Citrus Sinensis ID: 045849

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
cccccccccccccccccccEEEEccccccccEEEEEEEcccccccEEEEEcccccccEEEEEEEEEEEEEcccEEEEEEEEEcccccccEEEEEEccccccEEEEEEccccccccccEEEEEEcccccccccHHHHHHHHHccccccEEEEcccccccccccccccccHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHccccEEEEccccccccc
ccccccccccccccccccEEEEEEccccccEEEEEEEEcccccccEEEEEccccccEEEEEEEEEEEEEEEccccEEEEEEEcccccccEEEEEEcccccccEEEEEccccccccccEEEEEEEcccccccccHHHHHHHHccccccEEEEEcccEccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHcccHHHHHHHHHHHHHcccEEEEEccEEcEccc
mpldadvfqvppgynapqqvhitqgdLVGKAVIVSWVtvdepgtnTVVYWSENSEQKEQAEGKVYTYKYynytsgyihhctirhlefntKYYYVVGIGHTerqfwfvtppevgpdvpysfgligdlgqsydsnvtlthyernprkgqtllfvgdlsyadnypchdnnrwdtwgrfversaayqpwiwtagnheidfypeigetvpfkpyshryhvpyrasgstapfwySIKRASVYIIVLSSysaygkytpqykwleeelpkvnrsetpWLIVLMHapwynsynyhymeGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYwsenseqkeqaEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLThyernprkgQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEgkvytykyynytsgyIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
***********PGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSE********EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAY***
*PL**DVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
****ADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYE**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query320 2.2.26 [Sep-21-2011]
Q9SDZ9 465 Purple acid phosphatase 2 N/A no 1.0 0.688 0.846 1e-164
Q09131 464 Purple acid phosphatase O yes no 1.0 0.689 0.837 1e-163
Q9SIV9 468 Purple acid phosphatase 1 yes no 1.0 0.683 0.790 1e-156
P80366 432 Fe(3+)-Zn(2+) purple acid N/A no 1.0 0.740 0.743 1e-146
Q38924 469 Fe(3+)-Zn(2+) purple acid no no 1.0 0.682 0.731 1e-142
Q9SE00 473 Purple acid phosphatase 1 N/A no 1.0 0.676 0.697 1e-135
Q9C510 466 Purple acid phosphatase 6 no no 0.996 0.684 0.622 1e-119
O23244 466 Purple acid phosphatase 2 no no 0.990 0.680 0.609 1e-116
Q93WP4 481 Phosphoenolpyruvate phosp N/A no 0.993 0.661 0.625 1e-114
Q949Y3 475 Bifunctional purple acid no no 0.993 0.669 0.595 1e-111
>sp|Q9SDZ9|PPAF2_IPOBA Purple acid phosphatase 2 OS=Ipomoea batatas GN=PAP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  578 bits (1490), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 271/320 (84%), Positives = 294/320 (91%)

Query: 1   MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA 60
           MPLD+DVF+VPPGYNAPQQVHITQGD VGKA+IVSWVTVDEPG++ VVYWSENS+ K+ A
Sbjct: 40  MPLDSDVFRVPPGYNAPQQVHITQGDHVGKAMIVSWVTVDEPGSSKVVYWSENSQHKKVA 99

Query: 61  EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF 120
            G + TY Y+NYTSGYIHHCTIR+LE+NTKYYY VGIG+T R FWF TPPEVGPDVPY+F
Sbjct: 100 RGNIRTYTYFNYTSGYIHHCTIRNLEYNTKYYYEVGIGNTTRSFWFTTPPEVGPDVPYTF 159

Query: 121 GLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSA 180
           GLIGDLGQS+DSN TLTHYERNP KGQ +LFVGDLSYADNYP HDN RWDTWGRFVERS 
Sbjct: 160 GLIGDLGQSFDSNRTLTHYERNPIKGQAVLFVGDLSYADNYPNHDNVRWDTWGRFVERST 219

Query: 181 AYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVL 240
           AYQPWIWTAGNHEIDF PEIGET PFKP++ RYHVPY+ASGST  FWY IKRAS YIIVL
Sbjct: 220 AYQPWIWTAGNHEIDFAPEIGETKPFKPFTKRYHVPYKASGSTETFWYPIKRASAYIIVL 279

Query: 241 SSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPW 300
           SSYSAYGKYTPQYKWLEEELPKVNR+ETPWLIVLMH+PWYNSYNYHYMEGETMRVMYEPW
Sbjct: 280 SSYSAYGKYTPQYKWLEEELPKVNRTETPWLIVLMHSPWYNSYNYHYMEGETMRVMYEPW 339

Query: 301 LVKYKVDVVFAGHVHAYERS 320
            V++KVD+VFAGHVHAYERS
Sbjct: 340 FVQHKVDLVFAGHVHAYERS 359

Ipomoea batatas (taxid: 4120)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|Q09131|PPAF_SOYBN Purple acid phosphatase OS=Glycine max GN=PAP PE=1 SV=2 Back     alignment and function description
>sp|Q9SIV9|PPA10_ARATH Purple acid phosphatase 10 OS=Arabidopsis thaliana GN=PAP10 PE=2 SV=1 Back     alignment and function description
>sp|P80366|PPAF_PHAVU Fe(3+)-Zn(2+) purple acid phosphatase OS=Phaseolus vulgaris PE=1 SV=2 Back     alignment and function description
>sp|Q38924|PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12 OS=Arabidopsis thaliana GN=PAP12 PE=2 SV=3 Back     alignment and function description
>sp|Q9SE00|PPAF1_IPOBA Purple acid phosphatase 1 OS=Ipomoea batatas GN=PAP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9C510|PPA6_ARATH Purple acid phosphatase 6 OS=Arabidopsis thaliana GN=PAP6 PE=2 SV=1 Back     alignment and function description
>sp|O23244|PPA25_ARATH Purple acid phosphatase 25 OS=Arabidopsis thaliana GN=PAP25 PE=2 SV=2 Back     alignment and function description
>sp|Q93WP4|PEPP_ALLCE Phosphoenolpyruvate phosphatase OS=Allium cepa GN=ACPEPP PE=1 SV=1 Back     alignment and function description
>sp|Q949Y3|PPA26_ARATH Bifunctional purple acid phosphatase 26 OS=Arabidopsis thaliana GN=PAP26 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
224103361 426 predicted protein [Populus trichocarpa] 1.0 0.751 0.875 1e-168
225427698 472 PREDICTED: purple acid phosphatase 2 iso 1.0 0.677 0.868 1e-166
224080395 468 predicted protein [Populus trichocarpa] 1.0 0.683 0.862 1e-166
255543799 467 Purple acid phosphatase precursor, putat 1.0 0.685 0.865 1e-165
359806067 464 uncharacterized protein LOC100807555 pre 1.0 0.689 0.846 1e-164
225427706 472 PREDICTED: purple acid phosphatase 2 iso 1.0 0.677 0.856 1e-164
27597229 470 purple acid phosphatase [Nicotiana tabac 1.0 0.680 0.85 1e-164
4160280 465 purple acid phosphatase [Ipomoea batatas 1.0 0.688 0.85 1e-163
297744759 426 unnamed protein product [Vitis vinifera] 1.0 0.751 0.856 1e-163
75265719 465 RecName: Full=Purple acid phosphatase 2; 1.0 0.688 0.846 1e-162
>gi|224103361|ref|XP_002313026.1| predicted protein [Populus trichocarpa] gi|222849434|gb|EEE86981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 280/320 (87%), Positives = 299/320 (93%)

Query: 1   MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA 60
           MPLD+DVF+VPPGYNAPQQVHITQGD VGKAVIVSWVT +EPG+  V+YWSENSE KE+A
Sbjct: 1   MPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTANEPGSKKVIYWSENSEHKEEA 60

Query: 61  EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF 120
             KVYTYK+YNYTSGYIHHCTIR+LEFNTKYYYVVG+GHTER+FWF TPP VGPDVPY+F
Sbjct: 61  NSKVYTYKFYNYTSGYIHHCTIRNLEFNTKYYYVVGVGHTERKFWFTTPPAVGPDVPYTF 120

Query: 121 GLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSA 180
           GLIGDLGQSYDSN TLTHYE+NP KGQ +LFVGDLSYADNY  HDN RWDTWGRFVERS 
Sbjct: 121 GLIGDLGQSYDSNTTLTHYEKNPTKGQAVLFVGDLSYADNYSNHDNVRWDTWGRFVERSV 180

Query: 181 AYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVL 240
           AYQPWIWTAGNHEIDF PEIGET PFKP++HRYHVPYRAS STAPFWYSIKRAS YI+VL
Sbjct: 181 AYQPWIWTAGNHEIDFAPEIGETKPFKPFTHRYHVPYRASQSTAPFWYSIKRASAYIVVL 240

Query: 241 SSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPW 300
           SSYSAYGKYTPQYKWLE+ELPKVNRSETPWLIVLMH+PWYNSYNYHYMEGETMRVMYEPW
Sbjct: 241 SSYSAYGKYTPQYKWLEQELPKVNRSETPWLIVLMHSPWYNSYNYHYMEGETMRVMYEPW 300

Query: 301 LVKYKVDVVFAGHVHAYERS 320
            V+YKVDVVFAGHVHAYERS
Sbjct: 301 FVQYKVDVVFAGHVHAYERS 320

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225427698|ref|XP_002263937.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] gi|297744760|emb|CBI38022.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224080395|ref|XP_002306126.1| predicted protein [Populus trichocarpa] gi|222849090|gb|EEE86637.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543799|ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis] gi|223547973|gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359806067|ref|NP_001240926.1| uncharacterized protein LOC100807555 precursor [Glycine max] gi|304421394|gb|ADM32496.1| phytase [Glycine max] Back     alignment and taxonomy information
>gi|225427706|ref|XP_002264113.1| PREDICTED: purple acid phosphatase 2 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|27597229|dbj|BAC55155.1| purple acid phosphatase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|4160280|emb|CAA06921.1| purple acid phosphatase [Ipomoea batatas] Back     alignment and taxonomy information
>gi|297744759|emb|CBI38021.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|75265719|sp|Q9SDZ9.1|PPAF2_IPOBA RecName: Full=Purple acid phosphatase 2; AltName: Full=Manganese(II) purple acid phosphatase 2; Flags: Precursor gi|6635443|gb|AAF19822.1|AF200826_1 purple acid phosphatase precursor [Ipomoea batatas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
UNIPROTKB|Q09131 464 PAP "Purple acid phosphatase" 1.0 0.689 0.812 9.8e-151
TAIR|locus:2042689 468 PAP10 "AT2G16430" [Arabidopsis 1.0 0.683 0.756 7.5e-144
TAIR|locus:2005533 469 PAP12 "AT2G27190" [Arabidopsis 1.0 0.682 0.703 3.1e-131
TAIR|locus:2010753 466 PAP6 "purple acid phosphatase 0.990 0.680 0.611 6.1e-110
TAIR|locus:2115345 466 PAP25 "purple acid phosphatase 0.990 0.680 0.591 1.5e-106
TAIR|locus:2184657 475 PAP26 "AT5G34850" [Arabidopsis 0.993 0.669 0.576 5.3e-104
TAIR|locus:2053149 441 PAP11 "purple acid phosphatase 0.609 0.442 0.739 6.8e-98
TAIR|locus:2075341 388 PAP19 "purple acid phosphatase 0.221 0.182 0.763 6.7e-70
TAIR|locus:2011501396 PAP5 "purple acid phosphatase 0.825 0.666 0.485 1.9e-67
TAIR|locus:2083238434 PAP22 "purple acid phosphatase 0.9 0.663 0.411 1.5e-53
UNIPROTKB|Q09131 PAP "Purple acid phosphatase" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
 Score = 1471 (522.9 bits), Expect = 9.8e-151, P = 9.8e-151
 Identities = 260/320 (81%), Positives = 285/320 (89%)

Query:     1 MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA 60
             MPLD+DVF VPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPG++ V YWSENS++K+ A
Sbjct:    38 MPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVHYWSENSDKKKIA 97

Query:    61 EXXXXXXXXXXXXXXXIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF 120
             E               IHH TIR+LE+ TKYYY VG+G+T RQFWFVTPPE+GPDVPY+F
Sbjct:    98 EGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPYTF 157

Query:   121 GLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSA 180
             GLIGDLGQS+DSN TL+HYE NPRKGQT+LFVGDLSYADNYP HDN RWD+WGRF ERS 
Sbjct:   158 GLIGDLGQSFDSNKTLSHYELNPRKGQTVLFVGDLSYADNYPNHDNIRWDSWGRFTERSV 217

Query:   181 AYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVL 240
             AYQPWIWTAGNHE  F PEIGETVPFKPY+HRYHVPY+AS ST+PFWYSIKRAS +IIVL
Sbjct:   218 AYQPWIWTAGNHENHFAPEIGETVPFKPYTHRYHVPYKASQSTSPFWYSIKRASAHIIVL 277

Query:   241 SSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPW 300
             +SYSAYGKYTPQYKWLE+ELPKVNR+ETPWLIVLMH+PWYNSYNYHYMEGETMRVMYEPW
Sbjct:   278 ASYSAYGKYTPQYKWLEKELPKVNRTETPWLIVLMHSPWYNSYNYHYMEGETMRVMYEPW 337

Query:   301 LVKYKVDVVFAGHVHAYERS 320
              V+YKVDVVFAGHVHAYERS
Sbjct:   338 FVQYKVDVVFAGHVHAYERS 357
GO:0003993 "acid phosphatase activity" evidence=IDA
GO:0005615 "extracellular space" evidence=IDA
GO:0008150 "biological_process" evidence=ND
GO:0030145 "manganese ion binding" evidence=IDA
GO:0046872 "metal ion binding" evidence=IDA
TAIR|locus:2042689 PAP10 "AT2G16430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005533 PAP12 "AT2G27190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010753 PAP6 "purple acid phosphatase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115345 PAP25 "purple acid phosphatase 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184657 PAP26 "AT5G34850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053149 PAP11 "purple acid phosphatase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075341 PAP19 "purple acid phosphatase 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011501 PAP5 "purple acid phosphatase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083238 PAP22 "purple acid phosphatase 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q09131PPAF_SOYBN3, ., 1, ., 3, ., 20.83751.00.6896yesno
Q9SDZ9PPAF2_IPOBA3, ., 1, ., 3, ., 20.84681.00.6881N/Ano
Q9SIV9PPA10_ARATH3, ., 1, ., 3, ., 20.79061.00.6837yesno
P80366PPAF_PHAVU3, ., 1, ., 3, ., 20.74371.00.7407N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.963
3rd Layer3.6.1.13LOW CONFIDENCE prediction!
3rd Layer3.1.3.20.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_IX0440
hypothetical protein (426 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
cd00839294 cd00839, MPP_PAPs, purple acid phosphatases of the 2e-75
PLN02533427 PLN02533, PLN02533, probable purple acid phosphata 9e-67
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 8e-29
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 1e-07
COG1409 301 COG1409, Icc, Predicted phosphohydrolases [General 1e-06
cd07378277 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 8e-05
>gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information 
 Score =  232 bits (595), Expect = 2e-75
 Identities = 90/213 (42%), Positives = 123/213 (57%), Gaps = 11/213 (5%)

Query: 114 PDVPYSFGLIGDLGQS-YDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTW 172
            D P+ F + GD+GQ+  +S  TL H E+       +L VGDL+YAD Y   + +RWDT+
Sbjct: 1   DDTPFKFAVFGDMGQNTNNSTNTLDHLEKELGNYDAILHVGDLAYADGYN--NGSRWDTF 58

Query: 173 GRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKR 232
            R +E  A+Y P++ T GNHE D+          K +  R+  P+  SGST+  WYS   
Sbjct: 59  MRQIEPLASYVPYMVTPGNHEADY---NFSFYKIKAFFPRFRFPHSPSGSTSNLWYSFDV 115

Query: 233 ASVYIIVLSSYSAY---GKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYM- 288
             V+ + LS+   +   G  +PQY WLE +L KV+RS+TPW+IV+ H P Y S   H   
Sbjct: 116 GPVHFVSLSTEVDFYGDGPGSPQYDWLEADLAKVDRSKTPWIIVMGHRPMYCSNTDHDDC 175

Query: 289 -EGETMRVMYEPWLVKYKVDVVFAGHVHAYERS 320
            EGE MR   E    KY VD+V +GHVHAYER+
Sbjct: 176 IEGEKMRAALEDLFYKYGVDLVLSGHVHAYERT 208

Purple acid phosphatases (PAPs) belong to a diverse family of binuclear metallohydrolases that have been identified and characterized in plants, animals, and fungi. PAPs contain a binuclear metal center and their characteristic pink or purple color derives from a charge-transfer transition between a tyrosine residue and a chromophoric ferric ion within the binuclear center. PAPs catalyze the hydrolysis of a wide range of activated phosphoric acid mono- and di-esters and anhydrides. PAPs are distinguished from the other phosphatases by their insensitivity to L-(+) tartrate inhibition and are therefore also known as tartrate resistant acid phosphatases (TRAPs). While only a few copies of PAP-like genes are present in mammalian and fungal genomes, multiple copies are present in plant genomes. PAPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 294
>gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|224327 COG1409, Icc, Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163621 cd07378, MPP_ACP5, Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 100.0
PLN02533427 probable purple acid phosphatase 100.0
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 100.0
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.97
PTZ00422 394 glideosome-associated protein 50; Provisional 99.96
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.96
PF09423453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 99.95
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 99.92
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.92
COG3540 522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 99.92
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.92
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.91
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.89
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.89
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 99.85
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.81
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.79
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.76
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.72
TIGR03767 496 P_acnes_RR metallophosphoesterase, PPA1498 family. 99.7
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.69
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.68
COG1409 301 Icc Predicted phosphohydrolases [General function 99.63
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.61
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.59
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.58
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.57
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.57
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 99.55
PRK11340271 phosphodiesterase YaeI; Provisional 99.49
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 99.48
cd00838131 MPP_superfamily metallophosphatase superfamily, me 99.45
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.34
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 99.3
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.27
COG1408284 Predicted phosphohydrolases [General function pred 99.26
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.21
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.19
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 99.19
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.17
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 99.16
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 99.15
COG1768230 Predicted phosphohydrolase [General function predi 99.15
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 99.14
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 99.11
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 99.07
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.04
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.98
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.98
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 98.96
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 98.88
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.83
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.8
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 98.78
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 98.72
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.69
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 98.66
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 98.66
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 98.55
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 98.55
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 98.53
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 98.51
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 98.51
KOG3662 410 consensus Cell division control protein/predicted 98.5
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.48
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 98.46
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.45
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.45
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 98.42
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 98.34
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 98.34
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 98.33
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 98.32
PRK10966 407 exonuclease subunit SbcD; Provisional 98.31
COG0622172 Predicted phosphoesterase [General function predic 98.31
PHA02546 340 47 endonuclease subunit; Provisional 98.26
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 98.2
PRK09453182 phosphodiesterase; Provisional 98.19
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 98.17
COG2908237 Uncharacterized protein conserved in bacteria [Fun 98.13
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 98.12
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.01
PHA02239235 putative protein phosphatase 97.97
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.87
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.85
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 97.79
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 97.79
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.76
PRK04036504 DNA polymerase II small subunit; Validated 97.76
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 97.74
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.67
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 97.65
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 97.63
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 97.53
PRK09968218 serine/threonine-specific protein phosphatase 2; P 97.53
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 97.51
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 97.46
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 97.4
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 97.39
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.32
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 97.29
cd07381239 MPP_CapA CapA and related proteins, metallophospha 97.28
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 97.27
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 97.24
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 97.17
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 97.06
COG5555392 Cytolysin, a secreted calcineurin-like phosphatase 97.06
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 97.03
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 97.03
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.91
COG1692266 Calcineurin-like phosphoesterase [General function 96.8
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 96.74
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 96.65
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 96.62
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 96.35
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 96.34
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 96.27
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 96.25
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 96.23
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 96.22
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 96.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 95.94
KOG4419 602 consensus 5' nucleotidase [Nucleotide transport an 95.9
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 95.63
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 95.61
PTZ00480320 serine/threonine-protein phosphatase; Provisional 95.6
KOG3947305 consensus Phosphoesterases [General function predi 95.27
cd0006393 FN3 Fibronectin type 3 domain; One of three types 94.87
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 94.82
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 94.65
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 94.62
smart0006083 FN3 Fibronectin type 3 domain. One of three types 93.61
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 91.84
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 88.52
KOG0372303 consensus Serine/threonine specific protein phosph 85.4
KOG0374331 consensus Serine/threonine specific protein phosph 82.96
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 82.46
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-64  Score=448.63  Aligned_cols=308  Identities=43%  Similarity=0.689  Sum_probs=263.9

Q ss_pred             CCCCCccccCCCCCCCCccEEEEeeCCCCCcEEEEEEeCCCCCCCeEEEeccCCCC-----ceEEEEEEEEEEeccccce
Q 045849            1 MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQ-----KEQAEGKVYTYKYYNYTSG   75 (320)
Q Consensus         1 ~~~~~~~~~~~~~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~~~~~v~y~~~~~~~-----~~~~~~~~~~~~~~~~~~~   75 (320)
                      |++++.++.+|.+.+.|+||||++++... +|+|+|.|.+.. ...|+|+......     ...+++.+..+...++..+
T Consensus        29 ~~~~~~~~~~~~~~~~peQvhlS~~~~~~-~m~VswvT~~~~-~~~V~Yg~~~~~~~~~~~~~~~~~~~~~y~~~~~~sg  106 (452)
T KOG1378|consen   29 LLSESEQLTFPSVVNSPEQVHLSFTDNLN-EMRVSWVTGDGE-ENVVRYGEVKDKLDNSAARGMTEAWTDGYANGWRDSG  106 (452)
T ss_pred             cccccccccCcccCCCCCeEEEeccCCCC-cEEEEEeCCCCC-CceEEEeecCCCccccccccceEEEecccccccceee
Confidence            56788899999999999999999998764 999999998643 4999999765542     1223333333333346789


Q ss_pred             EEEEEEecCCCCCCEEEEEeCcC-CceeeEEEECCCCCCCCCCeEEEEEEcCCCCCCcHHHHHHHHhCCCCCceEEEccc
Q 045849           76 YIHHCTIRHLEFNTKYYYVVGIG-HTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGD  154 (320)
Q Consensus        76 ~~~~~~l~~L~p~t~Y~Y~v~~~-~~s~~~~F~t~p~~~~~~~~~f~~~gD~~~~~~~~~~l~~~~~~~~~~d~vl~~GD  154 (320)
                      ++|+|++++|+|+|+|+|+||++ .||+.++|+|+|  ++..+.+|+++||++.......++....+.. ++|+|||.||
T Consensus       107 ~ih~~~~~~L~~~t~YyY~~Gs~~~wS~~f~F~t~p--~~~~~~~~~i~GDlG~~~~~~s~~~~~~~~~-k~d~vlhiGD  183 (452)
T KOG1378|consen  107 YIHDAVMKNLEPNTRYYYQVGSDLKWSEIFSFKTPP--GQDSPTRAAIFGDMGCTEPYTSTLRNQEENL-KPDAVLHIGD  183 (452)
T ss_pred             eEeeeeecCCCCCceEEEEeCCCCCcccceEeECCC--CccCceeEEEEccccccccccchHhHHhccc-CCcEEEEecc
Confidence            99999999999999999999997 589999999988  3457999999999999887777777777763 7999999999


Q ss_pred             ccccCCCCCCCChhhhhHHHHHhhhhccCCeEeCCCCCccccCCCCCCcccCcccceeeeCCCCCCCCCCCcEEEEEeCc
Q 045849          155 LSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRAS  234 (320)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~GNHD~~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~~ys~~~g~  234 (320)
                      ++|+++..+   .+||.|.++++++++.+|+|++.||||.++.+..    .|..|..+|.+|.++..+..+.||||++|+
T Consensus       184 lsYa~~~~n---~~wD~f~r~vEp~As~vPymv~~GNHE~d~~~~~----~F~~y~~Rf~mP~~~s~s~~~l~YSfd~G~  256 (452)
T KOG1378|consen  184 LSYAMGYSN---WQWDEFGRQVEPIASYVPYMVCSGNHEIDWPPQP----CFVPYSARFNMPGNSSESDSNLYYSFDVGG  256 (452)
T ss_pred             hhhcCCCCc---cchHHHHhhhhhhhccCceEEecccccccCCCcc----cccccceeeccCCCcCCCCCceeEEEeecc
Confidence            999988643   6999999999999999999999999999865433    588999999999988777778999999999


Q ss_pred             EEEEEEcccCCC--CCChHHHHHHHHhcccCCCCCCCEEEEEecccceecCCC-CCCccH--HHHHHHHHHHHhCCCcEE
Q 045849          235 VYIIVLSSYSAY--GKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNY-HYMEGE--TMRVMYEPWLVKYKVDVV  309 (320)
Q Consensus       235 v~fi~lds~~~~--~~~~~q~~WL~~~L~~~~~~~~~~~iv~~H~P~~~~~~~-~~~~~~--~~~~~l~~l~~~~~v~lv  309 (320)
                      +|||+|+|+..+  ..+.+|++||+++|++++|++.||+||+.|.|+|++... +..+++  .+|+.|++||-+++||+|
T Consensus       257 vhfv~lsse~~~~~~~~~~QY~WL~~dL~~v~r~~tPWlIv~~HrP~Y~S~~~~~~reG~~~~~~~~LE~l~~~~~VDvv  336 (452)
T KOG1378|consen  257 VHFVVLSTETYYNFLKGTAQYQWLERDLASVDRKKTPWLIVQGHRPMYCSSNDAHYREGEFESMREGLEPLFVKYKVDVV  336 (452)
T ss_pred             EEEEEEeccccccccccchHHHHHHHHHHHhcccCCCeEEEEecccceecCCchhhccCcchhhHHHHHHHHHHhceeEE
Confidence            999999998875  346899999999999998776899999999999998774 455555  789999999999999999


Q ss_pred             EecCccccccC
Q 045849          310 FAGHVHAYERS  320 (320)
Q Consensus       310 l~GH~H~y~Rt  320 (320)
                      |.||.|.|||+
T Consensus       337 f~GHvH~YER~  347 (452)
T KOG1378|consen  337 FWGHVHRYERF  347 (452)
T ss_pred             Eeccceehhcc
Confidence            99999999996

>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>COG5555 Cytolysin, a secreted calcineurin-like phosphatase [Cell motility and secretion] Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG4419 consensus 5' nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1kbp_A 432 Kidney Bean Purple Acid Phosphatase Length = 432 1e-140
4dsy_A 426 Crystal Structure Of Red Kidney Bean Purple Acid Ph 1e-140
2qfp_A 424 Crystal Structure Of Red Kidney Bean Purple Acid Ph 1e-140
1xzw_A426 Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL 1e-127
>pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 Back     alignment and structure 
Iteration: 1

 Score =  494 bits (1273), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/320 (72%), Positives = 268/320 (83%)
Query: 1   MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA 60
           MPLD+DVF+VPPGYNAPQQVHITQGDLVG+A+I+SWVT+DEPG++ V YWSE + +K  A
Sbjct: 11  MPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIA 70
Query: 61  EXXXXXXXXXXXXXXXIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF 120
           +               IHH TIR L++NTKYYY VG+ +T R+F F+TPP+ G DVPY+F
Sbjct: 71  KGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTF 130
Query: 121 GLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSA 180
           GLIGDLGQS+DSN TL+HYE +P+KGQT+LFVGDLSYAD YP HDN RWDTWGRF ERS 
Sbjct: 131 GLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSV 190
Query: 181 AYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVL 240
           AYQPWIWTAGNHEI+F PEI ET PFKP+S+RYHVPY AS ST+PFWYSIKRAS +IIVL
Sbjct: 191 AYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVL 250
Query: 241 SSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPW 300
           SSYSAYG+ TPQY WL++EL KV RSETPWLIVLMH+P YNSYN+H+MEGE MR  +E W
Sbjct: 251 SSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAW 310
Query: 301 LVKYKVDVVFAGHVHAYERS 320
            VKYKVDVVFAGHVHAYERS
Sbjct: 311 FVKYKVDVVFAGHVHAYERS 330
>pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Maybridge Fragment Cc24201 Length = 426 Back     alignment and structure
>pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 Back     alignment and structure
>pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 1e-122
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 1e-120
1ute_A313 Protein (II purple acid phosphatase); tartrate res 5e-30
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 7e-18
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 4e-07
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 8e-07
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 2e-06
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure
 Score =  355 bits (913), Expect = e-122
 Identities = 240/320 (75%), Positives = 282/320 (88%)

Query: 1   MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA 60
           MPLD+DVF+VPPGYNAPQQVHITQGDLVG+A+I+SWVT+DEPG++ V YWSE + +K  A
Sbjct: 3   MPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIA 62

Query: 61  EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF 120
           +GK+ TY+++NY+SG+IHH TIR L++NTKYYY VG+ +T R+F F+TPP+ G DVPY+F
Sbjct: 63  KGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTF 122

Query: 121 GLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSA 180
           GLIGDLGQS+DSN TL+HYE +P+KGQT+LFVGDLSYAD YP HDN RWDTWGRF ERS 
Sbjct: 123 GLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSV 182

Query: 181 AYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVL 240
           AYQPWIWTAGNHEI+F PEI ET PFKP+S+RYHVPY AS ST+PFWYSIKRAS +IIVL
Sbjct: 183 AYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVL 242

Query: 241 SSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPW 300
           SSYSAYG+ TPQY WL++EL KV RSETPWLIVLMH+P YNSYN+H+MEGE MR  +E W
Sbjct: 243 SSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAW 302

Query: 301 LVKYKVDVVFAGHVHAYERS 320
            VKYKVDVVFAGHVHAYERS
Sbjct: 303 FVKYKVDVVFAGHVHAYERS 322
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Length = 313 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Length = 342 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 100.0
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 100.0
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 100.0
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 99.96
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.94
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 99.89
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.88
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.88
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.82
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.61
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.6
2q8u_A 336 Exonuclease, putative; structural genomics, joint 99.47
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.41
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 99.35
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.28
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.27
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 99.24
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.21
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.17
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.15
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.12
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.11
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 99.09
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.07
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.99
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 98.98
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.96
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.95
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.8
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 98.79
3qfk_A 527 Uncharacterized protein; structural genomics, cent 98.65
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 98.62
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 98.61
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 98.6
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 98.49
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 98.44
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 98.29
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.21
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 98.2
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 98.18
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 98.14
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 98.06
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 97.97
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 97.96
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 97.83
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 97.76
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 97.76
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 97.67
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 97.57
1x4x_A106 Fibronectin type-III domain containing protein 3A; 97.55
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 97.53
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 97.52
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 97.5
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 97.47
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 97.46
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 97.46
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 97.4
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 97.4
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 97.36
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 97.33
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 97.32
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 97.31
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 97.3
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 97.28
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 97.27
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 97.27
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 97.27
2crz_A110 Fibronectin type-III domain containing protein 3A; 97.25
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 97.25
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 97.24
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 97.23
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 97.21
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 97.21
1x5x_A109 Fibronectin type-III domain containing protein 3A; 97.19
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.19
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 97.17
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 97.14
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 97.11
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 97.11
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 97.08
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 97.07
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 97.06
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 97.04
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 97.03
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 97.02
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 97.0
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 96.97
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 96.96
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 96.94
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 96.91
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 96.88
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 96.85
1x3d_A118 Fibronectin type-III domain containing protein 3A; 96.85
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 96.84
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 96.83
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 96.83
2crm_A120 Fibronectin type-III domain containing protein 3A; 96.83
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 96.81
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 96.79
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 96.77
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 96.77
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 96.75
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 96.74
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 96.73
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 96.7
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 96.68
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 96.67
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 96.66
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 96.64
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 96.6
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 96.59
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 96.57
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 96.56
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 96.56
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 96.52
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 96.48
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 96.46
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 96.45
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 96.45
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 96.41
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 96.41
3k2m_C101 Monobody HA4; engineered binding protein, antibody 96.39
1oww_A98 FN, fibronectin first type III module, CIG; fibron 96.38
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 96.35
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 96.34
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 96.33
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 96.32
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 96.28
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 96.27
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 96.27
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 96.27
3t04_D103 Monobody 7C12; engineered binding protein, antibod 96.21
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 96.2
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 96.2
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 96.18
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 96.17
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 96.14
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 96.13
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 96.11
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 96.06
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 96.01
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 95.99
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 95.97
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 95.84
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 95.77
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 95.7
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 95.7
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 95.64
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 95.61
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 95.53
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 95.49
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 95.47
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 95.45
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 95.43
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 95.39
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 95.34
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 95.26
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 95.23
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 95.22
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 95.19
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 95.15
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 95.12
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 95.04
1eer_B227 Epobp, erythropoietin receptor; signal transductio 95.04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 94.93
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 94.9
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 94.89
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 94.79
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 94.72
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 94.5
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 94.39
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 94.36
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 94.12
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 93.94
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 93.43
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 93.32
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 92.85
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 92.55
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 92.48
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 92.44
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 92.34
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 92.28
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 92.24
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 92.16
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 91.97
2erj_C247 Cytokine receptor common gamma chain; immune syste 91.93
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 91.89
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 91.61
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 91.46
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 91.15
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 90.59
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 90.43
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 90.42
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 90.15
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 90.0
2gys_A419 Cytokine receptor common beta chain; dimer of inte 89.89
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 89.57
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 89.18
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 89.16
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 87.98
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 85.48
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 85.18
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 84.14
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 83.97
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 82.8
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 81.84
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
Probab=100.00  E-value=2.8e-63  Score=462.84  Aligned_cols=320  Identities=70%  Similarity=1.287  Sum_probs=274.4

Q ss_pred             CCCCCccccCCCCCCCCccEEEEeeCCCCCcEEEEEEeC-CCCCCCeEEEeccCCCCceEEEEEEEEEEeccccceEEEE
Q 045849            1 MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTV-DEPGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHH   79 (320)
Q Consensus         1 ~~~~~~~~~~~~~~~~p~~v~l~~~~~~~~~~~v~W~t~-~~~~~~~v~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (320)
                      ||||..+|++|++.++|+||||+++++++++|+|+|.|. +.++.+.|+|++.++.+..++.|+..+|...+...+++|+
T Consensus         9 ~~~~~~~~~~~~~~~~p~~v~l~~~~~~~~~~~v~W~t~~~~~~~~~V~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (426)
T 1xzw_A            9 MPWDSDVFAVPSGYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSENSKSQKRAMGTVVTYKYYNYTSAFIHH   88 (426)
T ss_dssp             CCTTCGGGCCCCSTTCCEEEEEEECSSSSSCEEEEEEESSCCTTTTEEEEEETTCCCCEEEECEEECCEETTEECCEEEE
T ss_pred             CCCCCCcccCCCCCCCCceEEEEECCCCCCeEEEEEEeCCCCCCCCEEEEecCCCCCceEEEEEEEEEEecCCcCCEEEE
Confidence            899999999999999999999999999889999999998 7778899999998877788888888777655556789999


Q ss_pred             EEecCCCCCCEEEEEeCcCCceeeEEEECCCCCCCCCCeEEEEEEcCCCCCCcHHHHHHHHhCCCCCceEEEcccccccC
Q 045849           80 CTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYAD  159 (320)
Q Consensus        80 ~~l~~L~p~t~Y~Y~v~~~~~s~~~~F~t~p~~~~~~~~~f~~~gD~~~~~~~~~~l~~~~~~~~~~d~vl~~GD~~~~~  159 (320)
                      |+|+||+|||+|+|||+.+.+|+.++|+|+|.+++..++||+++||+|.......+++++.+...+|||||++||++|.+
T Consensus        89 v~l~gL~p~t~Y~Yrv~~g~~s~~~~f~T~p~~~~~~~~~f~~~gD~~~~~~~~~~l~~i~~~~~~~D~vl~~GD~~y~~  168 (426)
T 1xzw_A           89 CTIKDLEYDTKYYYRLGFGDAKRQFWFVTPPKPGPDVPYVFGLIGDIGQTHDSNTTLTHYEQNSAKGQAVLFMGDLSYSN  168 (426)
T ss_dssp             EEECCCCTTCEEEEEECCGGGCEEEEEECCCCCCTTCCEEEEEECSCTTBHHHHHHHHHHHHCTTCCSEEEECSCCCCGG
T ss_pred             EEECCCCCCCEEEEEECCCCccceeEEECCCCCCCCCCeEEEEEEeCCCCCchHHHHHHHHhCCCCCCEEEeCCChhhcc
Confidence            99999999999999999877899999999998777789999999999976544567777776534899999999999986


Q ss_pred             CCCCCCChhhhhHHHHHhhhhccCCeEeCCCCCccccCCCCCCcccCcccceeeeCCCCCCCCCCCcEEEEEeCcEEEEE
Q 045849          160 NYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIV  239 (320)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~GNHD~~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~~ys~~~g~v~fi~  239 (320)
                      +....+..+|+.|.+.++++.+.+|+++++||||+......++...+..|..+|.+|.++.....+.||+|++|+++||+
T Consensus       169 ~~~~~~~~~~~~~~~~l~~l~~~~P~~~v~GNHD~~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~~ys~~~g~~~~i~  248 (426)
T 1xzw_A          169 RWPNHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDYAPDIGEYQPFVPFTNRYPTPHEASGSGDPLWYAIKRASAHIIV  248 (426)
T ss_dssp             GSGGGCTHHHHHHHHHHHHHHTTSCEECCCCGGGCCCBGGGTBCSTTHHHHHHSCCCCGGGTCSSTTSEEEEETTEEEEE
T ss_pred             cCCcccchHHHHHHHHHHHHHhcCCEEEeccccccccCCccccccCChhheEEEeCCcccCCCCCCCeEEEEECCEEEEE
Confidence            64323356799999999998889999999999999743222223345678888889876555567789999999999999


Q ss_pred             EcccCCCCCChHHHHHHHHhcccCCCCCCCEEEEEecccceecCCCCCCccHHHHHHHHHHHHhCCCcEEEecCcccccc
Q 045849          240 LSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYER  319 (320)
Q Consensus       240 lds~~~~~~~~~q~~WL~~~L~~~~~~~~~~~iv~~H~P~~~~~~~~~~~~~~~~~~l~~l~~~~~v~lvl~GH~H~y~R  319 (320)
                      ||++..++.+.+|++||+++|+++++++.+|+||++|+|+++....+..++..+|+.|.++|++++|++||+||+|.|+|
T Consensus       249 Ldt~~~~~~~~~Q~~WL~~~L~~~~~~~~~w~Iv~~H~P~~~~~~~~~~~~~~~r~~l~~ll~~~~VdlvlsGH~H~~~r  328 (426)
T 1xzw_A          249 LSSYSGFVKYSPQYKWFTSELEKVNRSETPWLIVLVHAPLYNSYEAHYMEGEAMRAIFEPYFVYYKVDIVFSGHVHSYER  328 (426)
T ss_dssp             CCTTSCCSTTSHHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSSSSEEE
T ss_pred             eeCcccCCCCHHHHHHHHHHHHhhhhcCCCEEEEEeccCceeCCCcccCCCHHHHHHHHHHHHHhCCCEEEEcChhhhee
Confidence            99988777789999999999999766678999999999999876544455677899999999999999999999999998


Q ss_pred             C
Q 045849          320 S  320 (320)
Q Consensus       320 t  320 (320)
                      +
T Consensus       329 ~  329 (426)
T 1xzw_A          329 S  329 (426)
T ss_dssp             E
T ss_pred             e
Confidence            4
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 320
d2qfra2 312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 4e-61
d2qfra1112 b.1.12.1 (A:9-120) Purple acid phosphatase, N-term 1e-43
d1xzwa1119 b.1.12.1 (A:1-119) Purple acid phosphatase, N-term 3e-40
d1utea_302 d.159.1.1 (A:) Mammalian purple acid phosphatase { 5e-12
d2nxfa1320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 3e-05
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 6e-04
d2hy1a1256 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide pho 0.001
d2yvta1257 d.159.1.6 (A:4-260) Uncharacterized protein Aq_195 0.004
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  195 bits (496), Expect = 4e-61
 Identities = 166/210 (79%), Positives = 185/210 (88%)

Query: 111 EVGPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWD 170
           + G DVPY+FGLIGDLGQS+DSN TL+HYE +P+KGQT+LFVGDLSYAD YP HDN RWD
Sbjct: 1   QTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWD 60

Query: 171 TWGRFVERSAAYQPWIWTAGNHEIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSI 230
           TWGRF ERS AYQPWIWTAGNHEI+F PEI ET PFKP+S+RYHVPY AS ST+PFWYSI
Sbjct: 61  TWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSI 120

Query: 231 KRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLIVLMHAPWYNSYNYHYMEG 290
           KRAS +IIVLSSYSAYG+ TPQY WL++EL KV RSETPWLIVLMH+P YNSYN+H+MEG
Sbjct: 121 KRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEG 180

Query: 291 ETMRVMYEPWLVKYKVDVVFAGHVHAYERS 320
           E MR  +E W VKYKVDVVFAGHVHAYERS
Sbjct: 181 EAMRTKFEAWFVKYKVDVVFAGHVHAYERS 210
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Length = 302 Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 256 Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 100.0
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 99.96
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.96
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 99.95
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.9
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.87
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.81
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.69
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.65
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.13
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.07
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 98.97
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.94
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.9
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 98.87
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.84
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.55
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.39
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.03
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 97.97
d1x5xa196 Fibronectin type-III domain containing protein 3a, 97.89
d1x4xa193 Fibronectin type-III domain containing protein 3a, 97.88
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.87
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.86
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 97.8
d2crza197 Fibronectin type-III domain containing protein 3a, 97.8
d1x3da1105 Fibronectin type-III domain containing protein 3a, 97.76
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 97.72
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.69
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 97.69
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.68
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 97.67
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 97.66
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.65
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.56
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 97.51
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 97.45
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.43
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.41
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 97.38
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 97.37
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 97.36
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.34
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.32
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.28
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.23
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.23
d1va9a1109 Down syndrome cell adhesion molecule-like protein 97.2
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 97.19
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 97.19
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 97.18
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 97.17
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 97.16
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 97.15
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 97.11
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 97.11
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 97.1
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.08
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 97.07
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 97.03
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 97.01
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 96.97
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 96.96
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 96.93
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 96.92
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.89
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 96.88
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 96.85
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.82
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.8
d2crma1107 Fibronectin type-III domain containing protein 3a, 96.8
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 96.78
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 96.69
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 96.67
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 96.63
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 96.63
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 96.61
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 96.59
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.52
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 96.51
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 96.48
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.44
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.33
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 96.32
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 96.3
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 95.85
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 95.83
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 95.81
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 95.79
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 95.55
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 95.43
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 95.22
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 94.96
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 94.67
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 94.43
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 94.35
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 94.11
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 93.43
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 93.0
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 92.91
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 92.27
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 91.09
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 87.44
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.1e-45  Score=327.43  Aligned_cols=208  Identities=80%  Similarity=1.386  Sum_probs=178.8

Q ss_pred             CCCCCeEEEEEEcCCCCCCcHHHHHHHHhCCCCCceEEEcccccccCCCCCCCChhhhhHHHHHhhhhccCCeEeCCCCC
Q 045849          113 GPDVPYSFGLIGDLGQSYDSNVTLTHYERNPRKGQTLLFVGDLSYADNYPCHDNNRWDTWGRFVERSAAYQPWIWTAGNH  192 (320)
Q Consensus       113 ~~~~~~~f~~~gD~~~~~~~~~~l~~~~~~~~~~d~vl~~GD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~GNH  192 (320)
                      |++.++||+++||+|.......++.++.....+|||||++||++|+++....+..+|+.|++.++++...+|+++++|||
T Consensus         3 g~~~p~~F~v~GD~g~~~~~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~wd~~~~~~~~~~~~~P~~~~~GNH   82 (312)
T d2qfra2           3 GLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNH   82 (312)
T ss_dssp             CSSCCEEEEEECSCCSBHHHHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECCCGG
T ss_pred             CCCCCEEEEEEeeCCCCCchHHHHHHHHHcCCCCCEEEECCCCCcCCCCcccchHHHHHHHHHHHHHhhcceEEEecccc
Confidence            45679999999999887666667766544445899999999999987765556678999999999999999999999999


Q ss_pred             ccccCCCCCCcccCcccceeeeCCCCCCCCCCCcEEEEEeCcEEEEEEcccCCCCCChHHHHHHHHhcccCCCCCCCEEE
Q 045849          193 EIDFYPEIGETVPFKPYSHRYHVPYRASGSTAPFWYSIKRASVYIIVLSSYSAYGKYTPQYKWLEEELPKVNRSETPWLI  272 (320)
Q Consensus       193 D~~~~~~~~~~~~~~~~~~~f~~p~~~~~~~~~~~ys~~~g~v~fi~lds~~~~~~~~~q~~WL~~~L~~~~~~~~~~~i  272 (320)
                      |+......+....+..|..+|.+|.++.....+.||+|++|+++||+||++..+..+.+|++||+++|+++++++.+|+|
T Consensus        83 D~~~~~~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~~~~~~~Q~~WL~~~L~~~~~~~~~w~i  162 (312)
T d2qfra2          83 EIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLI  162 (312)
T ss_dssp             GTCCBGGGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSCCSTTSHHHHHHHHHHHTCCTTTCCEEE
T ss_pred             cccccccccccccccchhhhccCCccccCCCCCceEEEEECCEEEEEeeccccccchHHHHHHHHHHHHHHhhcCCCEEE
Confidence            98654433444556778889999988766677889999999999999999988888899999999999998778899999


Q ss_pred             EEecccceecCCCCCCccHHHHHHHHHHHHhCCCcEEEecCccccccC
Q 045849          273 VLMHAPWYNSYNYHYMEGETMRVMYEPWLVKYKVDVVFAGHVHAYERS  320 (320)
Q Consensus       273 v~~H~P~~~~~~~~~~~~~~~~~~l~~l~~~~~v~lvl~GH~H~y~Rt  320 (320)
                      |++|+|+|++.......+..+|+.|.+||++++||+||+||+|.||||
T Consensus       163 v~~H~P~y~~~~~~~~~~~~~r~~l~~l~~~~~Vdlv~~GH~H~YeRt  210 (312)
T d2qfra2         163 VLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERS  210 (312)
T ss_dssp             EECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSSSSEEEE
T ss_pred             EEccccccccCCCCcccchhHHHHHHHHHHHcCcEEEEEccCcceEEE
Confidence            999999999876655567789999999999999999999999999996
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure