Citrus Sinensis ID: 045789
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| 297742964 | 546 | unnamed protein product [Vitis vinifera] | 0.650 | 0.245 | 0.743 | 1e-56 | |
| 359482462 | 600 | PREDICTED: 3-oxoacyl-[acyl-carrier-prote | 0.650 | 0.223 | 0.743 | 1e-56 | |
| 147769102 | 664 | hypothetical protein VITISV_027246 [Viti | 0.655 | 0.203 | 0.737 | 2e-56 | |
| 357479365 | 491 | 3-oxoacyl-ACP synthase [Medicago truncat | 0.665 | 0.279 | 0.700 | 2e-55 | |
| 217074824 | 491 | unknown [Medicago truncatula] | 0.665 | 0.279 | 0.700 | 2e-55 | |
| 30795125 | 573 | beta-ketoacyl-ACP synthase II [Elaeis gu | 0.650 | 0.233 | 0.722 | 1e-54 | |
| 1698690 | 540 | beta-ketoacyl-ACP synthase II [Cuphea wr | 0.650 | 0.248 | 0.708 | 5e-54 | |
| 294666 | 535 | chloroplast beta-ketoacyl-ACP synthase p | 0.665 | 0.256 | 0.693 | 8e-54 | |
| 255550355 | 554 | 46 kDa ketoavyl-ACP synthase [Ricinus co | 0.665 | 0.247 | 0.693 | 8e-54 | |
| 1698688 | 517 | beta-ketoacyl-ACP synthase II [Cuphea wr | 0.820 | 0.326 | 0.595 | 8e-54 |
| >gi|297742964|emb|CBI35831.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 225 bits (573), Expect = 1e-56, Method: Compositional matrix adjust.
Identities = 107/144 (74%), Positives = 122/144 (84%), Gaps = 10/144 (6%)
Query: 1 MGEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKS 60
MGEGAGVLLLEELEHAK+RG NIYAE L GS TCDAYH+T PHPEG G+V C+EKALA++
Sbjct: 365 MGEGAGVLLLEELEHAKRRGANIYAEFLGGSFTCDAYHMTEPHPEGTGVVLCIEKALAQA 424
Query: 61 GVAKEDVNYINAHAPSTRLGDLREYQA----------LRMNSTKSLIGHLLGASGAAEAV 110
GVA+EDVNYINAHA ST GDL+E+QA LR+NSTKS+IGHLLGASGA EAV
Sbjct: 425 GVAREDVNYINAHATSTPSGDLKEFQALIRCFGQNPKLRVNSTKSMIGHLLGASGAVEAV 484
Query: 111 ATIKAIQTGWIHPNLNLENPDKHV 134
AT+KAIQTGW+HPN+NLENPD+ V
Sbjct: 485 ATVKAIQTGWVHPNINLENPDQGV 508
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359482462|ref|XP_002272201.2| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147769102|emb|CAN69528.1| hypothetical protein VITISV_027246 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357479365|ref|XP_003609968.1| 3-oxoacyl-ACP synthase [Medicago truncatula] gi|355511023|gb|AES92165.1| 3-oxoacyl-ACP synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074824|gb|ACJ85772.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|30795125|gb|AAF26738.2|AF220453_1 beta-ketoacyl-ACP synthase II [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|1698690|gb|AAB37271.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii] | Back alignment and taxonomy information |
|---|
| >gi|294666|gb|AAA33872.1| chloroplast beta-ketoacyl-ACP synthase precursor [Ricinus communis] gi|148645269|gb|ABR01158.1| plastid 3-keto-acyl-ACP synthase II [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255550355|ref|XP_002516228.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis] gi|223544714|gb|EEF46230.1| 46 kDa ketoavyl-ACP synthase [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|1698688|gb|AAB37270.1| beta-ketoacyl-ACP synthase II [Cuphea wrightii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 206 | ||||||
| TAIR|locus:2027252 | 541 | FAB1 "fatty acid biosynthesis | 0.582 | 0.221 | 0.638 | 3.5e-43 | |
| CGD|CAL0003432 | 441 | CEM1 [Candida albicans (taxid: | 0.776 | 0.362 | 0.410 | 5.8e-25 | |
| TIGR_CMR|ECH_0882 | 422 | ECH_0882 "3-oxoacyl-(acyl-carr | 0.548 | 0.267 | 0.491 | 6.6e-25 | |
| TIGR_CMR|APH_0930 | 423 | APH_0930 "3-oxoacyl-(acyl-carr | 0.558 | 0.271 | 0.476 | 2e-24 | |
| TIGR_CMR|GSU_1605 | 410 | GSU_1605 "3-oxoacyl-(acyl-carr | 0.563 | 0.282 | 0.488 | 2.6e-24 | |
| TIGR_CMR|CBU_0497 | 414 | CBU_0497 "3-oxoacyl-acyl carri | 0.572 | 0.285 | 0.449 | 3.7e-24 | |
| TIGR_CMR|NSE_0453 | 415 | NSE_0453 "3-oxoacyl-(acyl-carr | 0.728 | 0.361 | 0.383 | 2e-23 | |
| UNIPROTKB|E1BYY7 | 461 | OXSM "3-oxoacyl-[acyl-carrier- | 0.567 | 0.253 | 0.476 | 5.1e-23 | |
| UNIPROTKB|Q81JF9 | 412 | fabF "3-oxoacyl-[acyl-carrier- | 0.567 | 0.283 | 0.468 | 7.3e-23 | |
| TIGR_CMR|BA_1185 | 412 | BA_1185 "3-oxoacyl-(acyl-carri | 0.567 | 0.283 | 0.468 | 7.3e-23 |
| TAIR|locus:2027252 FAB1 "fatty acid biosynthesis 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 456 (165.6 bits), Expect = 3.5e-43, P = 3.5e-43
Identities = 83/130 (63%), Positives = 104/130 (80%)
Query: 15 HAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKSGVAKEDVNYINAHA 74
HAKKRG IYAE L GS TCDAYH+T PHP+G G++ C+E+ALA +G++KE +NYINAHA
Sbjct: 374 HAKKRGATIYAEFLGGSFTCDAYHMTEPHPDGAGVILCIERALASAGISKEQINYINAHA 433
Query: 75 PSTRLGDLREYQAL----------RMNSTKSLIGHLLGASGAAEAVATIKAIQTGWIHPN 124
ST GD++EYQAL ++NSTKS+IGHLLGA+GA EAVAT++AI+TGW+HPN
Sbjct: 434 TSTHAGDIKEYQALAHCFGQNPELKVNSTKSMIGHLLGAAGAVEAVATVQAIRTGWVHPN 493
Query: 125 LNLENPDKHV 134
+NLENPD V
Sbjct: 494 INLENPDSGV 503
|
|
| CGD|CAL0003432 CEM1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0882 ECH_0882 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|APH_0930 APH_0930 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1605 GSU_1605 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0497 CBU_0497 "3-oxoacyl-acyl carrier protein synthase II" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0453 NSE_0453 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYY7 OXSM "3-oxoacyl-[acyl-carrier-protein] synthase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81JF9 fabF "3-oxoacyl-[acyl-carrier-protein] synthase 2" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_1185 BA_1185 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034037001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (502 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00024012001 | • | • | • | • | • | • | 0.991 | ||||
| GSVIVG00007299001 | • | • | • | • | • | 0.990 | |||||
| GSVIVG00024709001 | • | • | • | 0.919 | |||||||
| GSVIVG00017895001 | • | • | 0.910 | ||||||||
| GSVIVG00035074001 | • | • | 0.910 | ||||||||
| GSVIVG00025373001 | • | • | 0.909 | ||||||||
| GSVIVG00016807001 | • | • | 0.904 | ||||||||
| GSVIVG00017969001 | • | • | 0.900 | ||||||||
| GSVIVG00034687001 | • | 0.899 | |||||||||
| GSVIVG00034686001 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| PLN02787 | 540 | PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protei | 1e-76 | |
| cd00834 | 406 | cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot | 9e-69 | |
| TIGR03150 | 407 | TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protei | 9e-67 | |
| PRK07314 | 411 | PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protei | 3e-63 | |
| COG0304 | 412 | COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy | 2e-59 | |
| PRK06333 | 424 | PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protei | 3e-57 | |
| PTZ00050 | 421 | PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein | 1e-53 | |
| PLN02836 | 437 | PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protei | 2e-46 | |
| PRK09116 | 405 | PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protei | 3e-41 | |
| PRK08439 | 406 | PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protei | 1e-36 | |
| pfam02801 | 119 | pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase | 3e-36 | |
| PRK07910 | 418 | PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protei | 4e-36 | |
| PRK08722 | 414 | PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protei | 3e-34 | |
| PRK07103 | 410 | PRK07103, PRK07103, polyketide beta-ketoacyl:acyl | 4e-34 | |
| PRK07967 | 406 | PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protei | 5e-32 | |
| PRK05952 | 381 | PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protei | 5e-32 | |
| PRK06501 | 425 | PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protei | 8e-31 | |
| PRK14691 | 342 | PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protei | 9e-30 | |
| cd00833 | 421 | cd00833, PKS, polyketide synthases (PKSs) polymeri | 6e-27 | |
| cd00828 | 407 | cd00828, elong_cond_enzymes, "elongating" condensi | 1e-24 | |
| PRK09185 | 392 | PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protei | 7e-24 | |
| cd00825 | 332 | cd00825, decarbox_cond_enzymes, decarboxylating co | 3e-19 | |
| cd00327 | 254 | cd00327, cond_enzymes, Condensing enzymes; Family | 4e-18 | |
| COG3321 | 1061 | COG3321, COG3321, Polyketide synthase modules and | 1e-17 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 7e-11 | |
| smart00825 | 298 | smart00825, PKS_KS, Beta-ketoacyl synthase | 3e-10 | |
| cd00832 | 399 | cd00832, CLF, Chain-length factor (CLF) is a facto | 8e-09 | |
| cd00751 | 386 | cd00751, thiolase, Thiolase are ubiquitous enzymes | 2e-04 | |
| PRK08131 | 401 | PRK08131, PRK08131, acetyl-CoA acetyltransferase; | 0.004 |
| >gnl|CDD|215421 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
Score = 239 bits (611), Expect = 1e-76
Identities = 104/144 (72%), Positives = 122/144 (84%), Gaps = 10/144 (6%)
Query: 1 MGEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKS 60
MGEGAGVLLLEELEHAKKRG NIYAE L GS TCDAYH+T PHPEG G++ C+EKALA+S
Sbjct: 359 MGEGAGVLLLEELEHAKKRGANIYAEFLGGSFTCDAYHMTEPHPEGAGVILCIEKALAQS 418
Query: 61 GVAKEDVNYINAHAPSTRLGDLREYQA----------LRMNSTKSLIGHLLGASGAAEAV 110
GV+KEDVNYINAHA ST+ GDL+EYQA LR+NSTKS+IGHLLGA+GA EA+
Sbjct: 419 GVSKEDVNYINAHATSTKAGDLKEYQALMRCFGQNPELRVNSTKSMIGHLLGAAGAVEAI 478
Query: 111 ATIKAIQTGWIHPNLNLENPDKHV 134
AT++AI+TGW+HPN+NLENP+ V
Sbjct: 479 ATVQAIRTGWVHPNINLENPESGV 502
|
Length = 540 |
| >gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >gnl|CDD|200247 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >gnl|CDD|235987 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235781 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240245 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215449 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >gnl|CDD|181657 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236265 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217236 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236129 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181539 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181184 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235653 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235817 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173154 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >gnl|CDD|236398 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >gnl|CDD|181242 PRK08131, PRK08131, acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| COG3321 | 1061 | Polyketide synthase modules and related proteins [ | 100.0 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 100.0 | |
| PLN02787 | 540 | 3-oxoacyl-[acyl-carrier-protein] synthase II | 100.0 | |
| PRK07910 | 418 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| PRK14691 | 342 | 3-oxoacyl-(acyl carrier protein) synthase II; Prov | 100.0 | |
| PRK08722 | 414 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| PLN02836 | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase | 100.0 | |
| PTZ00050 | 421 | 3-oxoacyl-acyl carrier protein synthase; Provision | 100.0 | |
| PRK06333 | 424 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| KOG1394 | 440 | consensus 3-oxoacyl-(acyl-carrier-protein) synthas | 100.0 | |
| cd00832 | 399 | CLF Chain-length factor (CLF) is a factor required | 100.0 | |
| PRK09116 | 405 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| PRK07314 | 411 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| COG0304 | 412 | FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li | 100.0 | |
| PRK07967 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 100.0 | |
| PRK05952 | 381 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| PRK08439 | 406 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| TIGR03150 | 407 | fabF beta-ketoacyl-acyl-carrier-protein synthase I | 100.0 | |
| cd00828 | 407 | elong_cond_enzymes "elongating" condensing enzymes | 100.0 | |
| PRK06501 | 425 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 100.0 | |
| cd00834 | 406 | KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) | 100.0 | |
| smart00825 | 424 | PKS_KS Beta-ketoacyl synthase. The structure of be | 100.0 | |
| PRK07103 | 410 | polyketide beta-ketoacyl:acyl carrier protein synt | 100.0 | |
| cd00833 | 421 | PKS polyketide synthases (PKSs) polymerize simple | 100.0 | |
| KOG1202 | 2376 | consensus Animal-type fatty acid synthase and rela | 99.98 | |
| PRK09185 | 392 | 3-oxoacyl-(acyl carrier protein) synthase I; Revie | 99.98 | |
| PRK06519 | 398 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 99.96 | |
| PF02801 | 119 | Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina | 99.94 | |
| cd00825 | 332 | decarbox_cond_enzymes decarboxylating condensing e | 99.9 | |
| PRK06147 | 348 | 3-oxoacyl-(acyl carrier protein) synthase; Validat | 99.85 | |
| cd00327 | 254 | cond_enzymes Condensing enzymes; Family of enzymes | 99.78 | |
| cd00751 | 386 | thiolase Thiolase are ubiquitous enzymes that cata | 99.6 | |
| TIGR01930 | 386 | AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi | 99.56 | |
| PRK05656 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.56 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 99.51 | |
| PRK06445 | 394 | acetyl-CoA acetyltransferase; Provisional | 99.47 | |
| PRK06633 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.47 | |
| PLN02644 | 394 | acetyl-CoA C-acetyltransferase | 99.45 | |
| PRK13359 | 400 | beta-ketoadipyl CoA thiolase; Provisional | 99.44 | |
| PRK09052 | 399 | acetyl-CoA acetyltransferase; Provisional | 99.44 | |
| PRK06064 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.43 | |
| PRK09051 | 394 | beta-ketothiolase; Provisional | 99.42 | |
| PRK07661 | 391 | acetyl-CoA acetyltransferase; Provisional | 99.41 | |
| TIGR02430 | 400 | pcaF beta-ketoadipyl CoA thiolase. Members of this | 99.4 | |
| PRK08242 | 402 | acetyl-CoA acetyltransferase; Validated | 99.38 | |
| PRK07108 | 392 | acetyl-CoA acetyltransferase; Provisional | 99.35 | |
| PRK06954 | 397 | acetyl-CoA acetyltransferase; Provisional | 99.34 | |
| PRK07801 | 382 | acetyl-CoA acetyltransferase; Provisional | 99.33 | |
| PRK07851 | 406 | acetyl-CoA acetyltransferase; Provisional | 99.33 | |
| TIGR02445 | 385 | fadA fatty oxidation complex, beta subunit FadA. T | 99.33 | |
| PRK08947 | 387 | fadA 3-ketoacyl-CoA thiolase; Reviewed | 99.32 | |
| PRK06205 | 404 | acetyl-CoA acetyltransferase; Provisional | 99.32 | |
| PRK09050 | 401 | beta-ketoadipyl CoA thiolase; Validated | 99.32 | |
| PLN02287 | 452 | 3-ketoacyl-CoA thiolase | 99.32 | |
| PRK08131 | 401 | acetyl-CoA acetyltransferase; Provisional | 99.3 | |
| PRK08235 | 393 | acetyl-CoA acetyltransferase; Provisional | 99.3 | |
| PRK07516 | 389 | acetyl-CoA acetyltransferase; Provisional | 99.29 | |
| cd00829 | 375 | SCP-x_thiolase Thiolase domain associated with ste | 99.27 | |
| PRK12578 | 385 | acetyl-CoA acetyltransferase; Provisional | 99.26 | |
| PRK06025 | 417 | acetyl-CoA acetyltransferase; Provisional | 99.25 | |
| PRK07850 | 387 | acetyl-CoA acetyltransferase; Provisional | 99.19 | |
| PRK06158 | 384 | thiolase; Provisional | 99.18 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.15 | |
| PRK06504 | 390 | acetyl-CoA acetyltransferase; Provisional | 99.13 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 99.12 | |
| PRK06690 | 361 | acetyl-CoA acetyltransferase; Provisional | 99.12 | |
| PRK08963 | 428 | fadI 3-ketoacyl-CoA thiolase; Reviewed | 99.1 | |
| PRK06289 | 403 | acetyl-CoA acetyltransferase; Provisional | 99.09 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 99.07 | |
| PRK08313 | 386 | acetyl-CoA acetyltransferase; Provisional | 99.06 | |
| KOG1390 | 396 | consensus Acetyl-CoA acetyltransferase [Lipid tran | 99.05 | |
| PTZ00455 | 438 | 3-ketoacyl-CoA thiolase; Provisional | 99.05 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 99.05 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 99.03 | |
| PRK06066 | 385 | acetyl-CoA acetyltransferase; Provisional | 98.98 | |
| PRK06157 | 398 | acetyl-CoA acetyltransferase; Validated | 98.97 | |
| PRK07937 | 352 | lipid-transfer protein; Provisional | 98.97 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 98.96 | |
| PRK09268 | 427 | acetyl-CoA acetyltransferase; Provisional | 98.9 | |
| cd00826 | 393 | nondecarbox_cond_enzymes nondecarboxylating conden | 98.9 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 98.85 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 98.82 | |
| KOG1389 | 435 | consensus 3-oxoacyl CoA thiolase [Lipid transport | 98.8 | |
| PRK08257 | 498 | acetyl-CoA acetyltransferase; Validated | 98.78 | |
| PRK07855 | 386 | lipid-transfer protein; Provisional | 98.74 | |
| PF02803 | 123 | Thiolase_C: Thiolase, C-terminal domain; InterPro: | 98.69 | |
| KOG1391 | 396 | consensus Acetyl-CoA acetyltransferase [Lipid tran | 98.58 | |
| PRK07515 | 372 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 98.12 | |
| KOG1406 | 408 | consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44 | 97.95 | |
| KOG1392 | 465 | consensus Acetyl-CoA acetyltransferase [Lipid tran | 97.75 | |
| PRK07204 | 329 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 97.23 | |
| TIGR00747 | 318 | fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | 97.16 | |
| PRK09352 | 319 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 97.13 | |
| cd00830 | 320 | KAS_III Ketoacyl-acyl carrier protein synthase III | 97.02 | |
| COG0183 | 392 | PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis | 96.96 | |
| PRK09258 | 338 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 96.92 | |
| PRK12879 | 325 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 96.76 | |
| PRK06840 | 339 | hypothetical protein; Validated | 95.7 | |
| PRK06816 | 378 | 3-oxoacyl-(acyl carrier protein) synthase III; Rev | 95.53 | |
| PLN02326 | 379 | 3-oxoacyl-[acyl-carrier-protein] synthase III | 95.49 | |
| PRK04262 | 347 | hypothetical protein; Provisional | 95.41 | |
| COG0332 | 323 | FabH 3-oxoacyl-[acyl-carrier-protein] | 95.12 | |
| CHL00203 | 326 | fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr | 95.06 | |
| TIGR00748 | 345 | HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase | 94.15 | |
| cd00827 | 324 | init_cond_enzymes "initiating" condensing enzymes | 93.9 | |
| PRK05963 | 326 | 3-oxoacyl-(acyl carrier protein) synthase II; Revi | 92.96 | |
| PF08541 | 90 | ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC | 92.39 | |
| cd00831 | 361 | CHS_like Chalcone and stilbene synthases; plant-sp | 92.37 | |
| TIGR01835 | 379 | HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt | 90.37 | |
| COG3425 | 377 | PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi | 88.94 | |
| PLN03173 | 391 | chalcone synthase; Provisional | 87.88 | |
| PLN03170 | 401 | chalcone synthase; Provisional | 87.85 | |
| PLN03169 | 391 | chalcone synthase family protein; Provisional | 86.96 | |
| PRK08256 | 391 | lipid-transfer protein; Provisional | 86.37 | |
| PRK06158 | 384 | thiolase; Provisional | 86.35 | |
| PRK05790 | 393 | putative acyltransferase; Provisional | 86.14 | |
| PRK06365 | 430 | acetyl-CoA acetyltransferase; Provisional | 85.3 | |
| PLN03172 | 393 | chalcone synthase family protein; Provisional | 85.26 | |
| PRK06065 | 392 | acetyl-CoA acetyltransferase; Provisional | 84.94 | |
| COG3424 | 356 | BcsA Predicted naringenin-chalcone synthase [Secon | 84.11 | |
| PRK06366 | 388 | acetyl-CoA acetyltransferase; Provisional | 84.05 | |
| PRK08142 | 388 | acetyl-CoA acetyltransferase; Provisional | 83.89 | |
| PRK06059 | 399 | lipid-transfer protein; Provisional | 83.69 | |
| TIGR02446 | 430 | FadI fatty oxidation complex, beta subunit FadI. T | 83.51 | |
| PRK08170 | 426 | acetyl-CoA acetyltransferase; Provisional | 82.48 | |
| PLN03171 | 399 | chalcone synthase-like protein; Provisional | 82.37 |
| >COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-43 Score=339.39 Aligned_cols=202 Identities=28% Similarity=0.377 Sum_probs=180.9
Q ss_pred CceEEEEEEccchHHHhcCCceeEEEEEEEecCCCCCCCCCCCChHHHHHHHHHHHHHcCCCccccccccccCCCCCcCC
Q 045789 2 GEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKSGVAKEDVNYINAHAPSTRLGD 81 (206)
Q Consensus 2 gEGa~alvL~~~~~A~~~g~~i~a~I~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~Agi~~~dI~~ve~hgtgt~~~D 81 (206)
|||++++|||++++|.++|++||++|+|.++|+||.+.+.+.|++.+|.+++++||+++||+|++|+|||+|||||++||
T Consensus 238 geG~g~vvLKrl~~A~~dgd~IyavI~gsavn~dG~~~gltaP~~~aQ~~v~~~al~~a~i~p~tv~yvEaHgTGT~lGD 317 (1061)
T COG3321 238 GEGAGVVVLKRLSDAERDGDRIYAVIRGSAVNQDGRSNGLTAPNLEAQADVIREALADAGIDPATVQYVEAHGTGTPLGD 317 (1061)
T ss_pred eeeEEEEEEEEhHHHHhCCCeEEEEEEeeeeccCCCcCCCCCCCHHHHHHHHHHHHHhcCCCcccCcEEEecCCCCCCcC
Confidence 79999999999999999999999999999999999877999999999999999999999999999999999999999999
Q ss_pred Hhhhhc-------------ceeccccccccccccccchHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCCcccccccc
Q 045789 82 LREYQA-------------LRMNSTKSLIGHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHVLSRTSGASAAFISI 148 (206)
Q Consensus 82 ~~E~~a-------------~~v~s~k~~~Gh~~~asG~~~l~~~~l~l~~~~ipp~~~~~~~~~~~~~~~~~~~~~~~~~ 148 (206)
++|..+ |.+||+|+||||++.|+|+++++|++|+|+++++||++|+++|||.+++..++|+++++.+
T Consensus 318 piE~~aL~~v~~~~~~~~~c~iGSvKsNiGH~~~AaGiagliK~~Lal~~~~ip~~l~~~~~np~i~~~~sp~~v~~~~~ 397 (1061)
T COG3321 318 PIEANALGAVYGEGAPAQPCAIGSVKSNIGHLEAAAGIAGLIKTALALKHGYIPPTLHFDTPNPEIDFDSSPFVVPTEAT 397 (1061)
T ss_pred HHHHHHHHHHhccCCCCCcccccccccccccHHHHHHHHHHHHHHHhhhcCccCCcCCCCCCCcCCccccCCeEeecCCc
Confidence 999998 7789999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCC-CCeEEEEEee-cccceeEEEccccCC--CCCCCCCCCCCCCccChHHHHHHHh
Q 045789 149 PVIKQ-FKTRFVLISF-NGSFLSSLYMASCFR--ARPCFRAPSVAVFEETHEAHIAIKL 203 (206)
Q Consensus 149 ~~~~~-~~~~~~~~~~-~gG~n~~~vl~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~ 203 (206)
+|+.. .+++..+++| +||+|+|+|++++++ .......|...+.+.+..+.+....
T Consensus 398 ~W~~~~~prrAgvssfG~gGtNaHvIlEe~~~~~~~~~~~~p~~l~lSAk~~~~L~~~a 456 (1061)
T COG3321 398 PWPTGGGPRRAGVSSFGFGGTNAHVILEEAPPRAESTIPSSPRLLVLSAKTAERLAATA 456 (1061)
T ss_pred CCCCCCCCceeeeeccCCCCCceEEEEeecCCcccCCCCCCCceeeeecCCHHHHHHHH
Confidence 99887 6777778776 999999999999886 1112222223344555555555443
|
|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II | Back alignment and domain information |
|---|
| >PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional | Back alignment and domain information |
|---|
| >PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase | Back alignment and domain information |
|---|
| >PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >KOG1394 consensus 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria | Back alignment and domain information |
|---|
| >PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II | Back alignment and domain information |
|---|
| >cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases | Back alignment and domain information |
|---|
| >PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II | Back alignment and domain information |
|---|
| >smart00825 PKS_KS Beta-ketoacyl synthase | Back alignment and domain information |
|---|
| >PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated | Back alignment and domain information |
|---|
| >cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations | Back alignment and domain information |
|---|
| >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed | Back alignment and domain information |
|---|
| >PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 | Back alignment and domain information |
|---|
| >cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated | Back alignment and domain information |
|---|
| >cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction | Back alignment and domain information |
|---|
| >cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases | Back alignment and domain information |
|---|
| >PRK05656 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06445 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06633 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02644 acetyl-CoA C-acetyltransferase | Back alignment and domain information |
|---|
| >PRK13359 beta-ketoadipyl CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK09052 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06064 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09051 beta-ketothiolase; Provisional | Back alignment and domain information |
|---|
| >PRK07661 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02430 pcaF beta-ketoadipyl CoA thiolase | Back alignment and domain information |
|---|
| >PRK08242 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07108 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06954 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07801 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07851 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02445 fadA fatty oxidation complex, beta subunit FadA | Back alignment and domain information |
|---|
| >PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK06205 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09050 beta-ketoadipyl CoA thiolase; Validated | Back alignment and domain information |
|---|
| >PLN02287 3-ketoacyl-CoA thiolase | Back alignment and domain information |
|---|
| >PRK08131 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08235 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07516 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism | Back alignment and domain information |
|---|
| >PRK12578 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06025 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07850 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06504 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06690 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed | Back alignment and domain information |
|---|
| >PRK06289 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK08313 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00455 3-ketoacyl-CoA thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06066 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06157 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07937 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK09268 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08257 acetyl-CoA acetyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07855 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 | Back alignment and domain information |
|---|
| >KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III | Back alignment and domain information |
|---|
| >PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems | Back alignment and domain information |
|---|
| >COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PRK06840 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed | Back alignment and domain information |
|---|
| >PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III | Back alignment and domain information |
|---|
| >PRK04262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional | Back alignment and domain information |
|---|
| >TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative | Back alignment and domain information |
|---|
| >cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes | Back alignment and domain information |
|---|
| >PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed | Back alignment and domain information |
|---|
| >PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 | Back alignment and domain information |
|---|
| >cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs | Back alignment and domain information |
|---|
| >TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade | Back alignment and domain information |
|---|
| >COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN03173 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03170 chalcone synthase; Provisional | Back alignment and domain information |
|---|
| >PLN03169 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08256 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >PRK06158 thiolase; Provisional | Back alignment and domain information |
|---|
| >PRK05790 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06365 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03172 chalcone synthase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK06065 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK06366 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08142 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06059 lipid-transfer protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02446 FadI fatty oxidation complex, beta subunit FadI | Back alignment and domain information |
|---|
| >PRK08170 acetyl-CoA acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03171 chalcone synthase-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 206 | ||||
| 1j3n_A | 408 | Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protei | 1e-30 | ||
| 1e5m_A | 416 | Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kas | 6e-26 | ||
| 2gqd_A | 437 | The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii | 6e-24 | ||
| 2c9h_A | 444 | Structure Of Mitochondrial Beta-Ketoacyl Synthase L | 7e-23 | ||
| 2iwy_A | 438 | Human Mitochondrial Beta-ketoacyl Acp Synthase Leng | 8e-23 | ||
| 1w0i_A | 431 | Arabidopsis Thaliana Mitochondrial Kas Length = 431 | 1e-22 | ||
| 4f32_A | 451 | Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei | 1e-21 | ||
| 4ddo_A | 451 | Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei | 1e-21 | ||
| 3o04_A | 413 | Crystal Structure Of The Beta-Keto-Acyl Carrier Pro | 3e-21 | ||
| 2rjt_A | 428 | Crystal Structure Analysis Of A Surface Entropy Red | 3e-21 | ||
| 1ox0_A | 430 | The Crystal Structure Of Beta-Ketoacyl-[acyl Carrie | 5e-21 | ||
| 3hnz_A | 427 | Structure Of E. Coli Fabf(C163a) In Complex With Pl | 2e-20 | ||
| 2gfv_A | 427 | Structure Of E. Coli Fabf (Kasii) C163q Mutant Leng | 2e-20 | ||
| 1b3n_A | 412 | Beta-Ketoacyl Carrier Protein Synthase As A Drug Ta | 2e-20 | ||
| 2gfw_A | 427 | Structure Of Wild Type E. Coli Fabf (Kasii) Length | 2e-20 | ||
| 2alm_A | 431 | Crystal Structure Analysis Of A Mutant Beta-Ketoacy | 6e-20 | ||
| 2gfy_A | 427 | Structure Of E. Coli Fabf(K335a) Mutant With Covale | 1e-19 | ||
| 2gp6_A | 434 | X-Ray Crystal Structure Of Mycobacterium Tuberculos | 1e-19 | ||
| 2wgf_A | 416 | Crystal Structure Of Mycobacterium Tuberculosis C17 | 5e-19 | ||
| 2wgd_A | 416 | Crystal Structure Of Kasa Of Mycobacterium Tubercul | 6e-19 | ||
| 3e60_A | 424 | Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei | 3e-16 | ||
| 1fj4_A | 406 | The Structure Of Beta-Ketoacyl-[acyl Carrier Protei | 3e-16 | ||
| 1dd8_A | 406 | Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Pr | 3e-16 | ||
| 1f91_A | 406 | Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In | 3e-16 | ||
| 2vb7_C | 406 | Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Ap | 4e-16 | ||
| 1ek4_A | 418 | Beta-Ketoacyl [acyl Carrier Protein] Synthase I In | 4e-16 | ||
| 1h4f_A | 406 | E. Coli Beta-Ketoacyl [acyl Carrier Protein] Syntha | 7e-16 | ||
| 3kzu_A | 428 | Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei | 8e-16 | ||
| 4ewg_A | 412 | Crystal Structure Of A Beta-Ketoacyl Synthase From | 1e-15 | ||
| 2byw_A | 418 | Structure Of Escherichia Coli Beta-Ketoacyl (Acyl C | 2e-15 | ||
| 2byz_A | 418 | Structure Of E. Coli Kas I H298q Mutant In Complex | 2e-15 | ||
| 2byy_A | 418 | E. Coli Kas I H298e Mutation Length = 418 | 2e-15 | ||
| 3oyt_A | 410 | 1.84 Angstrom Resolution Crystal Structure Of 3-Oxo | 3e-15 | ||
| 3lrf_A | 428 | Crystal Structure Of Beta-Ketoacyl Synthase From Br | 4e-14 | ||
| 1tqy_A | 424 | The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le | 4e-14 | ||
| 3u0f_A | 411 | The Structure Of Beta-Ketoacyl Synthase From Brucel | 4e-14 | ||
| 2hg4_A | 917 | Structure Of The Ketosynthase-acyltransferase Didom | 6e-07 | ||
| 2qo3_A | 915 | Crystal Structure Of [ks3][at3] Didomain From Modul | 8e-07 | ||
| 3hhd_A | 965 | Structure Of The Human Fatty Acid Synthase Ks-Mat D | 8e-07 | ||
| 2vz8_A | 2512 | Crystal Structure Of Mammalian Fatty Acid Synthase | 7e-06 |
| >pdb|1J3N|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protein) Synthase Ii From Thermus Thermophilus Hb8 Length = 408 | Back alignment and structure |
|
| >pdb|1E5M|A Chain A, Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kasii) From Synechocystis Sp Length = 416 | Back alignment and structure |
| >pdb|2GQD|A Chain A, The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii (Fabf) From Staphylococcus Aureus Length = 437 | Back alignment and structure |
| >pdb|2C9H|A Chain A, Structure Of Mitochondrial Beta-Ketoacyl Synthase Length = 444 | Back alignment and structure |
| >pdb|2IWY|A Chain A, Human Mitochondrial Beta-ketoacyl Acp Synthase Length = 438 | Back alignment and structure |
| >pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas Length = 431 | Back alignment and structure |
| >pdb|4F32|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis In Complex With Platencin Length = 451 | Back alignment and structure |
| >pdb|4DDO|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis Length = 451 | Back alignment and structure |
| >pdb|3O04|A Chain A, Crystal Structure Of The Beta-Keto-Acyl Carrier Protein Synthase Ii (Lmo2201) From Listeria Monocytogenes Length = 413 | Back alignment and structure |
| >pdb|2RJT|A Chain A, Crystal Structure Analysis Of A Surface Entropy Reduction Mutant Of S. Pneumoniae Fabf Length = 428 | Back alignment and structure |
| >pdb|1OX0|A Chain A, The Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 430 | Back alignment and structure |
| >pdb|3HNZ|A Chain A, Structure Of E. Coli Fabf(C163a) In Complex With Platensimycin Length = 427 | Back alignment and structure |
| >pdb|2GFV|A Chain A, Structure Of E. Coli Fabf (Kasii) C163q Mutant Length = 427 | Back alignment and structure |
| >pdb|1B3N|A Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 | Back alignment and structure |
| >pdb|2GFW|A Chain A, Structure Of Wild Type E. Coli Fabf (Kasii) Length = 427 | Back alignment and structure |
| >pdb|2ALM|A Chain A, Crystal Structure Analysis Of A Mutant Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 431 | Back alignment and structure |
| >pdb|2GFY|A Chain A, Structure Of E. Coli Fabf(K335a) Mutant With Covalently Linked Dodecanoic Acid Length = 427 | Back alignment and structure |
| >pdb|2GP6|A Chain A, X-Ray Crystal Structure Of Mycobacterium Tuberculosis Beta- Ketoacyl Acyl Carrier Protein Synthase Ii (Mtkasb) Length = 434 | Back alignment and structure |
| >pdb|2WGF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis C171q Kasa Variant Length = 416 | Back alignment and structure |
| >pdb|2WGD|A Chain A, Crystal Structure Of Kasa Of Mycobacterium Tuberculosis Length = 416 | Back alignment and structure |
| >pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Bartonella Henselae Length = 424 | Back alignment and structure |
| >pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I In Complex With Thiolactomycin, Implications For Drug Design Length = 406 | Back alignment and structure |
| >pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I From Escherichia Coli Length = 406 | Back alignment and structure |
| >pdb|1F91|A Chain A, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex With C10 Fatty Acid Substrate Length = 406 | Back alignment and structure |
| >pdb|2VB7|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo Structure After Soak In Peg Solution Length = 406 | Back alignment and structure |
| >pdb|1EK4|A Chain A, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex With Dodecanoic Acid To 1.85 Resolution Length = 418 | Back alignment and structure |
| >pdb|1H4F|A Chain A, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I K328r Length = 406 | Back alignment and structure |
| >pdb|3KZU|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Brucella Melitensis Length = 428 | Back alignment and structure |
| >pdb|4EWG|A Chain A, Crystal Structure Of A Beta-Ketoacyl Synthase From Burkholderia Phymatum Stm815 Length = 412 | Back alignment and structure |
| >pdb|2BYW|A Chain A, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I Lys328ala Mutant Length = 418 | Back alignment and structure |
| >pdb|2BYZ|A Chain A, Structure Of E. Coli Kas I H298q Mutant In Complex With C12 Fatty Acid Length = 418 | Back alignment and structure |
| >pdb|2BYY|A Chain A, E. Coli Kas I H298e Mutation Length = 418 | Back alignment and structure |
| >pdb|3OYT|A Chain A, 1.84 Angstrom Resolution Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase I (Fabb) From Yersinia Pestis Co92 Length = 410 | Back alignment and structure |
| >pdb|3LRF|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Length = 428 | Back alignment and structure |
| >pdb|1TQY|A Chain A, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 424 | Back alignment and structure |
| >pdb|3U0F|A Chain A, The Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Bound To The Fragment 7-Hydroxycoumarin Length = 411 | Back alignment and structure |
| >pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 | Back alignment and structure |
| >pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 | Back alignment and structure |
| >pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 | Back alignment and structure |
| >pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 206 | |||
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 3e-70 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 3e-70 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 4e-69 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 5e-69 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 6e-69 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 8e-69 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 1e-68 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 1e-68 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 2e-68 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 4e-68 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 5e-68 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 6e-68 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 6e-68 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 3e-67 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 1e-60 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 1e-59 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 3e-59 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 2e-38 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 4e-35 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 4e-29 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-27 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 2e-28 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 6e-21 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 1e-22 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 7e-17 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 2e-16 | |
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 2e-16 |
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Length = 430 | Back alignment and structure |
|---|
Score = 218 bits (559), Expect = 3e-70
Identities = 60/139 (43%), Positives = 87/139 (62%), Gaps = 8/139 (5%)
Query: 1 MGEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKS 60
MGEG+G+L+LE LEHA+KRG I AE++ TCDAYH+T+PHPEG G + ++ AL ++
Sbjct: 250 MGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQGAIKAIKLALEEA 309
Query: 61 GVAKEDVNYINAHAPSTRLGDLREYQA--------LRMNSTKSLIGHLLGASGAAEAVAT 112
++ E V Y+NAH ST + E A + ++STKS GHLLGA+GA EA+ T
Sbjct: 310 EISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGHLLGAAGAVEAIVT 369
Query: 113 IKAIQTGWIHPNLNLENPD 131
I+A++ ++
Sbjct: 370 IEAMRHNFVPMTAGTSEVS 388
|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Length = 416 | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Length = 438 | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 408 | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Length = 434 | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Length = 413 | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Length = 416 | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Length = 451 | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Length = 437 | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Length = 427 | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 424 | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Length = 431 | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Length = 428 | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Length = 412 | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 415 | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Length = 406 | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Length = 428 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 | Back alignment and structure |
|---|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 | Back alignment and structure |
|---|
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| 2hg4_A | 917 | DEBS, 6-deoxyerythronolide B synthase; ketosynthas | 100.0 | |
| 2qo3_A | 915 | Eryaii erythromycin polyketide synthase modules 3; | 100.0 | |
| 3hhd_A | 965 | Fatty acid synthase; transferase, multienzyme, meg | 100.0 | |
| 2iwz_A | 438 | 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho | 100.0 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 100.0 | |
| 1e5m_A | 416 | KAS II, beta ketoacyl acyl carrier protein synthas | 100.0 | |
| 3ho9_A | 427 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, | 100.0 | |
| 4ewg_A | 412 | Beta-ketoacyl synthase; ssgcid, structural genomic | 100.0 | |
| 3o04_A | 413 | LMO2201 protein, beta-keto-acyl carrier protein sy | 100.0 | |
| 1tqy_A | 424 | Beta-ketoacyl synthase/acyl transferase; alpha-bet | 100.0 | |
| 2gqd_A | 437 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli | 100.0 | |
| 1tqy_B | 415 | Actinorhodin polyketide putative beta-ketoacyl SY; | 100.0 | |
| 1j3n_A | 408 | 3-oxoacyl-(acyl-carrier protein) synthase II; cond | 100.0 | |
| 4ddo_A | 451 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci | 100.0 | |
| 2ix4_A | 431 | 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke | 100.0 | |
| 2wge_A | 416 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta | 100.0 | |
| 1ox0_A | 430 | Beta ketoacyl-acyl carrier protein synthase; trans | 100.0 | |
| 3mqd_A | 428 | Beta-ketoacyl synthase; ssgcid, ALS collaborative | 100.0 | |
| 3kzu_A | 428 | 3-oxoacyl-(acyl-carrier-protein) synthase II; seat | 100.0 | |
| 2gp6_A | 434 | 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol | 100.0 | |
| 2vba_A | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop | 100.0 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 100.0 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 100.0 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 100.0 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 100.0 | |
| 1ulq_A | 401 | Putative acetyl-COA acetyltransferase; structural | 99.78 | |
| 2wu9_A | 442 | 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o | 99.78 | |
| 1wdk_C | 390 | 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame | 99.76 | |
| 4dd5_A | 396 | Acetyl-COA acetyltransferase; structural genomics, | 99.76 | |
| 2vu1_A | 392 | Acetyl-COA acetyltransferase; acyltransferase, PHB | 99.75 | |
| 1wl4_A | 397 | Acetyl-coenzyme A acetyltransferase 2; thiolase fo | 99.75 | |
| 4egv_A | 520 | Acetyl-COA acetyltransferase; NEW SUB-family, thio | 99.72 | |
| 2iik_A | 418 | 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m | 99.71 | |
| 4e1l_A | 395 | Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, | 99.71 | |
| 1afw_A | 393 | 3-ketoacetyl-COA thiolase; fatty acid metabolism; | 99.71 | |
| 3ss6_A | 394 | Acetyl-COA acetyltransferase; structural genomics, | 99.71 | |
| 3goa_A | 387 | 3-ketoacyl-COA thiolase; metabolism, fatty acid, p | 99.71 | |
| 2ib8_A | 395 | Acetyl-COA acetyltransferase; thiolase fold, potas | 99.67 | |
| 3svk_A | 407 | Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, | 99.65 | |
| 1ub7_A | 322 | 3-oxoacyl-[acyl-carrier protein] synthase; fatty a | 99.56 | |
| 2ebd_A | 309 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 99.32 | |
| 1hnj_A | 317 | Beta-ketoacyl-acyl carrier protein synthase III; F | 99.3 | |
| 1zow_A | 313 | 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB | 99.3 | |
| 1mzj_A | 339 | Beta-ketoacylsynthase III; beta-ketosynthase, arom | 99.16 | |
| 2x3e_A | 331 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, | 99.11 | |
| 1u6e_A | 335 | 3-oxoacyl-[acyl-carrier-protein] synthase III; tra | 98.81 | |
| 1ted_A | 393 | PKS18; thiolase fold, substrate binding tunnel, tr | 98.78 | |
| 1u0m_A | 382 | Putative polyketide synthase; type III polyketide | 98.78 | |
| 2h84_A | 374 | Steely1; thiolase-fold, type III polyketide syntha | 98.5 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 98.46 | |
| 1xpm_A | 396 | 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s | 98.05 | |
| 4dfe_A | 333 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci | 98.0 | |
| 3s21_A | 345 | 3-oxoacyl-[ACP] synthase III; non-decarboxylative | 97.7 | |
| 2d3m_A | 406 | Pentaketide chromone synthase; chalcone synthase, | 97.67 | |
| 3il3_A | 323 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 96.84 | |
| 3h78_A | 359 | PQS biosynthetic enzyme; PQSD, anthranilic acid, a | 96.5 | |
| 3gwa_A | 365 | 3-oxoacyl-(acyl-carrier-protein) synthase III; str | 96.43 | |
| 3s3l_A | 357 | CERJ; acyltransferase, FABH homologue, KS III homo | 96.41 | |
| 3led_A | 392 | 3-oxoacyl-acyl carrier protein synthase III; struc | 95.74 | |
| 3a5r_A | 387 | Benzalacetone synthase; chalcone synthase, type II | 95.72 | |
| 4efi_A | 354 | 3-oxoacyl-(acyl-carrier protein) synthase; structu | 95.64 | |
| 2f82_A | 450 | HMG-COA synthase; HMGS1, transferase; 2.10A {Brass | 95.64 | |
| 1ee0_A | 402 | 2-pyrone synthase; polyketide synthase, thiolase f | 95.32 | |
| 1xes_A | 413 | Dihydropinosylvin synthase; native structure, tran | 95.29 | |
| 1i88_A | 389 | CHS2, chalcone synthase 2; polyketide synthase, tr | 95.25 | |
| 2p0u_A | 413 | Stilbenecarboxylate synthase 2; polyketide synthas | 94.91 | |
| 3ov2_A | 393 | Curcumin synthase; type III polyketide synthase, t | 94.66 | |
| 3awk_A | 402 | Chalcone synthase-like polyketide synthase; type I | 94.64 | |
| 3euo_A | 379 | Type III pentaketide synthase; alpha helix, acyltr | 94.3 | |
| 3e1h_A | 465 | PKSIIINC, putative uncharacterized protein; resorc | 94.12 | |
| 3v4n_A | 388 | HMG-COA synthase; hydroxymethylglutaryl-COA syntha | 93.25 | |
| 3sqz_A | 425 | Putative hydroxymethylglutaryl-COA synthase; thiol | 91.61 | |
| 3oit_A | 387 | OS07G0271500 protein; type III polyketide synthase | 91.59 | |
| 3lma_A | 347 | Stage V sporulation protein AD (spovad); NESG, str | 88.77 | |
| 3il6_A | 321 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, | 87.61 | |
| 4ewp_A | 350 | 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans | 86.86 |
| >2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-39 Score=312.89 Aligned_cols=179 Identities=27% Similarity=0.352 Sum_probs=164.0
Q ss_pred CCceEEEEEEccchHHHhcCCceeEEEEEEEecCCCCCCCCCCCChHHHHHHHHHHHHHcCCCccccccccccCCCCCcC
Q 045789 1 MGEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKSGVAKEDVNYINAHAPSTRLG 80 (206)
Q Consensus 1 lgEGa~alvL~~~~~A~~~g~~i~a~I~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~Agi~~~dI~~ve~hgtgt~~~ 80 (206)
+|||++++|||++++|+++|++||++|+|+++++||.+.+.+.|++.++.++|+++|++||++|+||+|||+|||||+.+
T Consensus 262 ~gEGagavVL~~l~~A~~~g~~i~a~I~G~~~~~dg~~~~~~~P~~~~q~~ai~~Al~~Agl~p~dId~veaHgtgT~~g 341 (917)
T 2hg4_A 262 LAEGAGVLVLQRLSAARREGRPVLAVLRGSAVNQDGASNGLTAPSGPAQQRVIRRALENAGVRAGDVDYVEAHGTGTRLG 341 (917)
T ss_dssp BBCEEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECCSCSSSSCCCHHHHHHHHHHHHHHHTCCGGGCCEEECCCCCCTTH
T ss_pred CcceEEEEEEeeHHHHHhCCCCeEEEEEEEEEecCCCccCCCCCCHHHHHHHHHHHHHHcCCCHHHCCEEeeccCCCccC
Confidence 48999999999999999999999999999999999998888999999999999999999999999999999999999999
Q ss_pred CHhhhhc--------------ceeccccccccccccccchHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCCcccccc
Q 045789 81 DLREYQA--------------LRMNSTKSLIGHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHVLSRTSGASAAFI 146 (206)
Q Consensus 81 D~~E~~a--------------~~v~s~k~~~Gh~~~asG~~~l~~~~l~l~~~~ipp~~~~~~~~~~~~~~~~~~~~~~~ 146 (206)
|++|..+ ++++++|+++||+++|+|+++++|++++|++++|||++|+++|||.++++..+++++++
T Consensus 342 D~~E~~al~~~fg~~~~~~~~~~vgs~K~~iGH~~~AaG~~~lik~vl~L~~~~ipp~~~~~~~~p~i~~~~~~~~v~~~ 421 (917)
T 2hg4_A 342 DPIEVHALLSTYGAERDPDDPLWIGSVKSNIGHTQAAAGVAGVMKAVLALRHGEMPRTLHFDEPSPQIEWDLGAVSVVSQ 421 (917)
T ss_dssp HHHHHHHHHTTTTTSSCTTSCCEEECTHHHHCBCGGGTTHHHHHHHHHHHHHTEECCCTTCCSBCTTSCC---CCEECCS
T ss_pred cHHHHHHHHHHhccccCCCCceeccCcccceecchhhhHHHHHHHHHHHHhcCCcCCCCCCCCCCccCCccccceeecCC
Confidence 9999877 56899999999999999999999999999999999999999999999999999999999
Q ss_pred cccccCC-CCeEEEEEe-ecccceeEEEccccCCC
Q 045789 147 SIPVIKQ-FKTRFVLIS-FNGSFLSSLYMASCFRA 179 (206)
Q Consensus 147 ~~~~~~~-~~~~~~~~~-~~gG~n~~~vl~~~~~~ 179 (206)
.++|+.. ..+++.+|+ +|||+|+|+||++++..
T Consensus 422 ~~~w~~~~~~r~a~v~sfG~gG~Nah~vl~~~~~~ 456 (917)
T 2hg4_A 422 ARSWPAGERPRRAGVSSFGISGTNAHVIVEEAPEA 456 (917)
T ss_dssp CEECCCCSSCCEEEEEEECTTSEEEEEEEEECCCC
T ss_pred cccCCCCCCCCEEEEeeecCCCceEEEEeccCCcc
Confidence 9999863 334555555 59999999999997743
|
| >2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A | Back alignment and structure |
|---|
| >2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A | Back alignment and structure |
|---|
| >4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* | Back alignment and structure |
|---|
| >2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A | Back alignment and structure |
|---|
| >2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* | Back alignment and structure |
|---|
| >1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A | Back alignment and structure |
|---|
| >3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* | Back alignment and structure |
|---|
| >3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A | Back alignment and structure |
|---|
| >2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 | Back alignment and structure |
|---|
| >2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A | Back alignment and structure |
|---|
| >1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* | Back alignment and structure |
|---|
| >4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} | Back alignment and structure |
|---|
| >2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... | Back alignment and structure |
|---|
| >1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A | Back alignment and structure |
|---|
| >4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A | Back alignment and structure |
|---|
| >3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* | Back alignment and structure |
|---|
| >3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* | Back alignment and structure |
|---|
| >1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A | Back alignment and structure |
|---|
| >1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A | Back alignment and structure |
|---|
| >1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A | Back alignment and structure |
|---|
| >1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 | Back alignment and structure |
|---|
| >2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* | Back alignment and structure |
|---|
| >4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A | Back alignment and structure |
|---|
| >2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* | Back alignment and structure |
|---|
| >3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* | Back alignment and structure |
|---|
| >3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A | Back alignment and structure |
|---|
| >3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* | Back alignment and structure |
|---|
| >3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A | Back alignment and structure |
|---|
| >4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* | Back alignment and structure |
|---|
| >1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A | Back alignment and structure |
|---|
| >1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A | Back alignment and structure |
|---|
| >1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* | Back alignment and structure |
|---|
| >2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha} | Back alignment and structure |
|---|
| >3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A | Back alignment and structure |
|---|
| >3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A | Back alignment and structure |
|---|
| >3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* | Back alignment and structure |
|---|
| >3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} | Back alignment and structure |
|---|
| >3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* | Back alignment and structure |
|---|
| >3sqz_A Putative hydroxymethylglutaryl-COA synthase; thiolase fold, HMG_COA synthase, transferase; HET: COA; 1.20A {Streptococcus mutans} PDB: 3leh_A | Back alignment and structure |
|---|
| >3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A | Back alignment and structure |
|---|
| >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A | Back alignment and structure |
|---|
| >3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* | Back alignment and structure |
|---|
| >4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 206 | ||||
| d2ix4a2 | 161 | c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II | 6e-27 | |
| d1e5ma2 | 161 | c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II | 6e-24 | |
| d2gfva2 | 161 | c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II | 5e-22 | |
| d1j3na2 | 159 | c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II | 5e-21 | |
| d1tqya2 | 205 | c.95.1.1 (A:219-423) Actinorhodin polyketide putat | 2e-20 | |
| d1ox0a2 | 158 | c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II | 9e-20 | |
| d2vbaa2 | 151 | c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I | 1e-17 | |
| d1tqyb2 | 194 | c.95.1.1 (B:210-403) Actinorhodin polyketide putat | 7e-13 | |
| d2vbaa1 | 253 | c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E | 8e-07 | |
| d2ix4a1 | 270 | c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II | 1e-06 | |
| d1e5ma1 | 250 | c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { | 1e-05 | |
| d1ox0a1 | 256 | c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II | 2e-05 | |
| d1j3na1 | 249 | c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { | 2e-05 | |
| d2gfva1 | 250 | c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { | 2e-05 |
| >d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 161 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Beta-ketoacyl-ACP synthase II species: Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]
Score = 98.7 bits (245), Expect = 6e-27
Identities = 49/124 (39%), Positives = 67/124 (54%), Gaps = 13/124 (10%)
Query: 24 YAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKSGVAKEDVNYINAHAPSTRLGDL- 82
YAE+ ++ DA+HIT P +G G V M +AL +SG+ ++Y+NAHA ST +GD
Sbjct: 1 YAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAV 60
Query: 83 ------------REYQALRMNSTKSLIGHLLGASGAAEAVATIKAIQTGWIHPNLNLENP 130
L +STK GHLLGA+GA EA+ +I AI G LN++NP
Sbjct: 61 EARAIKTVFSEHATSGTLAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNP 120
Query: 131 DKHV 134
D
Sbjct: 121 DPIF 124
|
| >d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 161 | Back information, alignment and structure |
|---|
| >d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 159 | Back information, alignment and structure |
|---|
| >d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 205 | Back information, alignment and structure |
|---|
| >d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 158 | Back information, alignment and structure |
|---|
| >d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 151 | Back information, alignment and structure |
|---|
| >d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 194 | Back information, alignment and structure |
|---|
| >d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 | Back information, alignment and structure |
|---|
| >d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 | Back information, alignment and structure |
|---|
| >d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 | Back information, alignment and structure |
|---|
| >d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 | Back information, alignment and structure |
|---|
| >d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 | Back information, alignment and structure |
|---|
| >d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 206 | |||
| d1tqya2 | 205 | Actinorhodin polyketide putative beta-ketoacyl syn | 100.0 | |
| d1tqyb2 | 194 | Actinorhodin polyketide putative beta-ketoacyl syn | 100.0 | |
| d1e5ma2 | 161 | Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ | 100.0 | |
| d1j3na2 | 159 | Beta-ketoacyl-ACP synthase II {Thermus thermophilu | 100.0 | |
| d2gfva2 | 161 | Beta-ketoacyl-ACP synthase II {Escherichia coli [T | 100.0 | |
| d1ox0a2 | 158 | Beta-ketoacyl-ACP synthase II {Streptococcus pneum | 100.0 | |
| d2ix4a2 | 161 | Beta-ketoacyl-ACP synthase II {Thale cress (Arabid | 100.0 | |
| d2vbaa2 | 151 | Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta | 100.0 | |
| d1afwa2 | 124 | Thiolase {Baker's yeast (Saccharomyces cerevisiae) | 98.83 | |
| d1wdkc2 | 128 | Fatty oxidation complex beta subunit (3-ketoacyl-C | 98.67 | |
| d1ulqa2 | 125 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 98.64 | |
| d1m3ka2 | 124 | Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 | 98.64 | |
| d1teda_ | 372 | Polyketide synthase PKS18 {Mycobacterium tuberculo | 95.9 | |
| d1u6ea2 | 148 | Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu | 94.44 | |
| d1ub7a2 | 149 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 93.88 | |
| d1hnja2 | 143 | Ketoacyl-ACP synthase III (FabH) {Escherichia coli | 93.0 | |
| d1mzja2 | 153 | Priming beta-ketosynthase from the r1128 polyketid | 92.6 | |
| d1u0ma2 | 148 | Putative polyketide synthase SCO1206 {Streptomyces | 90.63 | |
| d1u0ma1 | 200 | Putative polyketide synthase SCO1206 {Streptomyces | 86.19 | |
| d1ulqa1 | 273 | Beta-ketoadipyl CoA thiolase {Thermus thermophilus | 81.89 |
| >d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thiolase-like superfamily: Thiolase-like family: Thiolase-related domain: Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA species: Streptomyces coelicolor [TaxId: 1902]
Probab=100.00 E-value=2e-43 Score=285.59 Aligned_cols=171 Identities=32% Similarity=0.452 Sum_probs=156.4
Q ss_pred CCceEEEEEEccchHHHhcCCceeEEEEEEEecCCCCCCCCCCCChHHHHHHHHHHHHHcCCCccccccccccCCCCCcC
Q 045789 1 MGEGAGVLLLEELEHAKKRGTNIYAEILDGSLTCDAYHITAPHPEGVGMVSCMEKALAKSGVAKEDVNYINAHAPSTRLG 80 (206)
Q Consensus 1 lgEGa~alvL~~~~~A~~~g~~i~a~I~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~Agi~~~dI~~ve~hgtgt~~~ 80 (206)
+|||++++|||++++|+++|++||++|.|+++++|+.+.+.+.|++..+.++++++|++++++++||+|||+|||||+.+
T Consensus 19 ~gEGa~~~vL~~~~~A~~~g~~i~a~i~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~a~i~~~~i~~ie~hgtGt~~~ 98 (205)
T d1tqya2 19 LAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESRTDATDIDYINAHGSGTRQN 98 (205)
T ss_dssp EECEEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECSSCSSCCCTTCHHHHHHHHHHHHHHTCCGGGCCEEECCCCCCHHH
T ss_pred eEeeEEEEEEeEHHHHHHCCCceEEEEEeeEccccccccCcccccccccchhhhhHHhhhcCCccceeeeeccccccccC
Confidence 48999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHhhhhc-----------ceeccccccccccccccchHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCCccccccccc
Q 045789 81 DLREYQA-----------LRMNSTKSLIGHLLGASGAAEAVATIKAIQTGWIHPNLNLENPDKHVLSRTSGASAAFISIP 149 (206)
Q Consensus 81 D~~E~~a-----------~~v~s~k~~~Gh~~~asG~~~l~~~~l~l~~~~ipp~~~~~~~~~~~~~~~~~~~~~~~~~~ 149 (206)
|.+|+.+ ++|+++|+++||+++|||+++|+|++++|++++|||+.|+++++|+++++.+++ +..+
T Consensus 99 D~~E~~ai~~~~~~~~~~~~v~s~K~~~GH~~~AsG~~~li~~~~~l~~g~ipp~~~~~~~~p~~~~~~v~~----~~~~ 174 (205)
T d1tqya2 99 DRHETAAYKRALGEHARRTPVSSIKSMVGHSLGAIGSLEIAACVLALEHGVVPPTANLRTSDPECDLDYVPL----EARE 174 (205)
T ss_dssp HHHHHHHHHHHTGGGGGGSCEECTHHHHCBCTTTHHHHHHHHHHHHHHHCEECCBTTCCSBBTTBCSCCCBS----SCEE
T ss_pred chhHHHHHHHhhccccCCceeeeecccccccccccchhHHHHHHHHHhCCeEcccCCCCCCCCCCCcccCCC----CCcC
Confidence 9999988 779999999999999999999999999999999999999999999988765553 3333
Q ss_pred ccCCCCeEEEEEeecccceeEEEccccC
Q 045789 150 VIKQFKTRFVLISFNGSFLSSLYMASCF 177 (206)
Q Consensus 150 ~~~~~~~~~~~~~~~gG~n~~~vl~~~~ 177 (206)
| +.++.++++.+|||+|+|+||++++
T Consensus 175 ~--~~~~a~~~s~GfGG~na~~vl~~~~ 200 (205)
T d1tqya2 175 R--KLRSVLTVGSGFGGFQSAMVLRDAE 200 (205)
T ss_dssp C--CCSEEEEEEEETTTEEEEEEEECHH
T ss_pred C--CCCEEEEeCCCCCceeEEEEEeeCC
Confidence 3 3455666666799999999999875
|
| >d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} | Back information, alignment and structure |
|---|
| >d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} | Back information, alignment and structure |
|---|
| >d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|