Citrus Sinensis ID: 045837


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGGGSPPSAPSTPPKPSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPVPTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAPEPSKPLLPPVQYPPSSVQSTPPPSPLPQSPPPPPSVKYPPPVQSPPPPTPVQSPPPPVHSPPPP
cccccccHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccccHHccccccccccccccHHcccccccccccccccccccccccccccccccEEEcccccEEEcccccccccccccccccccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEccccccEEcccHHHHcccccEEEccccEEEEcccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEEccccccccccccccHcccccccEEEEcccccccccccHcccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHccccEEEEEEccccccccccHHHcccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLltlpqdgklpdnieNEKHMLLskhsrrpyirtrltrqgnwvgtdvcsyygvfcapapdnsnitVVAGIDlngndiagyfpaelgwlsdlALFHvnsnrfcgiipeslsNWKLIYEfdvsnnrlvgsfpnvcLSWTSLRYldlrynnfegevpRELFKMKLDAIFLnnnrfsswipetigeSTVSVVTFAHnnfsgcvprsignmpnvneiilsnndlmgclpseigwlkkltvfdassnsfygsvpqsfsSLESIHRLVLSYNQLtgyvseqicklpninnftFSYNYFQglgnecipgskeggvfddtsnclaqrpsqkwattcspvvsnpvdcskdvclgggsppsapstppkpstptptpapeqrtptpapptpsppppptpkpltpvptplppvnspnppprnwrvrshtppqpwrpsapapepskpllppvqyppssvqstpppsplpqspppppsvkypppvqspppptpvqsppppvhspppp
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTlpqdgklpdniENEKHmllskhsrrpyirtrltrqgnwvgTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAqrpsqkwattcspVVSNPVDCSKDVCLGGGSppsapstppkpSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPVPTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAPEPSKPLLPPVQYPPSSVQSTPPPSPLPQSPPPPPSVKYPPPVQSPPPptpvqsppppvhspppp
MQVVGClvlfslicssfssfsfalsdaeaaflVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGGGsppsapstppkpstptptpapeqrtptpapptpsppppptpkpltpvptplppvnspnppprNWRVRSHTppqpwrpsapapepskpllppvqyppssvqstpppsplpqspppppsvkypppvqspppptpvqsppppvhspppp
**VVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQ*********************RPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCL*****************************************************************************************************************************************************
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKD********************************************************************************************************************************************************
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGG******************************************KPLTPVPTPLPPVNSPNPPPRNW********************SKPLLPPV******************************************************
**VVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGGGSPPSAPSTPPKPSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPVPTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAP**SKPLLPPV******************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVVGCLVLFSLICSSFSSFSFALSDAEAAFLVRRQLLTLPQDGKLPDNIENEKHMLLSKHSRRPYIRTRLTRQGNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGGGSPPSAPSTPPKPSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPVPTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAPEPSKPLLPPVQYPPSSVQSTPPPSPLPQSPPPPPSVKYPPPVQSPPPPTPVQSPPPPVHSPPPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query527 2.2.26 [Sep-21-2011]
O81765 699 Pollen-specific leucine-r yes no 0.861 0.649 0.534 1e-135
Q9LJ64 956 Pollen-specific leucine-r no no 0.707 0.390 0.591 1e-135
Q9XIL9 727 Pollen-specific leucine-r no no 0.747 0.541 0.544 1e-129
Q9XIB6 847 Pollen-specific leucine-r no no 0.910 0.566 0.474 1e-122
Q9LHF1494 Leucine-rich repeat exten no no 0.664 0.708 0.471 3e-92
Q9SN46 857 Leucine-rich repeat exten no no 0.688 0.423 0.464 2e-91
Q9T0K5 760 Leucine-rich repeat exten no no 0.666 0.461 0.470 8e-91
O65375 744 Leucine-rich repeat exten no no 0.588 0.416 0.514 3e-87
O48809 786 Leucine-rich repeat exten no no 0.588 0.394 0.511 1e-86
Q9LUI1470 Leucine-rich repeat exten no no 0.565 0.634 0.486 3e-80
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1 Back     alignment and function desciption
 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 322/485 (66%), Gaps = 31/485 (6%)

Query: 23  ALSDAEAAFLVRRQLLTLPQDGKLPDNIENE---KHMLLSKHSRRPYIRTRLTRQ----- 74
           AL+D EAAF+V+RQLLTLP +G+LPD+IE E   K    +   +R YI  +  ++     
Sbjct: 44  ALTDTEAAFIVQRQLLTLPDNGELPDDIEYEVDLKATFANTRLKRAYIALQAWKKAIFSD 103

Query: 75  -----GNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALF 129
                GNW G  VC Y GV CAPA D+S++TVVAG+DLNG DIAG+ PAELG ++D+A+F
Sbjct: 104 PFNTTGNWHGPHVCGYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAMF 163

Query: 130 HVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVP 189
           H+NSNRFCGIIP+S    KL++EFDVSNNR VG FPNV LSW  ++Y DLR+N+FEG+VP
Sbjct: 164 HLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQVP 223

Query: 190 RELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIIL 249
            ELFK +LDAIFLN+NRF+S IPE++GES  SVVTFA+N F+GC+P+SIGNM N+NEI+ 
Sbjct: 224 PELFKKELDAIFLNDNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNMKNLNEIVF 283

Query: 250 SNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQ 309
            +NDL GC PSEIG L  +TVFDAS NSF G +P SF  L S+  + +S N+LTG V   
Sbjct: 284 MDNDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVPHN 343

Query: 310 ICKLPNINNFTFSYNYFQGLGNECIP-GSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSN 368
           IC+LPN+ N T+SYNYF G G  C+P GS++    DDT NCLA RP Q+ A  C+ V++ 
Sbjct: 344 ICQLPNLVNLTYSYNYFSGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVVINR 403

Query: 369 PVDCSKDVCLGGGSPPSAPSTPPKPSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPV 428
           PVDCSKD C GG S PS PS   KP TP PT    + TP P  P   P P PT     P 
Sbjct: 404 PVDCSKDKCAGGSSTPSKPSPVHKP-TPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPS 462

Query: 429 PTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAPEPSKPLLPPVQYPPSSVQSTPPPSP 488
           P P  PV+ P+P          TP        P+P PS+    PVQ P    +S  P  P
Sbjct: 463 PVPTTPVHEPSP-------VLATPVD-----KPSPVPSR----PVQKPQPPKESPQPDDP 506

Query: 489 LPQSP 493
             QSP
Sbjct: 507 YDQSP 511




Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIB6|PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
15235186 699 Pollen-specific leucine-rich repeat exte 0.861 0.649 0.534 1e-134
30685162 956 Pollen-specific leucine-rich repeat exte 0.707 0.390 0.591 1e-133
20259488 712 unknown protein [Arabidopsis thaliana] 0.707 0.523 0.591 1e-132
297836208 740 predicted protein [Arabidopsis lyrata su 0.743 0.529 0.553 1e-128
297834816 927 hypothetical protein ARALYDRAFT_479420 [ 0.795 0.451 0.506 1e-127
15226640 727 Pollen-specific leucine-rich repeat exte 0.747 0.541 0.544 1e-127
224103499 711 predicted protein [Populus trichocarpa] 0.722 0.535 0.588 1e-126
224123244499 predicted protein [Populus trichocarpa] 0.669 0.707 0.590 1e-123
297798516 668 hypothetical protein ARALYDRAFT_491276 [ 0.702 0.553 0.575 1e-122
15222149 847 Pollen-specific leucine-rich repeat exte 0.910 0.566 0.474 1e-121
>gi|15235186|ref|NP_195123.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] gi|75318791|sp|O81765.1|PLRX4_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 4; Short=AtPEX4; Short=Pollen-specific LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|3297821|emb|CAA19879.1| extensin-like protein [Arabidopsis thaliana] gi|7270346|emb|CAB80114.1| extensin-like protein [Arabidopsis thaliana] gi|332660902|gb|AEE86302.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 322/485 (66%), Gaps = 31/485 (6%)

Query: 23  ALSDAEAAFLVRRQLLTLPQDGKLPDNIENE---KHMLLSKHSRRPYIRTRLTRQ----- 74
           AL+D EAAF+V+RQLLTLP +G+LPD+IE E   K    +   +R YI  +  ++     
Sbjct: 44  ALTDTEAAFIVQRQLLTLPDNGELPDDIEYEVDLKATFANTRLKRAYIALQAWKKAIFSD 103

Query: 75  -----GNWVGTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALF 129
                GNW G  VC Y GV CAPA D+S++TVVAG+DLNG DIAG+ PAELG ++D+A+F
Sbjct: 104 PFNTTGNWHGPHVCGYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAMF 163

Query: 130 HVNSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVP 189
           H+NSNRFCGIIP+S    KL++EFDVSNNR VG FPNV LSW  ++Y DLR+N+FEG+VP
Sbjct: 164 HLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFPNVVLSWPDVKYFDLRFNDFEGQVP 223

Query: 190 RELFKMKLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIIL 249
            ELFK +LDAIFLN+NRF+S IPE++GES  SVVTFA+N F+GC+P+SIGNM N+NEI+ 
Sbjct: 224 PELFKKELDAIFLNDNRFTSVIPESLGESPASVVTFANNKFTGCIPKSIGNMKNLNEIVF 283

Query: 250 SNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQ 309
            +NDL GC PSEIG L  +TVFDAS NSF G +P SF  L S+  + +S N+LTG V   
Sbjct: 284 MDNDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVPHN 343

Query: 310 ICKLPNINNFTFSYNYFQGLGNECIP-GSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSN 368
           IC+LPN+ N T+SYNYF G G  C+P GS++    DDT NCLA RP Q+ A  C+ V++ 
Sbjct: 344 ICQLPNLVNLTYSYNYFSGQGGSCVPGGSRKEIALDDTRNCLASRPEQRSAQECAVVINR 403

Query: 369 PVDCSKDVCLGGGSPPSAPSTPPKPSTPTPTPAPEQRTPTPAPPTPSPPPPPTPKPLTPV 428
           PVDCSKD C GG S PS PS   KP TP PT    + TP P  P   P P PT     P 
Sbjct: 404 PVDCSKDKCAGGSSTPSKPSPVHKP-TPVPTTPVHKPTPVPTTPVQKPSPVPTTPVQKPS 462

Query: 429 PTPLPPVNSPNPPPRNWRVRSHTPPQPWRPSAPAPEPSKPLLPPVQYPPSSVQSTPPPSP 488
           P P  PV+ P+P          TP        P+P PS+    PVQ P    +S  P  P
Sbjct: 463 PVPTTPVHEPSP-------VLATPVD-----KPSPVPSR----PVQKPQPPKESPQPDDP 506

Query: 489 LPQSP 493
             QSP
Sbjct: 507 YDQSP 511




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|30685162|ref|NP_188532.2| Pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] gi|75335059|sp|Q9LJ64.1|PLRX1_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 1; Short=AtPEX1; Short=Pollen-specific LRR/EXTENSIN1; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|9280319|dbj|BAB01698.1| extensin protein-like [Arabidopsis thaliana] gi|332642663|gb|AEE76184.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297836208|ref|XP_002885986.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331826|gb|EFH62245.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297834816|ref|XP_002885290.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. lyrata] gi|297331130|gb|EFH61549.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15226640|ref|NP_179188.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] gi|75338652|sp|Q9XIL9.1|PLRX3_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 3; Short=AtPEX3; Short=Pollen-specific LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|5306245|gb|AAD41978.1| unknown protein [Arabidopsis thaliana] gi|330251349|gb|AEC06443.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224103499|ref|XP_002313080.1| predicted protein [Populus trichocarpa] gi|222849488|gb|EEE87035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123244|ref|XP_002330268.1| predicted protein [Populus trichocarpa] gi|222871303|gb|EEF08434.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297798516|ref|XP_002867142.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. lyrata] gi|297312978|gb|EFH43401.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15222149|ref|NP_175372.1| Pollen-specific leucine-rich repeat extensin-like protein 2 [Arabidopsis thaliana] gi|75338632|sp|Q9XIB6.1|PLRX2_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 2; Short=AtPEX2; Short=Pollen-specific LRR/EXTENSIN2; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|5430752|gb|AAD43152.1|AC007504_7 Hypothetical Protein [Arabidopsis thaliana] gi|332194314|gb|AEE32435.1| Pollen-specific leucine-rich repeat extensin-like protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query527
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.660 0.364 0.603 1.6e-116
TAIR|locus:2118949 699 AT4G33970 [Arabidopsis thalian 0.660 0.497 0.580 1.6e-111
TAIR|locus:2044576 727 AT2G15880 [Arabidopsis thalian 0.658 0.477 0.572 6.8e-111
TAIR|locus:2010247 847 AT1G49490 [Arabidopsis thalian 0.578 0.360 0.645 7.8e-110
TAIR|locus:2142105 760 LRX3 "AT4G13340" [Arabidopsis 0.565 0.392 0.524 9.1e-84
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.641 0.394 0.473 1.2e-83
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.645 0.688 0.470 1.5e-83
TAIR|locus:2008895 744 LRX1 "AT1G12040" [Arabidopsis 0.573 0.405 0.518 5.8e-82
TAIR|locus:2121348391 AT4G28380 [Arabidopsis thalian 0.573 0.772 0.511 4.7e-80
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.565 0.634 0.486 4.8e-78
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1148 (409.2 bits), Expect = 1.6e-116, P = 1.6e-116
 Identities = 218/361 (60%), Positives = 267/361 (73%)

Query:    34 RRQLLTLPQDGKLPDNIENEKHMLL---SKHSRRPYIRTRLTRQG----------NWVGT 80
             RRQLL L ++G LPD+IE E  + L   +   +R YI  +  ++           NWVG 
Sbjct:    41 RRQLLALSENGDLPDDIEYEVDLDLKFANNRLKRAYIALQAWKKAFYSDPFNTAANWVGP 100

Query:    81 DVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGII 140
             DVCSY GVFCAPA D+ ++ VVAGIDLN  DIAGY P ELG L+D+ALFHVNSNRFCG+I
Sbjct:   101 DVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVI 160

Query:   141 PESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKMKLDAI 200
             P+SLS   L+YEFDVSNNR VG FP V LSW SL++LD+RYN+FEG++P E+F   LDAI
Sbjct:   161 PKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAI 220

Query:   201 FLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPS 260
             FLNNNRF S IPETIG+ST SVVTFAHN FSGC+P++IG M N+NEI+   N+L GCLP+
Sbjct:   221 FLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPN 280

Query:   261 EIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFT 320
             EIG L  +TVFDASSN F GS+P + S L ++ ++  SYN+ TG+V++ ICKLP ++NFT
Sbjct:   281 EIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFT 340

Query:   321 FSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQRPSQKWATTCSPVVSNPVDCSKDVCLGG 380
             FSYN+F G    C+PGS +   FDDTSNCL  RP+QK A  C PVVS PVDCSKD C GG
Sbjct:   341 FSYNFFNGEAQSCVPGSSQEKQFDDTSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCAGG 400

Query:   381 G 381
             G
Sbjct:   401 G 401




GO:0005634 "nucleus" evidence=ISM
GO:0005199 "structural constituent of cell wall" evidence=ISS
GO:0009860 "pollen tube growth" evidence=RCA
TAIR|locus:2118949 AT4G33970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121348 AT4G28380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81765PLRX4_ARATHNo assigned EC number0.53400.86140.6494yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT4G33970
protein binding / structural constituent of cell wall; protein binding / structural constituent of cell wall; FUNCTIONS IN- structural constituent of cell wall, protein binding; LOCATED IN- endomembrane system; EXPRESSED IN- 6 plant structures; EXPRESSED DURING- L mature pollen stage, M germinated pollen stage, 4 anthesis; CONTAINS InterPro DOMAIN/s- Leucine-rich repeat, N-terminal (InterPro-IPR013210), Leucine-rich repeat (InterPro-IPR001611); BEST Arabidopsis thaliana protein match is- leucine-rich repeat family protein / extensin family protein (TAIR-AT2G15880.1); Has 278485 Blast h [...] (699 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-24
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-18
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-17
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-15
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 7e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-14
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-14
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-13
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-13
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 3e-13
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-13
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-13
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-13
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-13
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-13
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-12
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-12
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 1e-12
pfam04652315 pfam04652, DUF605, Vta1 like 1e-12
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-12
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 3e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-12
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 3e-11
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 4e-11
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 5e-11
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 7e-11
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-11
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-10
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-10
pfam04652315 pfam04652, DUF605, Vta1 like 2e-10
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-10
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-10
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-10
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-10
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 4e-10
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 7e-10
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-09
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-09
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-09
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-08
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-08
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-08
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-08
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-08
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-08
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 6e-08
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 7e-08
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-07
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-07
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-07
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 3e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 3e-07
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-07
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 5e-07
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-07
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 6e-07
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 9e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 9e-07
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 9e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 1e-06
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-06
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
COG3147226 COG3147, DedD, Uncharacterized protein conserved i 1e-06
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 1e-06
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-06
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 2e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-06
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 3e-06
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 3e-06
PHA02682280 PHA02682, PHA02682, ORF080 virion core protein; Pr 4e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-06
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 5e-06
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 5e-06
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 5e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 6e-06
PRK12727 559 PRK12727, PRK12727, flagellar biosynthesis regulat 7e-06
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 8e-06
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 8e-06
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 9e-06
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-05
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 1e-05
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-05
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-05
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 1e-05
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 1e-05
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 1e-05
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 1e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-05
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 2e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-05
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-05
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 2e-05
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 2e-05
PRK09752 1250 PRK09752, PRK09752, adhesin; Provisional 2e-05
PHA03379 935 PHA03379, PHA03379, EBNA-3A; Provisional 2e-05
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 2e-05
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 2e-05
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-05
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 3e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-05
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-05
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 4e-05
PRK12727 559 PRK12727, PRK12727, flagellar biosynthesis regulat 4e-05
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 4e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-05
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 5e-05
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 5e-05
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 5e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 6e-05
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 6e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-05
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 6e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
pfam03326500 pfam03326, Herpes_TAF50, Herpesvirus transcription 7e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 8e-05
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 8e-05
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 8e-05
PRK09111598 PRK09111, PRK09111, DNA polymerase III subunits ga 8e-05
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 8e-05
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 9e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 9e-05
PRK12727 559 PRK12727, PRK12727, flagellar biosynthesis regulat 9e-05
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 9e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 9e-05
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 1e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 1e-04
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
PRK14954 620 PRK14954, PRK14954, DNA polymerase III subunits ga 1e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 1e-04
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 1e-04
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-04
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 1e-04
PLN03209 576 PLN03209, PLN03209, translocon at the inner envelo 1e-04
PRK12757256 PRK12757, PRK12757, cell division protein FtsN; Pr 1e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 2e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 2e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 2e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 2e-04
PHA03369 663 PHA03369, PHA03369, capsid maturational protease; 2e-04
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 2e-04
PHA03264416 PHA03264, PHA03264, envelope glycoprotein D; Provi 2e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 3e-04
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 3e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 3e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 3e-04
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 3e-04
PRK13729 475 PRK13729, PRK13729, conjugal transfer pilus assemb 3e-04
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 3e-04
PRK14959 624 PRK14959, PRK14959, DNA polymerase III subunits ga 3e-04
COG3147226 COG3147, DedD, Uncharacterized protein conserved i 4e-04
PTZ00436357 PTZ00436, PTZ00436, 60S ribosomal protein L19-like 4e-04
PRK08691 709 PRK08691, PRK08691, DNA polymerase III subunits ga 4e-04
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 4e-04
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 5e-04
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 5e-04
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 5e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 6e-04
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 6e-04
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 6e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 6e-04
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 6e-04
PHA033771000 PHA03377, PHA03377, EBNA-3C; Provisional 6e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 7e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 7e-04
PHA03369 663 PHA03369, PHA03369, capsid maturational protease; 7e-04
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 7e-04
PRK10905328 PRK10905, PRK10905, cell division protein DamX; Va 7e-04
COG3921 300 COG3921, COG3921, Uncharacterized protein conserve 7e-04
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 8e-04
PHA03379 935 PHA03379, PHA03379, EBNA-3A; Provisional 8e-04
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 8e-04
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 8e-04
pfam06070 777 pfam06070, Herpes_UL32, Herpesvirus large structur 8e-04
PHA02682280 PHA02682, PHA02682, ORF080 virion core protein; Pr 9e-04
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 9e-04
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 9e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.001
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 0.001
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.001
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 0.001
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.001
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 0.001
PHA03291 401 PHA03291, PHA03291, envelope glycoprotein I; Provi 0.001
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 0.001
pfam09483 185 pfam09483, HpaP, Type III secretion protein (HpaP) 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.002
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.002
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.002
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.002
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.002
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.002
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 0.002
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 0.002
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.002
PRK13729 475 PRK13729, PRK13729, conjugal transfer pilus assemb 0.002
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.002
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 0.002
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.002
pfam05466233 pfam05466, BASP1, Brain acid soluble protein 1 (BA 0.002
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 0.002
PTZ00441 576 PTZ00441, PTZ00441, sporozoite surface protein 2 ( 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 0.002
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 0.002
PRK06549130 PRK06549, PRK06549, acetyl-CoA carboxylase biotin 0.002
pfam12737 418 pfam12737, Mating_C, C-terminal domain of homeodom 0.002
PRK14949 944 PRK14949, PRK14949, DNA polymerase III subunits ga 0.002
PRK12799421 PRK12799, motB, flagellar motor protein MotB; Revi 0.002
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 0.003
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.003
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.003
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.003
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 0.003
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 0.003
pfam12868135 pfam12868, DUF3824, Domain of unknwon function (DU 0.003
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.004
pfam07223 357 pfam07223, DUF1421, Protein of unknown function (D 0.004
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 0.004
PTZ00449 943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.004
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 0.004
PLN02983274 PLN02983, PLN02983, biotin carboxyl carrier protei 0.004
PHA03291401 PHA03291, PHA03291, envelope glycoprotein I; Provi 0.004
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.004
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 0.004
pfam12526115 pfam12526, DUF3729, Protein of unknown function (D 0.004
PRK10856331 PRK10856, PRK10856, cytoskeletal protein RodZ; Pro 0.004
PRK00708209 PRK00708, PRK00708, sec-independent translocase; P 0.004
cd07219382 cd07219, Pat_PNPLA1, Patatin-like phospholipase do 0.004
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  118 bits (296), Expect = 8e-28
 Identities = 83/282 (29%), Positives = 135/282 (47%), Gaps = 17/282 (6%)

Query: 52  NEKHMLLSKHSRRPYIRTRLTRQGNWVGT-DVCSYYGVFCAPAPDNSNITVVAGIDLNGN 110
            E  +LLS  S    I   L    NW  + DVC + G+ C      +N + V  IDL+G 
Sbjct: 29  EELELLLSFKSS---INDPLKYLSNWNSSADVCLWQGITC------NNSSRVVSIDLSGK 79

Query: 111 DIAGYFPAELGWLSDLALFHVNSNRFCGIIPESL--SNWKLIYEFDVSNNRLVGSFPNVC 168
           +I+G   + +  L  +   ++++N+  G IP+ +  ++  L Y  ++SNN   GS P   
Sbjct: 80  NISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRY-LNLSNNNFTGSIPRGS 138

Query: 169 LSWTSLRYLDLRYNNFEGEVPREL-FKMKLDAIFLNNNRFSSWIPETIGE-STVSVVTFA 226
           +   +L  LDL  N   GE+P ++     L  + L  N     IP ++   +++  +T A
Sbjct: 139 IP--NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLA 196

Query: 227 HNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSF 286
            N   G +PR +G M ++  I L  N+L G +P EIG L  L   D   N+  G +P S 
Sbjct: 197 SNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL 256

Query: 287 SSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQG 328
            +L+++  L L  N+L+G +   I  L  + +   S N   G
Sbjct: 257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG 298


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional Back     alignment and domain information
>gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|217495 pfam03326, Herpes_TAF50, Herpesvirus transcription activation factor (transactivator) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|223029 PHA03264, PHA03264, envelope glycoprotein D; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236792 PRK10905, PRK10905, cell division protein DamX; Validated Back     alignment and domain information
>gnl|CDD|226435 COG3921, COG3921, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 Back     alignment and domain information
>gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|220260 pfam09483, HpaP, Type III secretion protein (HpaP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|218597 pfam05466, BASP1, Brain acid soluble protein 1 (BASP1 protein) Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|240420 PTZ00441, PTZ00441, sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 Back     alignment and domain information
>gnl|CDD|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) Back     alignment and domain information
>gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional Back     alignment and domain information
>gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|132858 cd07219, Pat_PNPLA1, Patatin-like phospholipase domain containing protein 1 Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 527
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PLN032101153 Resistant to P. syringae 6; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.42
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.42
PLN03150623 hypothetical protein; Provisional 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.36
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
PLN03150623 hypothetical protein; Provisional 99.18
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 99.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.04
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
PRK15386426 type III secretion protein GogB; Provisional 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
PRK15386426 type III secretion protein GogB; Provisional 97.53
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 97.53
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.1
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.06
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.01
KOG4341483 consensus F-box protein containing LRR [General fu 96.95
KOG4308478 consensus LRR-containing protein [Function unknown 96.63
KOG4308478 consensus LRR-containing protein [Function unknown 96.63
KOG4341483 consensus F-box protein containing LRR [General fu 96.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.88
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.78
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.26
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.44
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 92.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.45
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.32
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 89.96
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.79
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.6
smart0037026 LRR Leucine-rich repeats, outliers. 88.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.85
smart0037026 LRR Leucine-rich repeats, outliers. 86.85
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.75
PRK09718512 hypothetical protein; Validated 81.27
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.4e-33  Score=317.35  Aligned_cols=273  Identities=30%  Similarity=0.476  Sum_probs=183.2

Q ss_pred             CCCCC-CCCCccccceeeCCCCCCCCcceEEEEEcCCCCcCCCCccccCCCCCCCEEEccCCcccccccccc--------
Q 045837           74 QGNWV-GTDVCSYYGVFCAPAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIPESL--------  144 (527)
Q Consensus        74 ~~~w~-~~~~c~~~gv~c~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~i~~~~~~~~--------  144 (527)
                      +.+|. +.++|.|.|+.|..      ..+++.|+|++|.+.+.++..|..+++|++|+|++|++.+.++..+        
T Consensus        48 ~~~w~~~~~~c~w~gv~c~~------~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~  121 (968)
T PLN00113         48 LSNWNSSADVCLWQGITCNN------SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLR  121 (968)
T ss_pred             CCCCCCCCCCCcCcceecCC------CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCC
Confidence            34785 56899999999963      1245555555555555444445555555555555555544443332        


Q ss_pred             ---------------cCCCCCcEEEeecCcCcccCCcccccCCcccEEecccCCCCCCcchhhhc-cccchhhccccccc
Q 045837          145 ---------------SNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFK-MKLDAIFLNNNRFS  208 (527)
Q Consensus       145 ---------------~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~~~~~-~~L~~L~L~~n~l~  208 (527)
                                     +.+.+|++|+|++|.+.+.++..+..+.+|++|+|++|.+.+.++..+.. .+|++|+|++|.+.
T Consensus       122 ~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~  201 (968)
T PLN00113        122 YLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV  201 (968)
T ss_pred             EEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCc
Confidence                           23445555555555555555556666667777777777666666665554 56777777777776


Q ss_pred             cccccccCC-CCcceEeccCCcCCccCCCCCCCCCCCcEEEcccCCCCCCChhhccCCCCCCEEEccCCcccccCCcccC
Q 045837          209 SWIPETIGE-STVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFS  287 (527)
Q Consensus       209 ~~~~~~~~~-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~~~  287 (527)
                      +.++..++. .+|++|+|++|++.+.++..|+++.+|++|+|++|.+.+.++..++++++|++|+|++|++++.++..+.
T Consensus       202 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~  281 (968)
T PLN00113        202 GQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF  281 (968)
T ss_pred             CcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh
Confidence            666655543 4477777777777777777777777777777777777767777777777777777777777777777777


Q ss_pred             CCCCCcEEeccCCCCCCcchhhhhCCCCCcEEEecCcccCCCCCCCCCCCCCCceecCCCCCCCC
Q 045837          288 SLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNCLAQ  352 (527)
Q Consensus       288 ~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~  352 (527)
                      .+.+|++|+|++|.+.+.++..+.++.+|++|++++|.+.+..+..+..+.+|+.|++++|.+++
T Consensus       282 ~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~  346 (968)
T PLN00113        282 SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSG  346 (968)
T ss_pred             hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcC
Confidence            77777777777777777777777777777777777777777777777777788888888887764



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK09718 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-19
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-07
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 92.4 bits (228), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 72/234 (30%), Positives = 115/234 (49%), Gaps = 6/234 (2%) Query: 101 VVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNRFCGIIP-ESLSNWKLIYEFDVSNNR 159 + G+DL+GN G P G S L ++SN F G +P ++L + + D+S N Sbjct: 292 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 351 Query: 160 LVGSFPNVCLSWT-SLRYLDLRYNNFEGEVPRELF---KMKLDAIFLNNNRFSSWIPETI 215 G P + + SL LDL NNF G + L K L ++L NN F+ IP T+ Sbjct: 352 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL 411 Query: 216 GE-STVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDAS 274 S + + + N SG +P S+G++ + ++ L N L G +P E+ ++K L Sbjct: 412 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 471 Query: 275 SNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPNINNFTFSYNYFQG 328 N G +P S+ +++ + LS N+LTG + + I +L N+ S N F G Sbjct: 472 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG 525
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query527
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-42
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 7e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 6e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-12
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-12
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-10
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 5e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-09
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-08
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-12
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-12
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-08
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-07
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-12
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 9e-08
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-11
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 4e-11
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-09
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-09
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-09
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-07
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 2e-06
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 7e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-05
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 8e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-10
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-09
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 1e-09
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 4e-09
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 5e-09
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 1e-07
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 2e-06
2wvr_C 546 DNA replication factor CDT1; DNA replication licen 8e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-09
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 9e-09
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 6e-08
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 4e-09
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-07
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 6e-05
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-09
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 9e-09
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-07
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 4e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 1e-07
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 7e-07
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 6e-06
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-05
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 2e-07
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 1e-04
3iox_A497 AGI/II, PA; alpha helix, PPII helix, supersandwich 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 3e-06
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 1e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 1e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 1e-05
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 1e-05
1kxf_A 264 Sindbis virus capsid protein; chymotrypsin-like se 2e-04
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 2e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 5e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 7e-05
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 3e-05
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 4e-05
2yew_A 253 Capsid protein, coat protein; alphavirus, molecula 5e-05
2yew_A 253 Capsid protein, coat protein; alphavirus, molecula 6e-05
2yew_A 253 Capsid protein, coat protein; alphavirus, molecula 3e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 1e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 7e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-04
2es4_D 332 Lipase chaperone; protein-protein complex, steric 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 3e-04
2wd6_A349 Agglutinin receptor; cell adhesion, secreted, V-re 3e-04
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 4e-04
3vf0_A 283 Vinculin, metavinculin; cytoskeletal F-actin bindi 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  173 bits (441), Expect = 4e-50
 Identities = 63/277 (22%), Positives = 120/277 (43%), Gaps = 21/277 (7%)

Query: 76  NWV-GTDVC--SYYGVFCAPAPDNSNITVVAGIDLNGNDIAG--YFPAELGWLSDLALFH 130
           +W+  TD C  ++ GV C      +    V  +DL+G ++      P+ L  L  L   +
Sbjct: 26  SWLPTTDCCNRTWLGVLCDTD---TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLY 82

Query: 131 V-NSNRFCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVP 189
           +   N   G IP +++    ++   +++  + G+ P+      +L  LD  YN   G +P
Sbjct: 83  IGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLP 142

Query: 190 RELFKM-KLDAIFLNNNRFSSWIPETIGEST--VSVVTFAHNNFSGCVPRSIGNMPNVNE 246
             +  +  L  I  + NR S  IP++ G  +   + +T + N  +G +P +  N+ N+  
Sbjct: 143 PSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAF 201

Query: 247 IILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYV 306
           + LS N L G      G  K       + NS    +       ++++ L L  N++ G +
Sbjct: 202 VDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTL 260

Query: 307 SEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVF 343
            + + +L  +++   S+N   G     IP   +GG  
Sbjct: 261 PQGLTQLKFLHSLNVSFNNLCGE----IP---QGGNL 290


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2es4_D Lipase chaperone; protein-protein complex, steric chaperone, triacylglycerol hydrolase, all alpha helix protein, A/B hydrolase fold; 1.85A {Burkholderia glumae} SCOP: a.137.15.1 Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2wd6_A Agglutinin receptor; cell adhesion, secreted, V-region, cell WALL, AG I/II protei surface adhesin, peptidoglycan-anchor; 2.30A {Streptococcus gordonii} Length = 349 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>3vf0_A Vinculin, metavinculin; cytoskeletal F-actin binding protein, CEL adhesion-protein binding complex; HET: EPE; 2.54A {Homo sapiens} Length = 283 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.83
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.9
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.61
2w7z_A214 EFSQNR, pentapeptide repeat family protein; glutar 80.59
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.6e-37  Score=307.01  Aligned_cols=274  Identities=22%  Similarity=0.366  Sum_probs=246.5

Q ss_pred             CCCCC-CCCCcc--ccceeeCCCCCCCCcceEEEEEcCCCCcCC--CCccccCCCCCCCEEEccC-CcccccccccccCC
Q 045837           74 QGNWV-GTDVCS--YYGVFCAPAPDNSNITVVAGIDLNGNDIAG--YFPAELGWLSDLALFHVNS-NRFCGIIPESLSNW  147 (527)
Q Consensus        74 ~~~w~-~~~~c~--~~gv~c~~~~~~~~~~~L~~L~L~~n~l~~--~~~~~l~~l~~L~~L~Ls~-n~i~~~~~~~~~~l  147 (527)
                      +.+|. +.++|.  |.||.|...   ....+|++|+|++|.+.+  .++..|.++++|++|+|++ |++.+.++..|.++
T Consensus        24 l~~W~~~~~~C~~~w~gv~C~~~---~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l  100 (313)
T 1ogq_A           24 LSSWLPTTDCCNRTWLGVLCDTD---TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKL  100 (313)
T ss_dssp             GTTCCTTSCTTTTCSTTEEECCS---SSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGC
T ss_pred             ccCCCCCCCCCcCCCcceEeCCC---CCCceEEEEECCCCCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcC
Confidence            45785 567898  999999642   123689999999999998  8899999999999999995 99999999999999


Q ss_pred             CCCcEEEeecCcCcccCCcccccCCcccEEecccCCCCCCcchhhhc-cccchhhccccccccccccccCCC--CcceEe
Q 045837          148 KLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFK-MKLDAIFLNNNRFSSWIPETIGES--TVSVVT  224 (527)
Q Consensus       148 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~~~~~-~~L~~L~L~~n~l~~~~~~~~~~~--~L~~L~  224 (527)
                      .+|++|+|++|++++.++..|.++.+|++|+|++|.+++.++..+.. .+|++|+|++|++++.++..++..  +|++|+
T Consensus       101 ~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~  180 (313)
T 1ogq_A          101 TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMT  180 (313)
T ss_dssp             TTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEE
T ss_pred             CCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEE
Confidence            99999999999999999999999999999999999999888887766 799999999999998888777653  699999


Q ss_pred             ccCCcCCccCCCCCCCCCCCcEEEcccCCCCCCChhhccCCCCCCEEEccCCcccccCCcccCCCCCCcEEeccCCCCCC
Q 045837          225 FAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTG  304 (527)
Q Consensus       225 L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  304 (527)
                      +++|++.+.++..|..+. |++|+|++|.+++..+..|..+++|++|+|++|++++.++. +..+.+|++|+|++|+|++
T Consensus       181 L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~  258 (313)
T 1ogq_A          181 ISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYG  258 (313)
T ss_dssp             CCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEE
T ss_pred             CcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccC
Confidence            999999999999999987 99999999999989999999999999999999999977665 7888999999999999999


Q ss_pred             cchhhhhCCCCCcEEEecCcccCCCCCCCCCCCCCCceecCCCCC-CCCC
Q 045837          305 YVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNC-LAQR  353 (527)
Q Consensus       305 ~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~l~~N~-l~~~  353 (527)
                      .++..+..+++|++|+|++|++++.++.. ..+.+|+.+++++|. +++.
T Consensus       259 ~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~lc~~  307 (313)
T 1ogq_A          259 TLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             CCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEEST
T ss_pred             cCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCCCccCC
Confidence            99999999999999999999999888875 788999999999886 5543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2w7z_A EFSQNR, pentapeptide repeat family protein; glutaraldehyde, gyrase inhibitor, cyclic pentylation, chemic modification; HET: LP6; 1.60A {Enterococcus faecalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 527
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 76.6 bits (187), Expect = 5e-16
 Identities = 41/257 (15%), Positives = 79/257 (30%), Gaps = 13/257 (5%)

Query: 83  CSYYGVFCA-------PAPDNSNITVVAGIDLNGNDIAGYFPAELGWLSDLALFHVNSNR 135
           C    V C+       P     +  +   +DL  N I      +   L +L    + +N+
Sbjct: 10  CHLRVVQCSDLGLEKVPKDLPPDTAL---LDLQNNKITEIKDGDFKNLKNLHTLILINNK 66

Query: 136 FCGIIPESLSNWKLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFKM 195
              I P + +    +    +S N+L      +  +   LR  +         V   L +M
Sbjct: 67  ISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQM 126

Query: 196 KLDAIFLNNNRFSSWIPETIGESTVSVVTFAHNNFSGCVPRSIGNMPNVNEIILSNNDLM 255
            +  +  N  + S                   +     +P+ +   P++ E+ L  N + 
Sbjct: 127 IVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGL--PPSLTELHLDGNKIT 184

Query: 256 GCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTGYVSEQICKLPN 315
               + +  L  L     S NS       S ++   +  L L+ N+L             
Sbjct: 185 KVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGL-ADHKY 243

Query: 316 INNFTFSYNYFQGLGNE 332
           I       N    +G+ 
Sbjct: 244 IQVVYLHNNNISAIGSN 260


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query527
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.35
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=4.1e-35  Score=288.91  Aligned_cols=274  Identities=23%  Similarity=0.364  Sum_probs=242.8

Q ss_pred             CCCCC-CCCCcc--ccceeeCCCCCCCCcceEEEEEcCCCCcCCC--CccccCCCCCCCEEEccC-CcccccccccccCC
Q 045837           74 QGNWV-GTDVCS--YYGVFCAPAPDNSNITVVAGIDLNGNDIAGY--FPAELGWLSDLALFHVNS-NRFCGIIPESLSNW  147 (527)
Q Consensus        74 ~~~w~-~~~~c~--~~gv~c~~~~~~~~~~~L~~L~L~~n~l~~~--~~~~l~~l~~L~~L~Ls~-n~i~~~~~~~~~~l  147 (527)
                      +.+|. +.|+|.  |.||+|+..   ....+|+.|+|+++++.+.  ++..++++++|++|+|++ |++.|.+|..|+++
T Consensus        24 l~sW~~~~d~C~~~w~gv~C~~~---~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L  100 (313)
T d1ogqa_          24 LSSWLPTTDCCNRTWLGVLCDTD---TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKL  100 (313)
T ss_dssp             GTTCCTTSCTTTTCSTTEEECCS---SSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGC
T ss_pred             CCCCCCCCCCCCCcCCCeEEeCC---CCcEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccc
Confidence            45784 778995  999999752   3445899999999999874  678999999999999997 89999999999999


Q ss_pred             CCCcEEEeecCcCcccCCcccccCCcccEEecccCCCCCCcchhhhc-cccchhhccccccccccccccCC-CC-cceEe
Q 045837          148 KLIYEFDVSNNRLVGSFPNVCLSWTSLRYLDLRYNNFEGEVPRELFK-MKLDAIFLNNNRFSSWIPETIGE-ST-VSVVT  224 (527)
Q Consensus       148 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~~~~~-~~L~~L~L~~n~l~~~~~~~~~~-~~-L~~L~  224 (527)
                      .+|++|+|++|++.+..+..+..+.+|+++++++|.+.+.++..+.. .+++++++++|.+.+.++..++. .. ++.++
T Consensus       101 ~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~  180 (313)
T d1ogqa_         101 TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMT  180 (313)
T ss_dssp             TTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEE
T ss_pred             cccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccc
Confidence            99999999999999988888999999999999999999888888777 68999999999999888877654 33 58899


Q ss_pred             ccCCcCCccCCCCCCCCCCCcEEEcccCCCCCCChhhccCCCCCCEEEccCCcccccCCcccCCCCCCcEEeccCCCCCC
Q 045837          225 FAHNNFSGCVPRSIGNMPNVNEIILSNNDLMGCLPSEIGWLKKLTVFDASSNSFYGSVPQSFSSLESIHRLVLSYNQLTG  304 (527)
Q Consensus       225 L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  304 (527)
                      +++|++.+..+..+..+.. .+++++++.+.+.++..+..+.+|+.|++++|.+.+.++ .+..+.+|++|+|++|+|+|
T Consensus       181 ~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g  258 (313)
T d1ogqa_         181 ISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYG  258 (313)
T ss_dssp             CCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEE
T ss_pred             ccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecc
Confidence            9999999988888888754 479999999999999999999999999999999997765 68888999999999999999


Q ss_pred             cchhhhhCCCCCcEEEecCcccCCCCCCCCCCCCCCceecCCCCC-CCCC
Q 045837          305 YVSEQICKLPNINNFTFSYNYFQGLGNECIPGSKEGGVFDDTSNC-LAQR  353 (527)
Q Consensus       305 ~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~l~~N~-l~~~  353 (527)
                      .+|..|+++++|++|+|++|+|+|.+|. +..+.+|+.+++++|. +++.
T Consensus       259 ~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         259 TLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             CCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEEST
T ss_pred             cCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCC
Confidence            9999999999999999999999988875 5778899999999996 5543



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure