIRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSSGSYTMFFIADNEKEKEEWIN 120

Query:   108 SIGRAIVQHSRSVTESEVVEYDSK 131
             SIGR+IVQHSRSVT+SEV++YD +
Sbjct:   121 SIGRSIVQHSRSVTDSEVLDYDHR 144
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0007165 "signal transduction" evidence=ISS
GO:0035091 "phosphatidylinositol binding" evidence=ISS
TAIR|locus:2166349 AT5G05710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ST43PH1_ARATHNo assigned EC number0.52770.99240.9034yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.4__946__AT2G29700.1
annotation not avaliable (145 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 5e-18
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information 
 Score = 73.5 bits (181), Expect = 5e-18
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 16/91 (17%)

Query: 50  LKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDG------------EYTMYSVAD 97
           LKQG+  +FKD       S PRG I +  CLTVK AE+             E T Y +AD
Sbjct: 30  LKQGKLFYFKDE---DPDSEPRGVIDLSDCLTVKSAEEATNKEFAFEVSTPERTFYLIAD 86

Query: 98  TEKEKGERINSIGRAIVQHSRS-VTESEVVE 127
           +EKEK E I++IGRAIV+ SRS  T  EV++
Sbjct: 87  SEKEKEEWISAIGRAIVKLSRSKGTIDEVLD 117

AtPH1 is expressed in all plant tissue and is proposed to be the plant homolog of human pleckstrin. Pleckstrin consists of two PH domains separated by a linker region, while AtPH has a single PH domain with a short N-terminal extension. AtPH1 binds PtdIns3P specifically and is thought to be an adaptor molecule since it has no obvious catalytic functions. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 117

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.91
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.91
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.9
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.89
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.89
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.88
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.87
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.87
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.87
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.87
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.85
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.84
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.8
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.8
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.79
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.76
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.76
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.75
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.73
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.68
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.63
PF1540989 PH_8: Pleckstrin homology domain 99.61
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.57
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.56
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.53
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.52
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.45
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.38
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.37
KOG10901732 consensus Predicted dual-specificity phosphatase [ 99.33
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.33
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 99.31
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.28
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 99.19
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 99.15
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 98.93
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.92
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 98.86
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.85
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.82
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.8
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.74
KOG3723851 consensus PH domain protein Melted [Signal transdu 98.66
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 98.53
PTZ00267478 NIMA-related protein kinase; Provisional 98.44
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.41
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.39
KOG1739 611 consensus Serine/threonine protein kinase GPBP [Si 98.35
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.32
KOG0521 785 consensus Putative GTPase activating proteins (GAP 98.3
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 98.17
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 98.14
KOG3751 622 consensus Growth factor receptor-bound proteins (G 98.13
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 98.12
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.06
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 98.04
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.92
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 97.58
PF15406112 PH_6: Pleckstrin homology domain 97.52
PTZ00283496 serine/threonine protein kinase; Provisional 97.44
KOG1737 799 consensus Oxysterol-binding protein [Lipid transpo 97.39
PLN02866 1068 phospholipase D 97.39
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.35
PF15404185 PH_4: Pleckstrin homology domain 97.27
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.26
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.2
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.08
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 97.05
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 97.05
KOG35311036 consensus Rho guanine nucleotide exchange factor C 96.8
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 96.75
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 96.74
KOG0932 774 consensus Guanine nucleotide exchange factor EFA6 96.7
KOG4424 623 consensus Predicted Rho/Rac guanine nucleotide exc 96.66
PF15408104 PH_7: Pleckstrin homology domain 96.44
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 95.92
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 95.8
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 95.46
KOG1738638 consensus Membrane-associated guanylate kinase-int 95.09
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 94.64
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 94.47
KOG4807 593 consensus F-actin binding protein, regulates actin 93.52
KOG3551506 consensus Syntrophins (type beta) [Extracellular s 93.42
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 92.65
KOG4047 429 consensus Docking protein 1 (p62dok) [Signal trans 92.06
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 90.49
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 90.34
KOG3727 664 consensus Mitogen inducible gene product (contains 90.04
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 88.25
KOG3523695 consensus Putative guanine nucleotide exchange fac 87.55
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 86.5
KOG1170 1099 consensus Diacylglycerol kinase [Lipid transport a 86.36
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 85.66
cd05394313 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the 84.69
cd05134310 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of 84.64
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 84.58
cd05128315 RasGAP_GAP1_like The GAP1 family of Ras GTPase-act 83.96
KOG1264 1267 consensus Phospholipase C [Lipid transport and met 83.1
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 80.25
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information 
Probab=99.91  E-value=2.2e-25  Score=151.87  Aligned_cols=83  Identities=17%  Similarity=0.259  Sum_probs=69.8

Q ss_pred             CCCcchhHhHh-hhhcCCCeeeccccceeeeecccccccCCCCCcceeecceE---EEEe----c--cC---------Cc
Q 045778           29 EIGPANKARRL-HQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCL---TVKC----A--ED---------GE   89 (132)
Q Consensus        29 ~~GwL~Kqg~~-~k~WkrRwFvL~~~~L~yyk~~~~~~~~~~~~g~I~L~~~~---~v~~----~--~~---------~~   89 (132)
                      ++|||.|+|+. .++||+|||||+++.|+||+++.    +..|.|.|+|+.+.   .|..    .  .+         +.
T Consensus         1 KeG~L~K~g~~~~k~wkkRwFvL~~~~L~Yyk~~~----d~~~~G~I~L~~~~~~~~v~~~~~~~~~~~~~~~F~i~t~~   76 (103)
T cd01251           1 KEGFMEKTGPKHTEGFKKRWFTLDDRRLMYFKDPL----DAFAKGEVFLGSQEDGYEVREGLPPGTQGNHWYGVTLVTPE   76 (103)
T ss_pred             CceeEEecCCCCCCCceeEEEEEeCCEEEEECCCC----CcCcCcEEEeeccccceeEeccCCccccccccceEEEEeCC
Confidence            58999999986 69999999999999999999985    46899999998643   1211    0  00         78


Q ss_pred             eeEEEeccchhhhccchhhhhhhhhh
Q 045778           90 YTMYSVADTEKEKGERINSIGRAIVQ  115 (132)
Q Consensus        90 r~~~f~A~s~~e~~~Wi~aI~~~i~~  115 (132)
                      |+|+|+|+|++|+++||+||+.++..
T Consensus        77 Rty~l~a~s~~e~~~Wi~ai~~v~~~  102 (103)
T cd01251          77 RKFLFACETEQDRREWIAAFQNVLSR  102 (103)
T ss_pred             eEEEEECCCHHHHHHHHHHHHHHhcC
Confidence            99999999999999999999998864

Centaurin alpha Pleckstrin homology (PH) domain. Centaurin alpha is a phophatidlyinositide binding protein consisting of an N-terminal ArfGAP domain and two PH domains. In response to growth factor activation, PI3K phosphorylates phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 1 is recruited to the plasma membrane following growth factor stimulation by specific binding of its PH domain to phosphatidylinositol 3,4,5-trisphosphate. Centaurin alpha 2 is constitutively bound to the plasma membrane since it binds phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate with equal affinity. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specifici
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4047 consensus Docking protein 1 (p62dok) [Signal transduction mechanisms] Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3727 consensus Mitogen inducible gene product (contains ERM and PH domains) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG3523 consensus Putative guanine nucleotide exchange factor TIM [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1170 consensus Diacylglycerol kinase [Lipid transport and metabolism] Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL Back     alignment and domain information
>cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4) Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 4e-06
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 5e-04
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 6e-04
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 8e-04
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
 Score = 42.4 bits (100), Expect = 4e-06
 Identities = 18/86 (20%), Positives = 28/86 (32%), Gaps = 15/86 (17%)

Query: 50  LKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDGEY-----------TMYSVADT 98
           L + E  +FKD         P   + +  C  V+     E            T Y  A T
Sbjct: 41  LHRNELKYFKDQM----SPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKT 96

Query: 99  EKEKGERINSIGRAIVQHSRSVTESE 124
             E  E I  +   + Q  + + + E
Sbjct: 97  GVEADEWIKILRWKLSQIRKQLNQGE 122
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
1wi1_A126 Calcium-dependent activator protein for secretion, 99.91
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.91
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.89
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.89
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.89
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.89
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.89
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.89
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.89
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.89
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.89
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.89
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.88
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.88
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.88
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.88
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.87
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.87
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.87
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.87
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.87
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.87
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.86
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.86
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.86
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.86
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.85
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.85
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.85
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.85
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.85
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.85
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.85
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.85
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.84
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.84
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.84
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.84
2yry_A122 Pleckstrin homology domain-containing family A mem 99.84
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.84
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.83
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.81
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.81
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.81
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.8
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.8
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.8
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.79
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.78
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.78
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.78
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.76
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.75
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.74
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.74
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.74
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.72
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.72
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.72
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.69
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.68
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.61
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.59
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.5
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.46
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.46
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.43
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.4
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.35
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 99.04
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.91
3tfm_A 228 Myosin X; split PH domain, motor protein; 2.53A {R 98.62
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 98.29
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.96
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.7
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.56
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.5
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.44
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.35
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 97.3
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.26
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 97.26
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.26
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.25
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.19
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.13
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 97.04
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 96.99
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 96.96
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 96.93
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 96.88
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 96.86
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.31
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 96.01
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 95.97
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.73
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 95.44
1foe_A377 T-lymphoma invasion and metastasis inducing protei 92.36
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 90.2
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 88.97
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 87.49
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 86.23
3a58_A320 Exocyst complex component SEC3; protein complex, P 81.27
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
Probab=99.91  E-value=3.1e-26  Score=160.18  Aligned_cols=90  Identities=14%  Similarity=0.114  Sum_probs=74.7

Q ss_pred             cCCCCCCcchhHhH-hhhhcCCCeeeccccceeeee----cccccccCCCCCcceeecceEEEE---eccC---------
Q 045778           25 SQPGEIGPANKARR-LHQNLAPPLVHLKQGEHLWFK----DSHNITRGSTPRGFIPVGTCLTVK---CAED---------   87 (132)
Q Consensus        25 ~~~~~~GwL~Kqg~-~~k~WkrRwFvL~~~~L~yyk----~~~~~~~~~~~~g~I~L~~~~~v~---~~~~---------   87 (132)
                      .++.++|||.|||+ .+|+||||||||+++.||||+    ++.    +..|.|.|+|.+|. |+   +.++         
T Consensus         6 ~n~~~~G~L~KqG~~~~K~WKrRwFVL~~~~LyYfk~~~~~~~----~~~p~G~I~L~g~t-V~~~~~~~~~~~~k~~F~   80 (126)
T 1wi1_A            6 SGMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREK----KAEPQELLQLDGYT-VDYTDPQPGLEGGRAFFN   80 (126)
T ss_dssp             CCEEEEEEEEEECSSSCCSCEEEEEEEEEEETTEEEEEECCSS----SSCCSEEEECSSCE-EEECCCCSSCCSCSSEEE
T ss_pred             CCCceeEEEEEeCCCcccccceEEEEEeCCEEEEEEccccccc----CCCCceEEECCCcE-EEEecCCcccccCceEEE
Confidence            35678999999987 679999999999999999999    763    47899999999975 33   1121         


Q ss_pred             ---CceeEEEeccchhhhccchhhhhhhhhhhccc
Q 045778           88 ---GEYTMYSVADTEKEKGERINSIGRAIVQHSRS  119 (132)
Q Consensus        88 ---~~r~~~f~A~s~~e~~~Wi~aI~~~i~~~~~~  119 (132)
                         +.++|+|+|+|++||+.||+||+.++.+...+
T Consensus        81 ~v~~~~ty~~~Adseee~~~WikAi~~A~~~~~~~  115 (126)
T 1wi1_A           81 AVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKP  115 (126)
T ss_dssp             EECSSCEEEEECSSHHHHHHHHHHHHHHHTCSSCC
T ss_pred             EecCCceEEEEcCCHHHHHHHHHHHHHHhccccCC
Confidence               56689999999999999999999998765444
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.9
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.89
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.86
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.86
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.86
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.86
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.86
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.85
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.85
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.83
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.83
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.83
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.83
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.83
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.81
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.81
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.81
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.81
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.81
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.81
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.81
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.8
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.79
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.76
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.72
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.71
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.67
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.21
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.84
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.84
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.41
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.31
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.25
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.91
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.79
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.53
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 97.37
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.31
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 95.3
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 91.87
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=1.6e-25  Score=147.47  Aligned_cols=85  Identities=22%  Similarity=0.249  Sum_probs=74.9

Q ss_pred             CCCCCcchhHhHhhhhcCCCeeeccccceeeeecccccccCCCCCcceeecceEEEEeccC-----------CceeEEEe
Q 045778           27 PGEIGPANKARRLHQNLAPPLVHLKQGEHLWFKDSHNITRGSTPRGFIPVGTCLTVKCAED-----------GEYTMYSV   95 (132)
Q Consensus        27 ~~~~GwL~Kqg~~~k~WkrRwFvL~~~~L~yyk~~~~~~~~~~~~g~I~L~~~~~v~~~~~-----------~~r~~~f~   95 (132)
                      +.++|||.|+|+..++|++|||||+++.|+||+++.    +..|.|.|+|.+|..+....+           +.++|+|+
T Consensus         4 ~~KeG~L~K~~~~~k~Wk~R~fvL~~~~L~yy~~~~----~~~~~g~i~L~~~~~v~~~~~~~~~~~F~i~~~~r~~~l~   79 (100)
T d1faoa_           4 GTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQM----SPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC   79 (100)
T ss_dssp             TCEEEEEEEECSSSCCEEEEEEEEETTEEEEESSTT----CSSCSEEEEGGGCCEEEEECSSSSSSEEEEEETTEEEEEE
T ss_pred             ccEEEEEEEeCCCCCCceEEEEEEECCEEEEEeccC----CccCceEEechheEEEEeccccccccccccccCCeEEEEE
Confidence            467999999999899999999999999999999884    468999999999876543322           78999999


Q ss_pred             ccchhhhccchhhhhhhhhh
Q 045778           96 ADTEKEKGERINSIGRAIVQ  115 (132)
Q Consensus        96 A~s~~e~~~Wi~aI~~~i~~  115 (132)
                      |+|++++++||+||+.+|.+
T Consensus        80 a~s~~~~~~Wi~ai~~~i~~   99 (100)
T d1faoa_          80 AKTGVEADEWIKILRWKLSQ   99 (100)
T ss_dssp             CSSHHHHHHHHHHHHHHHHT
T ss_pred             eCCHHHHHHHHHHHHHHHhh
Confidence            99999999999999999875
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure