Citrus Sinensis ID: 045843

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910---
MEAVAAQAAAQAAGSLVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEEEEEcccHHHHHHcccEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccEEccccEEEEcHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHccEEEEEcccccccccccccccEEEEEccccccccccHHHHcccccccEEEccccccccccccccccccccEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccHHHHccccccccHHHHHHHHHHcHHHHcccccccccccccccccccccEEEEEcccccEEEEccccccccccccccEEEEcccccccccccccccccccccccEEEEcccccccccccHHHHcccccccEEEEEcccccHHHHcccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEccccccccccccHHHHcccccccEEc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEcccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccccHcccccEEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHccccccccccEEEEEEccHHHHHHcccccEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHcccccccccHHHHHccHHcccHHHHHHHHEHEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHccccEEEEEcccccccccccccHHHEEEEccccccccccccccccccEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccHHcccHHHcccccccEEEEcccccEEccccccHHHHHHHHHHHccHHHHHcccccccccccHHHHHHHccccHccccccccccccccHHHHHcHHcHHHHHHHHHHHccccccHcHcccHcHHHHccccccccccccEEEEcccccHHcccHHHHccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccHcccccccEEEEccccccEEccHccccccccccccccEEEEcccHcHHHcccccccccccccEEEEcccccHcccccccccccccEEEEccHccHHHcccccHHHHHHccccccEc
MEAVAAQAAAQAAGslvgpaveggtgilhCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSthkflcgicpfpsllQLGKQIVKLTAEVVSLRKQIGQIAIMvekapvpvIKKHAKKMEEVPSLNKHLKMLQECLRNVgtkriciwgppgvgktTIMENLHDaigesrqfdFIFWVTVNSEGNIRDIQEVLLKRLDlraedhniDQRADMISEELKDKSYVLFLDEVsteinlrdigihdehkngKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGvqlkdcrdiKPVARLIINECGGMPHMIKLIGSslanvsnpAIWRDMLSqlrspsmapkQELEEVYKSFKLVCdklpsdkqlCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLstlpkrpkcCRILTLLLQesslaelpasfFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCqlmrlpaevgdlhnleildlshtgicclpseidlttlcfyfpnvgllQNFINaskswngnsnfRSFSILVGynqrssphmefdfsgcsaekylrfadgegfPDAVVKILEQACAFELIGhrtaanlsdfgankfgdvEACIVEDCNEMISIIdgnltegvtfqHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAgsavdsrafpklksfqlinlpklssICHNMSLAWPLLETITIKACdelrnfpstieNASKLRGIQcnqawwsslvwpndhvrdHFQNFCQFI
MEAVAAQAAAQaagslvgpavegGTGILHCLKRKYLYVKNMSKnlrnlereekylcdeeadvktrlernklkmeksrrcetwlneverMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINlrdigihdehknGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVgvqlkdcrdiKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAgsavdsrafpKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
MEavaaqaaaqaaGSLVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKeeekiseeeweVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTkikllpssisslTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
***************LVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLE***KYLC**********************CETWLNEVE*****IETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKK**EVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDML***************EVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQF*
MEAVAAQAAAQAAGSLVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRK*******************************KHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLD**************ISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRS**********EVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
***************LVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
MEAVA**AAAQAAGSLVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIG*********************EEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVAAQAAAQAAGSLVGPAVEGGTGILHCLKRKYLYxxxxxxxxxxxxxxxxxxxxxEADVKTRLERNKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSSTHKFLCGICPFPSxxxxxxxxxxxxxxxxxxxxxIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQESSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFCQFI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query913 2.2.26 [Sep-21-2011]
Q42484909 Disease resistance protei yes no 0.807 0.810 0.255 6e-52
Q9T048985 Disease resistance protei no no 0.847 0.785 0.232 1e-46
Q8RXS5888 Probable disease resistan no no 0.642 0.661 0.272 4e-46
Q9LVT4843 Probable disease resistan no no 0.613 0.664 0.276 5e-46
Q9FG91848 Probable disease resistan no no 0.646 0.695 0.270 3e-44
Q8L3R3885 Disease resistance protei no no 0.615 0.635 0.274 3e-44
O81825919 Probable disease resistan no no 0.606 0.602 0.287 8e-43
Q9C8K0854 Probable disease resistan no no 0.627 0.670 0.267 9e-43
Q9LMP6851 Probable disease resistan no no 0.634 0.680 0.267 1e-42
P60838894 Probable disease resistan no no 0.618 0.631 0.278 2e-42
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (525), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 206/806 (25%), Positives = 373/806 (46%), Gaps = 69/806 (8%)

Query: 121 KQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVG 180
           K I +L     +++   G I +   + P+  +  +   ME+V        + +E  R + 
Sbjct: 124 KSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEF-----LSEEEERGI- 177

Query: 181 TKRICIWGPPGVGKTTIMENLHDA-IGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLR 239
              I ++GP GVGKTT+M+++++  I +  Q+D + WV ++ E     IQ+ +  RL L 
Sbjct: 178 ---IGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLS 234

Query: 240 AEDHNI-DQRADMISEELKDKSYVLFLDEVSTEINLRDIGIH--DEHKNGKVVFACIFRN 296
            ++    + RA  I   L+ K ++L LD+V  EI+L   G+   D     KV+F      
Sbjct: 235 WDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIA 294

Query: 297 ICGQIDEE--VNVQRLSGKDAQKLFWETVGVQ-LKDCRDIKPVARLIINECGGMPHMIKL 353
           +C  +  E  + V+ L  K A +LF   V  + L +   I+ +A +I+++CGG+P  +  
Sbjct: 295 LCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALIT 354

Query: 354 IGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDK-QLCLLYWAI 412
           +G ++A+      W    S++ +   A  + +  V+   K   D L SD  + C LY A+
Sbjct: 355 LGGAMAHRETEEEWIHA-SEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCAL 413

Query: 413 FPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMF 472
           FP  + +  + ++E W  E F      +     +G  ++ +     LLE G + +  KM 
Sbjct: 414 FPEEHSIEIEQLVEYWVGEGFLTSSHGVNTIY-KGYFLIGDLKAACLLETGDEKTQVKMH 472

Query: 473 EHFQRAALRIANHDENSFKILVKEE------EKISEEEWEVANRISLIRMCLSTLPKRPK 526
              +  AL +A+ ++ ++K L+  E      E    E W  A  ISL+   + TLP++  
Sbjct: 473 NVVRSFALWMAS-EQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLI 531

Query: 527 CCRILTLLLQE-SSLAELPASFFGYMCSLQLLDLHDTKIKLLPSSISSLTNLKALFLNNC 585
           C ++ TL+LQ+ SSL ++P  FF +M  L++LDL  T I  +P SI  L  L  L ++  
Sbjct: 532 CPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSG- 590

Query: 586 CQLMRLPAEVGDLHNLEILDLSHT---------GICCLPSEIDLTTLCFYFPNVGL-LQN 635
            ++  LP E+G+L  L+ LDL  T          IC L     L  L  Y+   G  LQ+
Sbjct: 591 TKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSK---LEVLNLYYSYAGWELQS 647

Query: 636 FINASKSWNGNSNFRSFSIL--VGYNQRSSPHMEFDFSGCSAEKYLRFADGEGFPDAVVK 693
           F        G ++      L  +G    S   ++  F   +  K+++           V+
Sbjct: 648 FGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLH--------VE 699

Query: 694 ILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGNLTEGVTFQHLKK 753
              +   F L       +L++ G N    +    ++ C+++  ++     E      L+ 
Sbjct: 700 ECNELLYFNL------PSLTNHGRN----LRRLSIKSCHDLEYLVTPADFENDWLPSLEV 749

Query: 754 LHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCK 813
           L +  L  L  +W  S+    L  +  + +  C+ +K +     + +L +++ +++ DC+
Sbjct: 750 LTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNV---SWVQKLPKLEVIELFDCR 806

Query: 814 EMEEII---EAGSAVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLETITIKACDELR 870
           E+EE+I   E+ S  D   FP LK+ +  +LP+L+SI  +   ++  +ET+ I  C  ++
Sbjct: 807 EIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPS-RFSFQKVETLVITNCPRVK 865

Query: 871 NFP-STIENASKLRGIQCNQAWWSSL 895
             P         L  + C + WW +L
Sbjct: 866 KLPFQERRTQMNLPTVYCEEKWWKAL 891
Disease resistance (R) protein that specifically recognizes the AvrRpt2 type III effector avirulence protein from Pseudomonas syringae. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Acts via its interaction with RIN4, and probably triggers the plant resistance when RIN4 is degraded by AvrRpt2.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8K0|DRL5_ARATH Probable disease resistance protein At1g51480 OS=Arabidopsis thaliana GN=At1g51480 PE=2 SV=2 Back     alignment and function description
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query913
297739493982 unnamed protein product [Vitis vinifera] 0.946 0.879 0.317 1e-117
147790050928 hypothetical protein VITISV_010159 [Viti 0.928 0.913 0.315 1e-115
147779179984 hypothetical protein VITISV_043194 [Viti 0.955 0.886 0.323 1e-107
1477789221001 hypothetical protein VITISV_020980 [Viti 0.971 0.886 0.312 1e-104
297739495979 unnamed protein product [Vitis vinifera] 0.959 0.894 0.306 2e-97
147798654 1864 hypothetical protein VITISV_038474 [Viti 0.904 0.443 0.292 5e-88
297739496966 unnamed protein product [Vitis vinifera] 0.621 0.586 0.336 9e-78
147808040 1257 hypothetical protein VITISV_033093 [Viti 0.900 0.653 0.295 4e-76
297739476 1781 unnamed protein product [Vitis vinifera] 0.622 0.318 0.332 9e-69
224124220991 cc-nbs-lrr resistance protein [Populus t 0.947 0.872 0.249 1e-67
>gi|297739493|emb|CBI29675.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  429 bits (1103), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 302/951 (31%), Positives = 497/951 (52%), Gaps = 87/951 (9%)

Query: 40  NMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEIETLKSS 99
           ++  N + L +E K L      ++T + ++++    +     W+ +V+ ++ E++ LK+ 
Sbjct: 36  DLKGNYKRLRQEAKKLKAIRDAIETEISKDRI----TPATREWIAKVKMIESEVKELKTK 91

Query: 100 YSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAI--MVEKAPVPVIKKHAK 157
           Y +       +    +  +L   + +   +V SL ++ G +    +  + P PV K+HA 
Sbjct: 92  YKNEMGHPWRLVRIWAYARLSTDVAEKYNQVHSLWEE-GNLKREELDAELPEPVRKRHAP 150

Query: 158 KMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIGESRQFDFIFWV 217
           ++EE  +L+  ++ +   L +   +RI +WG  G GKTTIM+NL++    ++ FD + WV
Sbjct: 151 RIEENSALHMAVQEILSFLEDEQIQRIGVWGTVGTGKTTIMQNLNNHEQIAKMFDIVIWV 210

Query: 218 TVNSEGNIRDIQEVLLKRLDLRAEDH-NIDQRADMISEELKDKSYVLFLDEVSTEINLRD 276
           TV+ E +I  +Q+ ++++L L  E   +I++ A  ISEELK+K Y++ LDEV   I+L  
Sbjct: 211 TVSKEWSIEKLQDAIMRQLKLDMERFADIEENARRISEELKEKKYLVLLDEVQENIDLNA 270

Query: 277 IGIHDEHKNGKVVFACIFRNICGQI--DEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIK 334
           +     +++ KVV A   R +C ++  DE +NV+RLS  DA  +F E VG  +     IK
Sbjct: 271 VMGIPNNQDSKVVLASRNRCVCYEMEADELINVKRLSPADAWNMFQEKVGHPISSPL-IK 329

Query: 335 PVARLIINECGGMPHMIKLIGSSLANVS-NPAIWRDMLSQLRSPSMAPKQELEEVYKSFK 393
           P+A  ++ EC G+P +I  IG +      + ++WRD L++LR       + ++EV    K
Sbjct: 330 PIAEQVVKECDGLPLLIDRIGRTFRKKGKDVSLWRDGLNRLRRWESVKTEGMDEVLDFLK 389

Query: 394 LVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKL-------GEARDR 446
              ++L  +K+ C LY A++P   E++ DY++ECW AE       +L        +ARD+
Sbjct: 390 FCYEELDRNKKDCFLYGALYPEECEIYIDYLLECWNAEGLIHDADELVDNTNVFRDARDK 449

Query: 447 GQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRIANHDENSFKILVKEEEKISE---- 502
           G +ILD  +  SLLE+  +    KM +  ++ AL+I++   N  K LVK  E + +    
Sbjct: 450 GHAILDALIDVSLLERSDEKKCVKMNKVLRKMALKISSQS-NGSKFLVKPCEGLQDFPDR 508

Query: 503 EEWEVANRISLIRMCLSTLPKRPKCCRILTLLLQ-ESSLAELPASFFGYMCSLQLLDLHD 561
           +EWE A+RISL+   L TLP+   C  + TLLLQ  + L  +P  FF  M SL++LDLH 
Sbjct: 509 KEWEDASRISLMGNQLCTLPEFLHCHNLSTLLLQMNNGLIAIPEFFFESMRSLRVLDLHG 568

Query: 562 TKIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGIC--------- 612
           T I+ LPSSIS L  L+ L+LN+C  L++LP  +  L  LE+LD+  T +          
Sbjct: 569 TGIESLPSSISYLICLRGLYLNSCPHLIQLPPNMRALEQLEVLDIRGTKLNLLQIGSLIW 628

Query: 613 --CLPSEI-----------------------------DLTTLCFYFPNVGLLQNFINASK 641
             CL   +                             DL+  C+    + +++  +   K
Sbjct: 629 LKCLRISLSSFFRGIRTQRQLGSISAFVSLEEFCVDDDLSEQCWDEFLMIVMEEVVTLKK 688

Query: 642 SWNGNSNFRSFSILVGYNQRSSPHME---FDFSGC---SAEKYLRFADGEGFPD------ 689
             +    F +   L  + QRS    +   F F  C       Y +  +   +P       
Sbjct: 689 LTSLRFCFPTVDFLKLFVQRSPVWKKNSCFTFQFCVGYQGNTYSQILESSDYPSYNCLKL 748

Query: 690 --------AVVKILEQACAFELIGHRTAANLSDFGANKFGDVEACIVEDCNEMISIIDGN 741
                    + ++L    AF+LI H+  + LSDFG N   ++  C VE CNE+ +I+ G+
Sbjct: 749 VNGEGMHPVIAEVLRMTHAFKLINHKGVSTLSDFGVNNMENMLVCSVEGCNEIRTIVCGD 808

Query: 742 LTEGVTFQHLKKLHISHLPKLMHIWKGSIQSGSLIMLETLILKRCHGMKTLFSEEIIFQL 801
                  ++L+ L+I+ + KL  IW+GSI +GSL  L TL L +C  +K +FS  +I QL
Sbjct: 809 RMASSVLENLEVLNINSVLKLRSIWQGSIPNGSLAQLTTLTLTKCPELKKIFSNGMIQQL 868

Query: 802 NQIQYLQVEDCKEMEEIIEAGS--AVDSRAFPKLKSFQLINLPKLSSICHNMSLAWPLLE 859
            ++Q+L+VE+C  +EEII       ++  A P+LK+  LI+LP+L SI  + SL WP L+
Sbjct: 869 PELQHLRVEECNRIEEIIMESENLELEVNALPRLKTLVLIDLPRLRSIWIDDSLEWPSLQ 928

Query: 860 TITIKACDELRNFPSTIENASKLRGIQCNQAWWSSLVWPNDHVRDHFQNFC 910
            I I  C  L+  P +  NA KLR I+  Q+WW +LVW +D  + +  +FC
Sbjct: 929 RIQIATCHMLKRLPFSNTNALKLRLIEGQQSWWEALVWEDDAFKQNLHSFC 979

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147790050|emb|CAN60524.1| hypothetical protein VITISV_010159 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147779179|emb|CAN71735.1| hypothetical protein VITISV_043194 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147778922|emb|CAN64818.1| hypothetical protein VITISV_020980 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739495|emb|CBI29677.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147798654|emb|CAN63327.1| hypothetical protein VITISV_038474 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739496|emb|CBI29678.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147808040|emb|CAN62149.1| hypothetical protein VITISV_033093 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739476|emb|CBI29658.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124220|ref|XP_002319275.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857651|gb|EEE95198.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query913
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.622 0.576 0.258 9.8e-51
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.627 0.645 0.260 1.4e-50
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.622 0.641 0.260 5.6e-50
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.618 0.614 0.27 8.4e-50
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.636 0.646 0.258 7.3e-49
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.884 0.888 0.237 7.5e-49
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.639 0.603 0.263 1.1e-48
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.618 0.631 0.267 1.7e-48
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.657 0.707 0.264 1e-45
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.619 0.597 0.262 4e-45
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 466 (169.1 bits), Expect = 9.8e-51, Sum P(2) = 9.8e-51
 Identities = 156/604 (25%), Positives = 293/604 (48%)

Query:    37 YVKNMSKNLRNLEREEKYLCDEEADVKTRLERNK-LKMEKSRRCETWLNEVERMKDEIET 95
             +  N+     +LER  +   +   D +T L ++K L+++  R    W  E E    E+ +
Sbjct:    29 FKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMR----WQREAE----EVIS 80

Query:    96 LKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMVEKAPVPVIKKH 155
              K+      +  CG+   P   ++ +++VK+  EV  L K   +   M+     P   +H
Sbjct:    81 -KARLKLEERVSCGMSLRP---RMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEH 136

Query:   156 AKKMEEVPSL--NKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAI---GESRQ 210
                +  V     +  L  +++ L +   ++I +WG  GVGKTT++  L++ +   G ++ 
Sbjct:   137 VPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQP 196

Query:   211 FDFIFWVTVNSEGNIRDIQEVLLKRLDLRAEDHNIDQR-ADMISEEL-KDKSYVLFLDEV 268
             F  + +V V+ E + R++Q+ + +RLD+  +    +++ A  I   L K++ ++L LD+V
Sbjct:   197 FGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDV 256

Query:   269 STEINLRDIGIH--DEHKNGKVVFACIFRNICGQI--DEEVNVQRLSGKDAQKLFWETVG 324
                I+L  +GI   +E+K  KV+    F  +C  +  D +V V  L  +DA +LF +  G
Sbjct:   257 WKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAG 316

Query:   325 VQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQE 384
               ++    ++ +A+ +  ECGG+P  I  +G+++    N  +W  +LS+L S S+   + 
Sbjct:   317 DVVRSDH-VRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKL-SKSVPWIKS 374

Query:   385 LEE-VYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEA 443
             +EE +++  KL  D L    + C L  A+FP  Y +    ++  W AE F   L    ++
Sbjct:   375 IEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDS 434

Query:   444 RDRGQSILDEFVKKSLLEKGRKASHYKMFEHFQRAALRI-ANHDENSFKILVKXXXXXXX 502
              + G + ++      LLE G +    KM +  +  A+ I ++  ++S  +++        
Sbjct:   435 MNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDI 494

Query:   503 XXXXVA---NRISLIRMCLSTLPKRPK--CCRILTLLLQESSLA-ELPASFFGYMCSLQL 556
                 +A    R+SL+   L +LP   +  C +   LLLQ + L  E+P  F     +L++
Sbjct:   495 RQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRI 554

Query:   557 LDLHDTXXXXXXXXXXXXT-NLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLP 615
             L+L  T              +L +LFL +C +L++LP+ +  L  LE+LDL  T I   P
Sbjct:   555 LNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPS-LETLAKLELLDLCGTHILEFP 613

Query:   616 SEID 619
               ++
Sbjct:   614 RGLE 617
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035309001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (835 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query913
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-38
pfam13401124 pfam13401, AAA_22, AAA domain 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
pfam13173127 pfam13173, AAA_14, AAA domain 2e-05
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 3e-04
pfam00910105 pfam00910, RNA_helicase, RNA helicase 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN032101153 PLN03210, PLN03210, Resistant to P 0.002
PRK13342413 PRK13342, PRK13342, recombination factor protein R 0.002
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 0.002
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  144 bits (366), Expect = 2e-38
 Identities = 75/257 (29%), Positives = 124/257 (48%), Gaps = 10/257 (3%)

Query: 186 IWGPPGVGKTTIMENLHDAIGESRQFDFIFWVTVNSEGNIRDIQEVLLKRLDLRAED--- 242
           I G  GVGKTT+ + +++       FD + WV V+       +Q+ +L+ L L   D   
Sbjct: 24  IVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVE 83

Query: 243 HNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGI--HDEHKNGKVVFACIFRNIC-- 298
            N  + A  I E L  K ++L LD+V  + +   IG+   D     +V+      ++   
Sbjct: 84  KNESELAVKIKEALLRKRFLLVLDDVWEKNDWDKIGVPFPDGENGSRVIVTTRSESVAGR 143

Query: 299 -GQIDEEVNVQRLSGKDAQKLFWETVGV-QLKDCRDIKPVARLIINECGGMPHMIKLIGS 356
            G   +   V+ L  +++ +LF   V   +L  C +++ VA+ I+ +C G+P  +K++G 
Sbjct: 144 MGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGG 203

Query: 357 SLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKLPSDKQLCLLYWAIFPVG 416
            LA  S    W  +L QL    +A +  L EV     L  D LP   + C LY A+FP  
Sbjct: 204 LLAFKSTVQEWEHVLEQLN-NELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPED 262

Query: 417 YELHEDYIIECWRAEQF 433
           Y + ++ +I+ W AE F
Sbjct: 263 YNIRKEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|221955 pfam13173, AAA_14, AAA domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 913
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.72
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.47
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.32
PRK04841 903 transcriptional regulator MalT; Provisional 99.3
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.26
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.24
KOG0617264 consensus Ras suppressor protein (contains leucine 99.22
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.22
KOG0617264 consensus Ras suppressor protein (contains leucine 99.17
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.13
KOG4237498 consensus Extracellular matrix protein slit, conta 99.12
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.11
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.1
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.02
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.92
PF05729166 NACHT: NACHT domain 98.89
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.83
PRK13342413 recombination factor protein RarA; Reviewed 98.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.79
PRK06893229 DNA replication initiation factor; Validated 98.76
COG2255332 RuvB Holliday junction resolvasome, helicase subun 98.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.71
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.65
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
PTZ001121164 origin recognition complex 1 protein; Provisional 98.58
PRK04195482 replication factor C large subunit; Provisional 98.55
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 98.53
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.52
KOG4341483 consensus F-box protein containing LRR [General fu 98.52
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.5
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 98.49
PTZ00202550 tuzin; Provisional 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
PRK12402337 replication factor C small subunit 2; Reviewed 98.39
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.38
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.37
cd01128249 rho_factor Transcription termination factor rho is 98.37
PLN03025319 replication factor C subunit; Provisional 98.36
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.36
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 98.35
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.34
PF13173128 AAA_14: AAA domain 98.34
KOG2028554 consensus ATPase related to the helicase subunit o 98.32
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.31
PRK09376416 rho transcription termination factor Rho; Provisio 98.31
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.3
PRK05564313 DNA polymerase III subunit delta'; Validated 98.29
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.29
PLN03150623 hypothetical protein; Provisional 98.29
PRK00440319 rfc replication factor C small subunit; Reviewed 98.29
PRK13341725 recombination factor protein RarA/unknown domain f 98.28
PRK08727233 hypothetical protein; Validated 98.27
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 98.27
PRK09087226 hypothetical protein; Validated 98.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.23
PRK08084235 DNA replication initiation factor; Provisional 98.23
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 98.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.19
COG3899849 Predicted ATPase [General function prediction only 98.17
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 98.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.16
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 98.15
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 98.13
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.12
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 98.11
PRK15386426 type III secretion protein GogB; Provisional 98.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.08
PRK07940394 DNA polymerase III subunit delta'; Validated 98.06
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 98.06
PRK07471365 DNA polymerase III subunit delta'; Validated 98.04
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 98.04
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.04
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.03
KOG4341483 consensus F-box protein containing LRR [General fu 98.03
PRK05642234 DNA replication initiation factor; Validated 98.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.02
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 98.02
PRK14087450 dnaA chromosomal replication initiation protein; P 98.01
PLN03150623 hypothetical protein; Provisional 98.01
PRK08903227 DnaA regulatory inactivator Hda; Validated 98.0
TIGR00767415 rho transcription termination factor Rho. Members 97.99
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.99
PRK09112351 DNA polymerase III subunit delta'; Validated 97.99
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.97
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.95
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.95
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.94
COG3903414 Predicted ATPase [General function prediction only 97.94
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.93
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.91
PRK03992389 proteasome-activating nucleotidase; Provisional 97.9
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.88
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.87
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.86
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.86
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.84
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.84
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.84
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.83
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.81
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.81
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.8
KOG2543438 consensus Origin recognition complex, subunit 5 [R 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
PHA02544316 44 clamp loader, small subunit; Provisional 97.8
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.79
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.78
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.78
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.77
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.77
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.76
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.74
PRK15386426 type III secretion protein GogB; Provisional 97.72
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.71
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.71
PF14516331 AAA_35: AAA-like domain 97.71
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.7
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.69
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 97.67
PRK00149450 dnaA chromosomal replication initiation protein; R 97.67
CHL00095821 clpC Clp protease ATP binding subunit 97.64
PRK06620214 hypothetical protein; Validated 97.64
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 97.62
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.62
CHL00181287 cbbX CbbX; Provisional 97.6
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.59
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.59
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.59
PRK14088440 dnaA chromosomal replication initiation protein; P 97.57
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.55
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.53
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 97.49
PRK14086617 dnaA chromosomal replication initiation protein; P 97.48
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.47
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.47
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.46
smart00382148 AAA ATPases associated with a variety of cellular 97.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.43
PRK12422445 chromosomal replication initiation protein; Provis 97.43
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.42
CHL00176638 ftsH cell division protein; Validated 97.41
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.38
PRK08118167 topology modulation protein; Reviewed 97.34
PRK10865857 protein disaggregation chaperone; Provisional 97.33
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.32
PRK07399314 DNA polymerase III subunit delta'; Validated 97.32
COG0593408 DnaA ATPase involved in DNA replication initiation 97.31
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 97.3
PRK08116268 hypothetical protein; Validated 97.29
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 97.29
PRK08181269 transposase; Validated 97.26
PRK10536262 hypothetical protein; Provisional 97.22
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 97.19
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.18
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 97.18
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 97.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.14
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.13
PF00004132 AAA: ATPase family associated with various cellula 97.08
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.08
PRK05707328 DNA polymerase III subunit delta'; Validated 97.04
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.01
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.98
PRK12377248 putative replication protein; Provisional 96.98
PRK07261171 topology modulation protein; Provisional 96.93
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.91
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.85
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 96.85
PRK12608380 transcription termination factor Rho; Provisional 96.83
PRK08769319 DNA polymerase III subunit delta'; Validated 96.78
CHL00195489 ycf46 Ycf46; Provisional 96.77
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.72
PRK06835329 DNA replication protein DnaC; Validated 96.69
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.68
PHA00729226 NTP-binding motif containing protein 96.63
PRK10865857 protein disaggregation chaperone; Provisional 96.62
PRK06526254 transposase; Provisional 96.62
PRK08058329 DNA polymerase III subunit delta'; Validated 96.61
COG1136226 SalX ABC-type antimicrobial peptide transport syst 96.6
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.54
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.53
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.53
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.52
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.51
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.48
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.48
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.47
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.46
PRK07952244 DNA replication protein DnaC; Validated 96.45
PRK06921266 hypothetical protein; Provisional 96.45
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.44
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.42
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.42
COG2884223 FtsE Predicted ATPase involved in cell division [C 96.38
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.36
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.35
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 96.34
TIGR02237209 recomb_radB DNA repair and recombination protein R 96.34
PRK06871325 DNA polymerase III subunit delta'; Validated 96.34
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.33
PRK08939306 primosomal protein DnaI; Reviewed 96.33
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.31
PRK05541176 adenylylsulfate kinase; Provisional 96.3
PTZ00494664 tuzin-like protein; Provisional 96.29
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.27
KOG2228408 consensus Origin recognition complex, subunit 4 [R 96.25
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 96.24
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.24
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.22
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.21
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.21
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.21
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.17
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.15
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.15
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.12
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.12
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.11
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.11
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.1
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.1
PRK04296190 thymidine kinase; Provisional 96.09
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 96.08
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.08
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.08
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 96.08
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.07
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.04
KOG1969877 consensus DNA replication checkpoint protein CHL12 96.01
PRK13695174 putative NTPase; Provisional 96.0
PRK04132846 replication factor C small subunit; Provisional 96.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.0
PRK09183259 transposase/IS protein; Provisional 95.97
cd03246173 ABCC_Protease_Secretion This family represents the 95.96
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.93
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.91
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.87
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.86
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.86
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 95.86
PRK06696223 uridine kinase; Validated 95.85
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.84
PRK06090319 DNA polymerase III subunit delta'; Validated 95.81
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.81
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.79
cd01394218 radB RadB. The archaeal protein radB shares simila 95.76
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.76
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 95.74
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.7
PRK15455644 PrkA family serine protein kinase; Provisional 95.66
TIGR00959428 ffh signal recognition particle protein. This mode 95.66
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.65
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 95.63
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 95.57
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.56
PRK06547172 hypothetical protein; Provisional 95.53
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 95.53
cd00983325 recA RecA is a bacterial enzyme which has roles in 95.51
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.51
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 95.5
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 95.49
PRK08233182 hypothetical protein; Provisional 95.49
PRK10867433 signal recognition particle protein; Provisional 95.48
PRK09354349 recA recombinase A; Provisional 95.47
PRK00771437 signal recognition particle protein Srp54; Provisi 95.46
PRK07993334 DNA polymerase III subunit delta'; Validated 95.45
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.43
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.43
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.43
KOG0731774 consensus AAA+-type ATPase containing the peptidas 95.43
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.42
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.42
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.41
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.4
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.4
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.39
PRK06964342 DNA polymerase III subunit delta'; Validated 95.37
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.35
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.33
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 95.32
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 95.32
KOG1514767 consensus Origin recognition complex, subunit 1, a 95.31
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 95.31
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 95.3
cd03115173 SRP The signal recognition particle (SRP) mediates 95.29
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.29
PRK08699325 DNA polymerase III subunit delta'; Validated 95.29
PF00154322 RecA: recA bacterial DNA recombination protein; In 95.28
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 95.26
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 95.25
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.24
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.24
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 95.22
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.15
COG0488530 Uup ATPase components of ABC transporters with dup 95.08
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 95.08
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.06
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 95.06
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 95.05
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 95.04
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.04
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.04
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.03
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 95.02
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 95.02
COG4618580 ArpD ABC-type protease/lipase transport system, AT 95.01
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.97
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.96
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.96
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 94.96
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 94.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.93
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 94.92
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.92
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 94.91
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.91
PRK15064530 ABC transporter ATP-binding protein; Provisional 94.89
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.88
PRK07667193 uridine kinase; Provisional 94.88
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 94.86
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.85
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 94.84
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.84
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.84
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.83
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 94.83
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.83
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 94.81
PRK04301317 radA DNA repair and recombination protein RadA; Va 94.81
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 94.79
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.79
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 94.78
PRK00889175 adenylylsulfate kinase; Provisional 94.77
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 94.75
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.75
PRK06067234 flagellar accessory protein FlaH; Validated 94.74
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 94.73
PTZ00301210 uridine kinase; Provisional 94.7
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 94.7
CHL00095821 clpC Clp protease ATP binding subunit 94.69
PRK11608326 pspF phage shock protein operon transcriptional ac 94.69
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 94.69
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 94.69
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.68
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 94.67
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.67
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 94.67
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.66
PRK05480209 uridine/cytidine kinase; Provisional 94.66
TIGR01817534 nifA Nif-specific regulatory protein. This model r 94.65
PRK06002450 fliI flagellum-specific ATP synthase; Validated 94.64
PRK11147635 ABC transporter ATPase component; Reviewed 94.63
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 94.63
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.62
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 94.61
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 94.61
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.59
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 94.59
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 94.58
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 94.58
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.58
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 94.57
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 94.55
PRK09280463 F0F1 ATP synthase subunit beta; Validated 94.54
PRK08972444 fliI flagellum-specific ATP synthase; Validated 94.52
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.49
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 94.49
PRK03839180 putative kinase; Provisional 94.49
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.48
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.47
PRK05022509 anaerobic nitric oxide reductase transcription reg 94.46
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 94.45
PTZ00088229 adenylate kinase 1; Provisional 94.45
PLN03186342 DNA repair protein RAD51 homolog; Provisional 94.43
TIGR02236310 recomb_radA DNA repair and recombination protein R 94.42
PRK15429686 formate hydrogenlyase transcriptional activator Fh 94.41
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 94.4
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 94.38
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 94.38
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 94.37
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 94.36
TIGR00064272 ftsY signal recognition particle-docking protein F 94.36
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 94.36
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 94.36
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.35
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.34
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.34
PRK13409590 putative ATPase RIL; Provisional 94.34
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 94.33
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.32
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.32
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.31
PRK10636638 putative ABC transporter ATP-binding protein; Prov 94.3
PRK13765637 ATP-dependent protease Lon; Provisional 94.29
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 94.27
PRK06762166 hypothetical protein; Provisional 94.26
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.22
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 94.22
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 94.22
PRK13545549 tagH teichoic acids export protein ATP-binding sub 94.21
TIGR02974329 phageshock_pspF psp operon transcriptional activat 94.18
PRK04328249 hypothetical protein; Provisional 94.16
PRK00279215 adk adenylate kinase; Reviewed 94.09
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 94.09
COG0488530 Uup ATPase components of ABC transporters with dup 94.09
PRK13531498 regulatory ATPase RavA; Provisional 94.08
COG4181228 Predicted ABC-type transport system involved in ly 94.06
PRK08927442 fliI flagellum-specific ATP synthase; Validated 94.06
PRK14974336 cell division protein FtsY; Provisional 94.05
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.05
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 94.04
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 94.04
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 94.02
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 94.02
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.02
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.99
PRK13537306 nodulation ABC transporter NodI; Provisional 93.99
PRK00409782 recombination and DNA strand exchange inhibitor pr 93.99
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 93.98
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.97
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 93.96
COG4133209 CcmA ABC-type transport system involved in cytochr 93.96
PRK00625173 shikimate kinase; Provisional 93.96
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 93.9
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.89
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.89
PTZ00035337 Rad51 protein; Provisional 93.89
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 93.88
PRK10938490 putative molybdenum transport ATP-binding protein 93.87
PRK08149428 ATP synthase SpaL; Validated 93.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.83
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.82
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.82
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 93.81
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.79
KOG0927614 consensus Predicted transporter (ABC superfamily) 93.78
PRK11819556 putative ABC transporter ATP-binding protein; Revi 93.78
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 93.77
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 93.77
PF1324576 AAA_19: Part of AAA domain 93.76
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 93.75
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 93.73
cd03299235 ABC_ModC_like Archeal protein closely related to M 93.7
PRK11153343 metN DL-methionine transporter ATP-binding subunit 93.7
PTZ00185574 ATPase alpha subunit; Provisional 93.7
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 93.68
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 93.67
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 93.67
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 93.65
PRK06936439 type III secretion system ATPase; Provisional 93.65
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 93.64
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 93.63
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 93.61
PRK13407334 bchI magnesium chelatase subunit I; Provisional 93.59
PRK00131175 aroK shikimate kinase; Reviewed 93.58
PRK04040188 adenylate kinase; Provisional 93.58
COG1117253 PstB ABC-type phosphate transport system, ATPase c 93.53
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.48
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 93.47
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 93.47
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 93.47
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 93.47
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.42
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.4
PRK06217183 hypothetical protein; Validated 93.38
PRK05973237 replicative DNA helicase; Provisional 93.38
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 93.37
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 93.37
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 93.37
TIGR02329526 propionate_PrpR propionate catabolism operon regul 93.37
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 93.36
PRK03846198 adenylylsulfate kinase; Provisional 93.36
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-96  Score=869.07  Aligned_cols=819  Identities=25%  Similarity=0.378  Sum_probs=625.0

Q ss_pred             ccccchhhcccchhhHHhHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccchhHHHHHHHHHHHHHHH
Q 045843           14 GSLVGPAVEGGTGILHCLKRKYLYVKNMSKNLRNLEREEKYLCDEEADVKTRLERNKLKMEKSRRCETWLNEVERMKDEI   93 (913)
Q Consensus        14 ~~~v~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~l~~a~~~~~~~~~~~~wl~~l~~~~~~~   93 (913)
                      ++.++..++   ++++.+.+++..+.+.++.+..|++++..|+.++.+       ++.++.....++.|.+.+++++|++
T Consensus         2 ~~~~s~~~~---~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d-------~~a~~~~~~~~~~~~e~~~~~~~~~   71 (889)
T KOG4658|consen    2 GACVSFGVE---KLDQLLNRESECLDGKDNYILELKENLKALQSALED-------LDAKRDDLERRVNWEEDVGDLVYLA   71 (889)
T ss_pred             CeEEEEehh---hHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHH-------HHhhcchHHHHHHHHHHHHHHHHHH
Confidence            456666666   889999999999999999999999999999998665       4455667778899999999999999


Q ss_pred             HHHHHhhhhccccc--------------------cCCCCCcchhhhhHHHHHHHHHHHHHHHhhccchhhc-ccCCCccc
Q 045843           94 ETLKSSYSSTHKFL--------------------CGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAIMV-EKAPVPVI  152 (913)
Q Consensus        94 ed~ld~~~~~~~~~--------------------~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  152 (913)
                      +|+++.|..+....                    .+.......+.+++++.+.++.++....++.+..+.. ..++....
T Consensus        72 e~~~~~~~v~~~~~~~~~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e  151 (889)
T KOG4658|consen   72 EDIIWLFLVEEIERKANDLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVE  151 (889)
T ss_pred             HHHHHHHHHHHHHHHHhHHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcc
Confidence            99999886654321                    1111233445566777777777777766655544433 22222333


Q ss_pred             ccccCccccccchHHHHHHHHHHHhcCCCcEEEEECCCCCcHHHHHHHHHHHhc-ccCCCceEEEEEeCCCCCHHHHHHH
Q 045843          153 KKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLHDAIG-ESRQFDFIFWVTVNSEGNIRDIQEV  231 (913)
Q Consensus       153 ~~~~~~~~~~~gr~~~~~~l~~~L~~~~~~vi~I~G~gG~GKTtLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~i~~~  231 (913)
                      ..|..+... ||.+..++++.+.|.+.+..+++|+||||+||||||++++|+.. ++.+|+.++||+||+.++..+++++
T Consensus       152 ~~~~~~~~~-VG~e~~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~  230 (889)
T KOG4658|consen  152 TRPIQSESD-VGLETMLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQT  230 (889)
T ss_pred             cCCCCcccc-ccHHHHHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHH
Confidence            444444444 89999999999999888779999999999999999999999999 9999999999999999999999999


Q ss_pred             HHHHccCCccC---CChHHHHHHHHHHHccCCeEEEEeCCCCccccccccCC--CCCCCceEEEEeechhhhhc---CCc
Q 045843          232 LLKRLDLRAED---HNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIH--DEHKNGKVVFACIFRNICGQ---IDE  303 (913)
Q Consensus       232 i~~~l~~~~~~---~~~~~~~~~l~~~l~~kr~LlVlDdv~~~~~~~~~~~~--~~~~~s~iivTTR~~~v~~~---~~~  303 (913)
                      |++.++.....   ...++.+..|.+.|++|||+|||||||+..+|+.++.|  ...+||||++|||++.||..   ...
T Consensus       231 Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~  310 (889)
T KOG4658|consen  231 ILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDY  310 (889)
T ss_pred             HHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCc
Confidence            99999875543   34578999999999999999999999999999999876  56788999999999999998   567


Q ss_pred             eEEcccCChHHHHHHHHHHhCCC-CCCCCChHHHHHHHHHHhCCcHHHHHHHHHHhhcCCChHHHHHHHHhhcCCC-CCC
Q 045843          304 EVNVQRLSGKDAQKLFWETVGVQ-LKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPS-MAP  381 (913)
Q Consensus       304 ~~~l~~L~~~~~~~Lf~~~~~~~-~~~~~~~~~~~~~I~~~c~GlPlai~~~~~~l~~~~~~~~w~~~~~~l~~~~-~~~  381 (913)
                      .+++++|+.+|||.||.+.+|.. ....+.++++|++|+++|+|+|||++++|++|+.|.++++|+++.+.+.+ . ..+
T Consensus       311 ~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s-~~~~~  389 (889)
T KOG4658|consen  311 PIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKS-SLAAD  389 (889)
T ss_pred             cccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccc-cccCC
Confidence            89999999999999999999988 55667799999999999999999999999999999999999999999877 5 344


Q ss_pred             CCch-HHHHHHHHHhccCCchhHHHHhhhhccccCCccccHHHHHHHHHhcCchhhhcchHHHHHHHHHHHHHHHHhccc
Q 045843          382 KQEL-EEVYKSFKLVCDKLPSDKQLCLLYWAIFPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLL  460 (913)
Q Consensus       382 ~~~~-~~i~~~l~~sy~~L~~~~k~cfl~~a~fp~~~~i~~~~Li~~W~a~g~i~~~~~~~~~~~~~~~~~~~L~~~~ll  460 (913)
                      .+++ +.+++++++||++||+++|.||+|||+||+||.|+++.||.+||||||+.+...+..+++.|+.|+++|++++|+
T Consensus       390 ~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll  469 (889)
T KOG4658|consen  390 FSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLL  469 (889)
T ss_pred             CCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHH
Confidence            4454 789999999999999889999999999999999999999999999999998767899999999999999999999


Q ss_pred             ccCC---CccccchhHHHHHHHHHHhcccCC-cceEEEeccccc----CHHhhhhhceeeeccccccCCCCCCCCCceeE
Q 045843          461 EKGR---KASHYKMFEHFQRAALRIANHDEN-SFKILVKEEEKI----SEEEWEVANRISLIRMCLSTLPKRPKCCRILT  532 (913)
Q Consensus       461 ~~~~---~~~~~~mHdlv~~~a~~i~~~~~~-~~~~~~~~~~~~----~~~~~~~~~~Lsl~~~~~~~l~~~~~~~~Lr~  532 (913)
                      +...   +..+|+|||+||++|.++|++.+. .++.++..+.+.    ....|...|++++++|.+..++....+++|++
T Consensus       470 ~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~t  549 (889)
T KOG4658|consen  470 IEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRT  549 (889)
T ss_pred             hhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccce
Confidence            9876   457899999999999999995443 256666654222    45677899999999999999999999999999


Q ss_pred             EeeccCc--cccCchHHHhcCCcccEEeccCC-cccccCccccCccCcceeecCCccCccccChhhhccccCCEEecCCC
Q 045843          533 LLLQESS--LAELPASFFGYMCSLQLLDLHDT-KIKLLPSSISSLTNLKALFLNNCCQLMRLPAEVGDLHNLEILDLSHT  609 (913)
Q Consensus       533 L~l~~~~--l~~l~~~~f~~l~~Lr~LdLs~~-~i~~lp~~i~~L~~L~~L~L~~c~~l~~lP~~i~~L~~L~~L~L~~~  609 (913)
                      |.+.+|.  +..++..+|..++.|+||||++| .+..||++|++|.|||||+|++ +.+..+|.++++|++|.||++..+
T Consensus       550 Lll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~-t~I~~LP~~l~~Lk~L~~Lnl~~~  628 (889)
T KOG4658|consen  550 LLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSD-TGISHLPSGLGNLKKLIYLNLEVT  628 (889)
T ss_pred             EEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccC-CCccccchHHHHHHhhheeccccc
Confidence            9999995  88899999999999999999976 5779999999999999999999 899999999999999999999998


Q ss_pred             cCCcCCCcc--ccccccccccccceeecccccccccCCCCCccceeeeeccccCCCCCccccccCCccccceeecCCCCC
Q 045843          610 GICCLPSEI--DLTTLCFYFPNVGLLQNFINASKSWNGNSNFRSFSILVGYNQRSSPHMEFDFSGCSAEKYLRFADGEGF  687 (913)
Q Consensus       610 ~~~~lp~~i--~L~~L~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~l~~~~~~~~~~~~~~~~~~~~~~~l~l~~l~~l  687 (913)
                      .....+.++  .|.       +|++|.++......                                  ....+.++..+
T Consensus       629 ~~l~~~~~i~~~L~-------~Lr~L~l~~s~~~~----------------------------------~~~~l~el~~L  667 (889)
T KOG4658|consen  629 GRLESIPGILLELQ-------SLRVLRLPRSALSN----------------------------------DKLLLKELENL  667 (889)
T ss_pred             cccccccchhhhcc-------cccEEEeecccccc----------------------------------chhhHHhhhcc
Confidence            873333444  688       99999887763110                                  01111222222


Q ss_pred             chhhHHHhcccccccccccccccccCccccCcccCc----ceEEecccCCceEeecCCCcccccccCCceEecccccccc
Q 045843          688 PDAVVKILEQACAFELIGHRTAANLSDFGANKFGDV----EACIVEDCNEMISIIDGNLTEGVTFQHLKKLHISHLPKLM  763 (913)
Q Consensus       688 ~~~~L~~L~i~~~l~l~~~~~~~~l~~~~~~~l~~L----~~L~l~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~l~  763 (913)
                        +.|+.+++.       .....-+...  ..+..|    +.+.+.+|... ..+.. +.   .+.+|+.|.+.+|....
T Consensus       668 --e~L~~ls~~-------~~s~~~~e~l--~~~~~L~~~~~~l~~~~~~~~-~~~~~-~~---~l~~L~~L~i~~~~~~e  731 (889)
T KOG4658|consen  668 --EHLENLSIT-------ISSVLLLEDL--LGMTRLRSLLQSLSIEGCSKR-TLISS-LG---SLGNLEELSILDCGISE  731 (889)
T ss_pred             --cchhhheee-------cchhHhHhhh--hhhHHHHHHhHhhhhcccccc-eeecc-cc---cccCcceEEEEcCCCch
Confidence              222222222       0000000000  111111    11221111111 11111 22   34555555554444432


Q ss_pred             --hhccccccccc-cccccEEeeccCccccccCchHHHhhcCCCcEEEEccCchhHhhhcCCc-----ccCCCCCCccce
Q 045843          764 --HIWKGSIQSGS-LIMLETLILKRCHGMKTLFSEEIIFQLNQIQYLQVEDCKEMEEIIEAGS-----AVDSRAFPKLKS  835 (913)
Q Consensus       764 --~~~~~~~~~~~-l~~L~~L~L~~c~~l~~l~~~~~l~~l~~L~~L~l~~~~~l~~i~~~~~-----~~~~~~f~~L~~  835 (913)
                        ..|........ |++|..+.+.+|..++++   .+..-.|+|+.|.+.+|..++++.+...     ......|+++..
T Consensus       732 ~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l---~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~  808 (889)
T KOG4658|consen  732 IVIEWEESLIVLLCFPNLSKVSILNCHMLRDL---TWLLFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEG  808 (889)
T ss_pred             hhcccccccchhhhHHHHHHHHhhcccccccc---chhhccCcccEEEEecccccccCCCHHHHhhhcccEEeccccccc
Confidence              11221111112 556666666677666666   4555566777777777766665553211     111335566666


Q ss_pred             e-ecccccccccccccCccCCCCccEEeeecCcccccccCCCc----CCCCcceeeecccccccCCCCchhhhccc
Q 045843          836 F-QLINLPKLSSICHNMSLAWPLLETITIKACDELRNFPSTIE----NASKLRGIQCNQAWWSSLVWPNDHVRDHF  906 (913)
Q Consensus       836 L-~l~~~~~l~~i~~~~~~~~p~L~~L~i~~C~~L~~lP~~~~----~l~~L~~l~~~~~~~~~l~w~~~~~~~~~  906 (913)
                      + .+.+.+.+.++.. ....++.|+.+.+..||+++.+|....    ++.......-+.+|...++|.+..++.+|
T Consensus       809 l~~~~~l~~l~~i~~-~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  809 LRMLCSLGGLPQLYW-LPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             ceeeecCCCCceeEe-cccCccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            6 4666677776666 555677799999999999999997533    33344555566688999999999998887

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PTZ00494 tuzin-like protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query913
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-30
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 3e-04
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 6e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  142 bits (359), Expect = 1e-34
 Identities = 104/662 (15%), Positives = 208/662 (31%), Gaps = 155/662 (23%)

Query: 27  ILHCLKRKY---LYVKNMSKNLRN-LEREEKYLCDEEADVKTRLERNKLKMEKSRRCETW 82
           IL   +  +      K++    ++ L +EE    D     K  +             +  
Sbjct: 21  ILSVFEDAFVDNFDCKDVQDMPKSILSKEE---IDHIIMSKDAVSGTLRLFWTLLSKQE- 76

Query: 83  LNEVERMKDEIETLKSSYSSTHKFLCGICPFPSLLQLGKQIVKLTAEVVSLRKQIGQIAI 142
              V++  +E+  L+ +Y    KFL        +    +Q   +T   +  R ++     
Sbjct: 77  -EMVQKFVEEV--LRINY----KFL-----MSPIKTEQRQPSMMTRMYIEQRDRL----- 119

Query: 143 MVEKAPVPVIKKHAKKMEEVPSLNKHLKMLQECLRNVGTKRICIWGPPGVGKTTIMENLH 202
                     K +  +++    L + L  L+        K + I G  G GKT +  ++ 
Sbjct: 120 --YNDNQVFAKYNVSRLQPYLKLRQALLELRP------AKNVLIDGVLGSGKTWVALDVC 171

Query: 203 DAIGESRQFDF-IFWVTV---NSEGNIRDIQEVLLKRLD---LRAEDH--NIDQRADMIS 253
            +     + DF IFW+ +   NS   + ++ + LL ++D       DH  NI  R   I 
Sbjct: 172 LSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQ 231

Query: 254 EELKD----KSYV---LFLDEV-STEI----NL--------RDIGIHDEHKNGKVVFACI 293
            EL+     K Y    L L  V + +     NL        R   + D            
Sbjct: 232 AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTT---- 287

Query: 294 FRNICGQIDEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKL 353
                  I  + +   L+  + + L  + +       +D+              P  + +
Sbjct: 288 ------HISLDHHSMTLTPDEVKSLLLKYLDC---RPQDLPREV------LTTNPRRLSI 332

Query: 354 IGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEEVYKSFKLVCDKL-PSDKQLCLLYWAI 412
           I  S+ +    A W D    +         +L  + +S     + L P++ +      ++
Sbjct: 333 IAESIRD--GLATW-DNWKHVN------CDKLTTIIESS---LNVLEPAEYRKMFDRLSV 380

Query: 413 FPVGYELHEDYIIECWRAEQFFACLRKLGEARDRGQSILDEFVKKSLLEKGRKASHYKMF 472
           FP    +    +   W                     ++++  K SL+EK  K S   + 
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDV-----------MVVVNKLHKYSLVEKQPKESTISI- 428

Query: 473 EHFQRAALRIANHDENSFKILVKEEEKISEEEWEVANRI----SLIR-MCLSTLPKRPKC 527
                              I ++ + K+ E E+ +   I    ++ +      L      
Sbjct: 429 ------------PS-----IYLELKVKL-ENEYALHRSIVDHYNIPKTFDSDDLIPPYLD 470

Query: 528 CRILTLL---LQESSLAELPASFFGYMCSLQLLDLH--DTKIK---LLPSSISSLTNL-- 577
               + +   L+     E    F      +  LD    + KI+      ++  S+ N   
Sbjct: 471 QYFYSHIGHHLKNIEHPERMTLF-----RMVFLDFRFLEQKIRHDSTAWNASGSILNTLQ 525

Query: 578 -----KALFLNNCCQLMRLPAEVGDLHNLEILDLSHTGICCLPSEIDLTTLCFYFPNVGL 632
                K    +N  +  RL   V  + +  +  +    IC      DL  +     +  +
Sbjct: 526 QLKFYKPYICDNDPKYERL---VNAILDF-LPKIEENLICS--KYTDLLRIALMAEDEAI 579

Query: 633 LQ 634
            +
Sbjct: 580 FE 581
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query913
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.86
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.72
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.71
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.65
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.61
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.57
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.57
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.55
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.55
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.55
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.54
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.54
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.53
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
2fna_A357 Conserved hypothetical protein; structural genomic 99.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.5
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.5
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.49
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.48
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.47
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.46
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.45
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.42
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.42
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.34
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.34
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.32
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.32
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.31
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.3
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.27
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.27
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.27
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.26
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.24
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.23
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.2
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.1
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.1
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.06
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.03
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.0
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.0
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.0
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.99
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.98
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.94
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.93
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.82
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.77
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.71
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.62
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.62
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.49
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.47
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.4
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.39
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 98.33
3pvs_A447 Replication-associated recombination protein A; ma 98.32
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.3
3bos_A242 Putative DNA replication factor; P-loop containing 98.28
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.28
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.21
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.19
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.19
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.15
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 98.14
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.11
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.09
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.08
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 98.06
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.01
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 98.0
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.98
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.97
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.95
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.93
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.91
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.89
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.88
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.86
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.8
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.79
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.78
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.78
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.75
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.75
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.74
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.72
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.64
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.62
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.61
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 97.61
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.55
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.51
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.47
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.46
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.36
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.36
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.29
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.24
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.24
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.22
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.16
3co5_A143 Putative two-component system transcriptional RES 97.12
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.08
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 97.03
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.03
1ojl_A304 Transcriptional regulatory protein ZRAR; response 97.01
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 97.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.97
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.85
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.84
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.71
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.71
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.66
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.62
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.61
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.6
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.59
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.57
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.43
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.18
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.13
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.09
2qgz_A308 Helicase loader, putative primosome component; str 95.87
4a74_A231 DNA repair and recombination protein RADA; hydrola 95.85
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.73
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 95.67
3io5_A333 Recombination and repair protein; storage dimer, i 95.6
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.56
2z43_A324 DNA repair and recombination protein RADA; archaea 95.55
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.55
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 95.5
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 95.43
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.39
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 95.39
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.3
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 95.26
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.16
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.12
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.05
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.05
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 94.95
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.88
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.74
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 94.71
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 94.57
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.54
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 94.51
3ice_A422 Transcription termination factor RHO; transcriptio 94.48
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.38
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 94.37
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.37
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 94.36
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 94.35
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.31
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.3
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 94.29
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.23
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 94.22
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.22
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.2
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.16
2hf9_A226 Probable hydrogenase nickel incorporation protein 94.12
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.1
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 93.98
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.96
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.94
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.93
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.93
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.92
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.91
2xxa_A433 Signal recognition particle protein; protein trans 93.88
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.83
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.82
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.8
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.8
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.7
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 93.69
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.69
2r44_A331 Uncharacterized protein; putative ATPase, structur 93.64
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.63
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.63
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.58
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 93.56
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.55
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 93.54
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.5
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.44
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.38
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.38
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.27
1via_A175 Shikimate kinase; structural genomics, transferase 93.26
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.2
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.19
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.19
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.14
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.13
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.13
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.09
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.06
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 93.04
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.02
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.0
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.99
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.97
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 92.96
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.95
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 92.91
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.91
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.89
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.88
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.87
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 92.86
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.84
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.82
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.8
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.72
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.64
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 92.64
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 92.61
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 92.6
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 92.58
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.54
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.54
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.52
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.47
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.47
1xjc_A169 MOBB protein homolog; structural genomics, midwest 92.45
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 92.42
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.36
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.35
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 92.34
3fwy_A314 Light-independent protochlorophyllide reductase I 92.33
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 92.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.31
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.3
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.25
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.24
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 92.23
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.22
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.14
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.14
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.13
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.08
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.02
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.98
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.98
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.98
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.93
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 91.83
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.83
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.83
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 91.81
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.8
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.73
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 91.72
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 91.68
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.65
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.62
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.61
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.6
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 91.58
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 91.57
1tue_A212 Replication protein E1; helicase, replication, E1E 91.53
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 91.53
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 91.53
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 91.52
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.45
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 91.39
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.39
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 91.35
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.33
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.29
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.17
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 91.13
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.13
3l0o_A427 Transcription termination factor RHO; helicase, RH 91.13
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.05
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.04
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.02
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 90.99
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.94
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.9
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.8
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.77
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.74
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 90.74
3r20_A233 Cytidylate kinase; structural genomics, seattle st 90.73
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.71
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 90.69
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 90.54
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 90.52
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.52
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 90.47
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.45
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.43
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 90.43
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 90.42
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.29
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.2
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 90.19
1b0u_A262 Histidine permease; ABC transporter, transport pro 90.19
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 90.16
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 90.12
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 90.12
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.1
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.04
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.99
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 89.96
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 89.94
1ji0_A240 ABC transporter; ATP binding protein, structural g 89.9
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.86
1g6h_A257 High-affinity branched-chain amino acid transport 89.8
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.69
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 89.69
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 89.67
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.67
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 89.64
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.6
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 89.5
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 89.41
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.39
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 89.39
2og2_A359 Putative signal recognition particle receptor; nuc 89.36
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 89.29
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 89.24
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 89.23
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 89.23
2ghi_A260 Transport protein; multidrug resistance protein, M 89.22
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 89.19
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.19
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.14
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 89.12
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 89.03
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.96
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 88.85
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 88.85
2eyu_A261 Twitching motility protein PILT; pilus retraction 88.84
2wji_A165 Ferrous iron transport protein B homolog; membrane 88.81
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.81
3end_A307 Light-independent protochlorophyllide reductase ir 88.54
3mfy_A588 V-type ATP synthase alpha chain; A-type ATP syntha 88.47
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.46
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 88.46
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 88.41
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 88.37
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 88.35
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 88.2
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 88.19
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 88.16
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 88.1
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 88.08
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 88.04
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 87.95
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 87.94
2r6a_A454 DNAB helicase, replicative helicase; replication, 87.77
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 87.59
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 87.55
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 87.54
3vr4_A600 V-type sodium ATPase catalytic subunit A; V-ATPase 87.39
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.39
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 87.38
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 87.33
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 87.33
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 87.31
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 87.28
2ged_A193 SR-beta, signal recognition particle receptor beta 87.21
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 87.21
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 87.17
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 87.12
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 87.11
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 87.05
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 87.02
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 86.99
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 86.99
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 86.96
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 86.94
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-48  Score=451.63  Aligned_cols=306  Identities=15%  Similarity=0.161  Sum_probs=249.2

Q ss_pred             cchHHHHHHHHHHHhcC---CCcEEEEECCCCCcHHHHHHHHHH--HhcccCCCceEEEEEeCCCC--CHHHHHHHHHHH
Q 045843          163 PSLNKHLKMLQECLRNV---GTKRICIWGPPGVGKTTIMENLHD--AIGESRQFDFIFWVTVNSEG--NIRDIQEVLLKR  235 (913)
Q Consensus       163 ~gr~~~~~~l~~~L~~~---~~~vi~I~G~gG~GKTtLa~~v~~--~~~~~~~F~~~~wv~vs~~~--~~~~i~~~i~~~  235 (913)
                      +||+.++++|.++|...   ..++|+|+||||+||||||+++|+  +.+++.+|++++||++++.+  ++..+++.|+.+
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~  210 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLM  210 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHH
Confidence            49999999999999543   679999999999999999999999  67888999999999999985  899999999999


Q ss_pred             ccCCcc--------CCChHHHHHHHHHHHccC-CeEEEEeCCCCccccccccCCCCCCCceEEEEeechhhhhcC--C-c
Q 045843          236 LDLRAE--------DHNIDQRADMISEELKDK-SYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQI--D-E  303 (913)
Q Consensus       236 l~~~~~--------~~~~~~~~~~l~~~l~~k-r~LlVlDdv~~~~~~~~~~~~~~~~~s~iivTTR~~~v~~~~--~-~  303 (913)
                      ++....        ..+.+.++..+++.|+++ ||||||||||+...+ .  ++ ..+||+||||||++.|+...  . .
T Consensus       211 l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~--~~-~~~gs~ilvTTR~~~v~~~~~~~~~  286 (549)
T 2a5y_B          211 LKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-R--WA-QELRLRCLVTTRDVEISNAASQTCE  286 (549)
T ss_dssp             HTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-H--HH-HHTTCEEEEEESBGGGGGGCCSCEE
T ss_pred             HhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-c--cc-ccCCCEEEEEcCCHHHHHHcCCCCe
Confidence            986521        134566789999999996 999999999997754 1  11 12799999999999998872  2 5


Q ss_pred             eEEcccCChHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHhCCcHHHHHHHHHHhhcCCChHHHHHHHHhhcCCCCCCCC
Q 045843          304 EVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQ  383 (913)
Q Consensus       304 ~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~I~~~c~GlPlai~~~~~~l~~~~~~~~w~~~~~~l~~~~~~~~~  383 (913)
                      +|++++|+.+|||+||.+.++... ..+.+++++++|+++|+|+||||+++|+.|+.+ +   |+.+ +.+.. ..+.. 
T Consensus       287 ~~~l~~L~~~ea~~Lf~~~a~~~~-~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~---w~~~-~~l~~-~l~~~-  358 (549)
T 2a5y_B          287 FIEVTSLEIDECYDFLEAYGMPMP-VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-T---FEKM-AQLNN-KLESR-  358 (549)
T ss_dssp             EEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-S---HHHH-HHHHH-HHHHH-
T ss_pred             EEECCCCCHHHHHHHHHHHhcCCC-CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-h---HHHH-HHhHH-Hhhcc-
Confidence            799999999999999999998753 246788999999999999999999999999776 3   4433 22221 11000 


Q ss_pred             chHHHHHHHHHhccCCchhHHHHhh-----------hhccccCCccccHHHHHHHHHhc--CchhhhcchHHHHHHHHHH
Q 045843          384 ELEEVYKSFKLVCDKLPSDKQLCLL-----------YWAIFPVGYELHEDYIIECWRAE--QFFACLRKLGEARDRGQSI  450 (913)
Q Consensus       384 ~~~~i~~~l~~sy~~L~~~~k~cfl-----------~~a~fp~~~~i~~~~Li~~W~a~--g~i~~~~~~~~~~~~~~~~  450 (913)
                      ...++.+++.+||++||+++|.||+           |||+||+++.|+    +++|+|+  ||+.....+...++.++ |
T Consensus       359 ~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~  433 (549)
T 2a5y_B          359 GLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-R  433 (549)
T ss_dssp             CSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-H
T ss_pred             cHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-H
Confidence            1245778899999999999999999           999999999999    8999999  99987643555677777 9


Q ss_pred             HHHHHHhcccccCC--CccccchhHHHHHHHHHHhcc
Q 045843          451 LDEFVKKSLLEKGR--KASHYKMFEHFQRAALRIANH  485 (913)
Q Consensus       451 ~~~L~~~~ll~~~~--~~~~~~mHdlv~~~a~~i~~~  485 (913)
                      |++|+++||++...  ...+|+|||+||++|++++.+
T Consensus       434 l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~  470 (549)
T 2a5y_B          434 LKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDA  470 (549)
T ss_dssp             HHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCT
T ss_pred             HHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHH
Confidence            99999999999765  346799999999999998876
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 913
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 94.1 bits (233), Expect = 1e-21
 Identities = 32/260 (12%), Positives = 68/260 (26%), Gaps = 31/260 (11%)

Query: 167 KHLKMLQECLRNVGTKR---ICIWGPPGVGKTTIMENL--HDAIGESRQFDFIFWVTVNS 221
            H+  + + L  +       + + G  G GK+ I               +D I W+  + 
Sbjct: 27  YHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSG 86

Query: 222 EGNIRDIQEVLLKRLDLRAEDH-----------NIDQRADMISEELKDKSYVLFLDEVST 270
                         L L++ED            ++  +  + +  +   + +   D+V  
Sbjct: 87  TAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQ 146

Query: 271 EINLRDIGIHDEHKNGKVVFACIFRNICGQIDEE---VNVQRLSGKDAQKLFWETVGVQL 327
           E    +     +    + +       I     +    + V  L   +             
Sbjct: 147 E----ETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP 202

Query: 328 KDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAPKQELEE 387
                 + V    I    G P  + +   S    +       + ++L S        L  
Sbjct: 203 VGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEK-MAQLNNKLESRG------LVG 254

Query: 388 VYKSFKLVCDKLPSDKQLCL 407
           V          L    Q C+
Sbjct: 255 VECITPYSYKSLAMALQRCV 274
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query913
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.45
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.24
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.21
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.16
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.14
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.08
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.08
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.07
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.06
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.91
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.76
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.74
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.68
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.6
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.57
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.51
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.51
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.47
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.45
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 98.38
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.34
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.29
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.27
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.26
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.25
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 98.23
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.09
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.04
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.03
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.97
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.86
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.85
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.58
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.75
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.65
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.58
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.5
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.45
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.37
d2qy9a2211 GTPase domain of the signal recognition particle r 96.28
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.12
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.05
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.99
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.95
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.94
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.92
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.86
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.84
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.81
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.77
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.74
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.69
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.68
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.65
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.59
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.57
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.54
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.48
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.47
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.45
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.41
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.41
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.4
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.38
d1vmaa2213 GTPase domain of the signal recognition particle r 95.34
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.29
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.26
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.22
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.17
d1okkd2207 GTPase domain of the signal recognition particle r 95.16
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.15
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.13
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 95.12
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.07
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.04
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.02
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.98
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.95
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.92
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.89
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.83
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.7
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.64
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.6
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.59
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.49
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.47
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.46
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.26
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.25
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.13
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.03
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.86
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.83
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.78
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.74
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.68
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.67
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.65
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.46
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.42
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.37
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.36
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.22
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.1
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.01
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.94
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.9
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.81
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.73
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.72
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.68
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.63
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.62
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 92.49
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.09
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 92.08
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.66
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.6
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.53
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.5
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.45
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.16
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.1
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.04
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.96
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 90.92
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 90.55
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 90.46
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 90.28
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 90.21
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.17
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.15
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.99
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.96
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.67
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.5
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.22
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.17
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.15
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.09
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.07
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.03
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 88.99
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.82
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 88.71
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 88.61
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.61
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 88.59
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.54
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.46
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 88.31
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.24
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.15
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.09
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.02
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.96
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.95
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.87
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.84
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 87.8
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.78
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.68
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.6
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.59
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 87.58
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.57
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.3
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 87.28
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.26
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 87.21
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 87.2
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.06
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.01
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.88
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.68
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 86.66
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.65
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.58
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 86.51
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 86.36
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.18
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.11
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.03
d2fh5b1207 Signal recognition particle receptor beta-subunit 85.97
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.94
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.9
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 85.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.76
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.66
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.64
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.45
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.44
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.27
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.13
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.1
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.06
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.04
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 85.01
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 85.0
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 84.98
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.81
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.75
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.53
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.41
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.4
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 84.16
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 84.09
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.08
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 83.98
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.92
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 83.25
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 83.17
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.99
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 82.74
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.49
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.38
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.28
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 82.01
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 81.36
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 81.21
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=100.00  E-value=8.1e-40  Score=342.72  Aligned_cols=238  Identities=13%  Similarity=0.062  Sum_probs=194.5

Q ss_pred             cccchHHHHHHHHHHHh---cCCCcEEEEECCCCCcHHHHHHHHHHHhc--ccCCCceEEEEEeCCCCCHHHHHHHHHHH
Q 045843          161 EVPSLNKHLKMLQECLR---NVGTKRICIWGPPGVGKTTIMENLHDAIG--ESRQFDFIFWVTVNSEGNIRDIQEVLLKR  235 (913)
Q Consensus       161 ~~~gr~~~~~~l~~~L~---~~~~~vi~I~G~gG~GKTtLa~~v~~~~~--~~~~F~~~~wv~vs~~~~~~~i~~~i~~~  235 (913)
                      .++||+.++++|+++|.   +.+..+|+|+||||+||||||+++|++..  +..+|++++||++++.++...+...+...
T Consensus        21 ~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~  100 (277)
T d2a5yb3          21 TCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDIL  100 (277)
T ss_dssp             CSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHH
T ss_pred             ceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHH
Confidence            35799999999999994   35678999999999999999999999865  56789999999999998877776665443


Q ss_pred             c---cCCcc--------CCChHHHHHHHHHHHccCCeEEEEeCCCCccccccccCCCCCCCceEEEEeechhhhhc---C
Q 045843          236 L---DLRAE--------DHNIDQRADMISEELKDKSYVLFLDEVSTEINLRDIGIHDEHKNGKVVFACIFRNICGQ---I  301 (913)
Q Consensus       236 l---~~~~~--------~~~~~~~~~~l~~~l~~kr~LlVlDdv~~~~~~~~~~~~~~~~~s~iivTTR~~~v~~~---~  301 (913)
                      +   +....        ..........+.+.+.++|+|+||||||+...|+.+.    ..||+||||||++.|+..   .
T Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~----~~~srilvTTR~~~v~~~~~~~  176 (277)
T d2a5yb3         101 LMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ----ELRLRCLVTTRDVEISNAASQT  176 (277)
T ss_dssp             HHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH----HTTCEEEEEESBGGGGGGCCSC
T ss_pred             HHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc----ccCceEEEEeehHHHHHhcCCC
Confidence            3   22211        1223334556778889999999999999988887653    358999999999999887   3


Q ss_pred             CceEEcccCChHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHhCCcHHHHHHHHHHhhcCCChHHHHHHHHhhcCCCCCC
Q 045843          302 DEEVNVQRLSGKDAQKLFWETVGVQLKDCRDIKPVARLIINECGGMPHMIKLIGSSLANVSNPAIWRDMLSQLRSPSMAP  381 (913)
Q Consensus       302 ~~~~~l~~L~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~I~~~c~GlPlai~~~~~~l~~~~~~~~w~~~~~~l~~~~~~~  381 (913)
                      ...|++++|+.+|||+||.+++|... ..+..++++++|+++|+|+|||++++|+.|+.+ +.++|.+..+.+.. .   
T Consensus       177 ~~~~~l~~L~~~ea~~Lf~~~~~~~~-~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~~-~---  250 (277)
T d2a5yb3         177 CEFIEVTSLEIDECYDFLEAYGMPMP-VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES-R---  250 (277)
T ss_dssp             EEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHH-H---
T ss_pred             CceEECCCCCHHHHHHHHHHHhCCcc-CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHhc-C---
Confidence            36799999999999999999988753 345578899999999999999999999999877 88999998887754 1   


Q ss_pred             CCchHHHHHHHHHhccCCchhHHHHhhhh
Q 045843          382 KQELEEVYKSFKLVCDKLPSDKQLCLLYW  410 (913)
Q Consensus       382 ~~~~~~i~~~l~~sy~~L~~~~k~cfl~~  410 (913)
                        +..++..++.+||++||+++|+||.++
T Consensus       251 --~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         251 --GLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             --CSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             --cHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence              125578889999999999999999864
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure