Citrus Sinensis ID: 045884

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAIRE
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccEEEccccEEEEccHHHHHHHHHccccccccccccHHHHHHccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccEEEEccHHHHHHHHHHccccccccccHHHHHHHccccccc
MEFSVKSIAFGIVIVTVVTWACKILnwawlkpkkpekqlrrqgfrgnsyrflfgdvkehdilsrqakskpisldddiaprvvplydqqeklygkntywwigpipminimdpdqIKEVFTNindfqkpktnplgkiLTTRLAIRE
mefsvksiAFGIVIVTVVTWACKILnwawlkpkkpekqlrrqgfrgNSYRFLfgdvkehdilsrqakskpisldddiaprVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNindfqkpktnplgkilttrlaire
MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAIRE
****VKSIAFGIVIVTVVTWACKILNWAWLKP*********QGFRGNSYRFLFGDVKEHDILS********SLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQK*****LGKILT*******
*EFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHD***************DIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAIR*
MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAIRE
*EFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAI**
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPKTNPLGKILTTRLAIRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q05047 524 Secologanin synthase OS=C N/A no 0.916 0.251 0.466 1e-30
Q9SHG5 519 Cytochrome P450 72C1 OS=A no no 0.979 0.271 0.340 4e-24
O48786 520 Cytochrome P450 734A1 OS= no no 0.868 0.240 0.340 8e-17
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.805 0.208 0.336 1e-14
B9X287 542 Cytochrome P450 734A6 OS= no no 0.791 0.210 0.347 4e-14
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.791 0.211 0.307 6e-13
Q8LIF2 537 Cytochrome P450 734A5 OS= no no 0.722 0.193 0.345 2e-12
Q9ZW95 512 Cytokinin hydroxylase OS= no no 0.805 0.226 0.297 2e-08
Q9FF18 518 Cytokinin hydroxylase OS= no no 0.770 0.214 0.294 6e-07
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 92/135 (68%), Gaps = 3/135 (2%)

Query: 6   KSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQ 65
           K+IA   +   V+ WA ++L+WAW  PK+ EK+LR+QGFRGN YRFL GDVKE   + ++
Sbjct: 10  KAIA-ATIFALVMAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVKESGKMHQE 68

Query: 66  AKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQ 125
           A SKP+  ++DI PR++P  +     YG+N++ W+G IP I++M+P+ IKEV T+ + +Q
Sbjct: 69  ALSKPMEFNNDIVPRLMPHINHTINTYGRNSFTWMGRIPRIHVMEPELIKEVLTHSSKYQ 128

Query: 126 K--PKTNPLGKILTT 138
           K     NPL K L T
Sbjct: 129 KNFDVHNPLVKFLLT 143
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
373501798 518 cytochrome P450 CYP72A129 [Panax ginseng 1.0 0.277 0.513 2e-36
224105979 518 cytochrome P450 [Populus trichocarpa] gi 0.993 0.276 0.513 4e-35
224119126 518 cytochrome P450 [Populus trichocarpa] gi 0.993 0.276 0.506 9e-35
224119134 518 cytochrome P450 [Populus trichocarpa] gi 0.993 0.276 0.493 2e-34
147777099 471 hypothetical protein VITISV_001871 [Viti 0.993 0.303 0.486 1e-33
359494406 516 PREDICTED: LOW QUALITY PROTEIN: secologa 0.993 0.277 0.479 2e-33
296082833 529 unnamed protein product [Vitis vinifera] 0.958 0.260 0.485 2e-33
296082838 417 unnamed protein product [Vitis vinifera] 0.993 0.342 0.479 2e-33
359494591 391 PREDICTED: secologanin synthase-like [Vi 0.979 0.360 0.453 2e-33
225462970 516 PREDICTED: secologanin synthase [Vitis v 0.958 0.267 0.485 2e-33
>gi|373501798|gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng] Back     alignment and taxonomy information
 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (68%)

Query: 1   MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHD 60
           ME  +K I+    IV V+    +I NW WL+P+K EK LR QGF GNSYR  FGDVKE  
Sbjct: 1   MELVLKLISSFCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMI 60

Query: 61  ILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTN 120
           ++ ++AKSKPI+L DDI PR++PL  +    YGKN++ W+GP PM++IM+PD IK+V + 
Sbjct: 61  VMLKEAKSKPINLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSK 120

Query: 121 INDFQKPKTNPLGKILTTRLAIRE 144
              FQKP+ NPL K+L T +A  E
Sbjct: 121 FYQFQKPRHNPLTKLLATGVADAE 144

Source: Panax ginseng

Species: Panax ginseng

Genus: Panax

Family: Araliaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119126|ref|XP_002331331.1| cytochrome P450 [Populus trichocarpa] gi|222873914|gb|EEF11045.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777099|emb|CAN63404.1| hypothetical protein VITISV_001871 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494406|ref|XP_003634774.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082833|emb|CBI22134.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082838|emb|CBI22139.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494591|ref|XP_003634812.1| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462970|ref|XP_002270326.1| PREDICTED: secologanin synthase [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
TAIR|locus:2089521 512 CYP72A15 ""cytochrome P450, fa 0.979 0.275 0.496 4.1e-33
TAIR|locus:2089621 512 CYP72A14 ""cytochrome P450, fa 0.972 0.273 0.5 3.5e-31
TAIR|locus:2089596 512 CYP72A13 ""cytochrome P450, fa 0.972 0.273 0.478 4.7e-31
TAIR|locus:2089586 512 CYP72A11 ""cytochrome P450, fa 0.958 0.269 0.463 1.8e-30
TAIR|locus:2089526 512 CYP72A7 ""cytochrome P450, fam 0.972 0.273 0.446 3.4e-29
TAIR|locus:2089531 515 CYP72A8 ""cytochrome P450, fam 0.993 0.277 0.423 6.2e-28
TAIR|locus:2089561 514 CYP72A10 ""cytochrome P450, fa 0.958 0.268 0.442 8e-28
TAIR|locus:2089546 508 CYP72A9 ""cytochrome P450, fam 0.951 0.269 0.432 7.8e-24
TAIR|locus:2043823 520 BAS1 "PHYB ACTIVATION TAGGED S 0.909 0.251 0.320 3.7e-16
UNIPROTKB|Q6Z6D6 557 CYP734A2 "Cytochrome P450 734A 0.888 0.229 0.312 8.5e-15
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 361 (132.1 bits), Expect = 4.1e-33, P = 4.1e-33
 Identities = 70/141 (49%), Positives = 87/141 (61%)

Query:     1 MEFSVKSIAFGIVIVTVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHD 60
             ME SV S+   +V+  V  W  + L W W KPK  E  LRRQG  G  Y  L GD+K++ 
Sbjct:     1 MEISVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNF 60

Query:    61 ILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTN 120
              +  +A+SKP+ L DDI+PRVVP   Q  K YG+  + W GPIP I IMDP+QIKEVF  
Sbjct:    61 TMLSEARSKPLKLTDDISPRVVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNK 120

Query:   121 INDFQKPKTNPLGKILTTRLA 141
             + DFQKP T PL  I+   LA
Sbjct:   121 VYDFQKPHTFPLATIIAKGLA 141
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z6D6 CYP734A2 "Cytochrome P450 734A2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP72A47
cytochrome P450 (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-11
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score = 60.2 bits (146), Expect = 2e-11
 Identities = 33/95 (34%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 29  WLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPI-SLDDDIAPRVVPLYDQ 87
           +L P++ +K + RQG RG   R L G++ +   L  Q+ SK + S+  DI  R++P Y  
Sbjct: 29  FLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVA 88

Query: 88  QEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNIN 122
             K YGK   +W G  P + + + + IKE+ T  N
Sbjct: 89  WSKQYGKRFIYWNGTEPRLCLTETELIKELLTKYN 123

Length = 516

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
PLN02290 516 cytokinin trans-hydroxylase 99.7
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.46
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.43
PTZ00404 482 cytochrome P450; Provisional 99.39
PLN02196 463 abscisic acid 8'-hydroxylase 99.34
PLN02687 517 flavonoid 3'-monooxygenase 99.27
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.25
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.25
PLN00168 519 Cytochrome P450; Provisional 99.25
PLN03112 514 cytochrome P450 family protein; Provisional 99.23
PLN02183 516 ferulate 5-hydroxylase 99.23
PLN02774 463 brassinosteroid-6-oxidase 99.21
PLN02971 543 tryptophan N-hydroxylase 99.21
PLN03234 499 cytochrome P450 83B1; Provisional 99.19
PLN02500 490 cytochrome P450 90B1 99.13
PLN02394 503 trans-cinnamate 4-monooxygenase 99.12
PLN02966 502 cytochrome P450 83A1 99.04
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.03
PLN02655 466 ent-kaurene oxidase 99.02
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.02
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.98
PLN02302 490 ent-kaurenoic acid oxidase 98.95
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.94
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 98.9
PLN02738 633 carotene beta-ring hydroxylase 98.89
PLN03018 534 homomethionine N-hydroxylase 98.81
PLN02936 489 epsilon-ring hydroxylase 98.62
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 98.0
PLN02426 502 cytochrome P450, family 94, subfamily C protein 97.99
PLN02648 480 allene oxide synthase 97.82
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 97.38
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information 
Probab=99.70  E-value=6.4e-16  Score=122.84  Aligned_cols=129  Identities=26%  Similarity=0.388  Sum_probs=88.3

Q ss_pred             HHHHHHHHHHhHHhcccchhHHHHHhcCCCCCCCcccCCCHHHHHHHHHhhcCCCCCCC-CCcccchhhhHHHHHHHhCC
Q 045884           16 TVVTWACKILNWAWLKPKKPEKQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLD-DDIAPRVVPLYDQQEKLYGK   94 (144)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pgp~~~pl~Gn~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~yg~   94 (144)
                      +.+-++|+.+..+++.++++..+++++++|||+++|++||+.++.....+...+...-. ++...+....+.+|.++||+
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~   95 (516)
T PLN02290         16 LLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGK   95 (516)
T ss_pred             HHHHHHHHHHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhcCCCCCCCcccccccchHHHHHHHHhCC
Confidence            34455566677788999999999999999999999999999888643222100000000 11111223356789999999


Q ss_pred             eEEEeeCCcCeEEEcChhHHHHHH-hcCCCCCCCCc--ccccccccccccccC
Q 045884           95 NTYWWIGPIPMINIMDPDQIKEVF-TNINDFQKPKT--NPLGKILTTRLAIRE  144 (144)
Q Consensus        95 v~~~~~g~~~~vvv~dPe~ik~VL-~~~~~f~k~~~--~~~~~~lG~GLl~s~  144 (144)
                      ++.+|.|+.+.++++||+++++++ ++...+.++..  ....+.+|+|+++++
T Consensus        96 i~~~~~g~~~~vvv~dp~~v~~il~~~~~~~~r~~~~~~~~~~~~g~~l~~~~  148 (516)
T PLN02290         96 RFIYWNGTEPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFIGRGLLMAN  148 (516)
T ss_pred             eEEEccCCccEEEECCHHHHHHHHhcCCCCCCCcchhhhHHHHHhcCCccccC
Confidence            999999999999999999999999 44333355432  123445688887653

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-09
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-08
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-07
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score = 54.2 bits (131), Expect = 1e-09
 Identities = 9/59 (15%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 71  ISLDDDIAPRVVP-LYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEVFTNINDFQKPK 128
           ++  D++  RV+  ++    K YG      +     + +  P+ +K+   +    +  K
Sbjct: 1   MAKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSK 59
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.42
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.21
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.19
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.19
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.17
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.11
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.11
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.09
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.05
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.03
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.02
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.0
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 98.94
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 98.93
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 98.9
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 98.88
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 98.84
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 98.84
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 98.84
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 98.8
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 98.75
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 98.72
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.71
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 98.68
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 98.67
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 98.65
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.55
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.28
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.16
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 97.82
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 97.76
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 97.55
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 97.55
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 97.42
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 97.4
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 97.39
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 97.37
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 97.37
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 97.36
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 97.35
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 97.24
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 97.17
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.15
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 97.07
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 97.05
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 97.02
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 96.97
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 96.97
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 96.9
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 96.78
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 96.74
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 96.65
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 96.64
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 96.61
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 96.52
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 96.52
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 96.5
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 96.48
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 96.47
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 96.36
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 96.21
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 96.2
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 96.11
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 96.01
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 96.0
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 95.94
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 95.86
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 95.46
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 95.46
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 95.09
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 94.52
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 94.02
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 92.09
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 91.87
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 91.04
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 83.6
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 83.15
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 80.51
1iij_A35 ERBB-2 receptor protein-tyrosine kinase; alpha-hel 80.47
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.42  E-value=2.1e-13  Score=105.54  Aligned_cols=89  Identities=22%  Similarity=0.382  Sum_probs=67.4

Q ss_pred             HHHHhcCCCCCCCcccCCCHHHHHHHHHhhcCCCCCCCCCcccchhhhHHHHHHHhCCeEEEeeCCcCeEEEcChhHHHH
Q 045884           37 KQLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKE  116 (144)
Q Consensus        37 ~~~~~~~~pgp~~~pl~Gn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yg~v~~~~~g~~~~vvv~dPe~ik~  116 (144)
                      .+++++++|||++.|++||+.++..                  .....+.+|.++||++++++.|+.+.++++||+++++
T Consensus         9 ~~~k~~~~PGP~~~PliGn~~~~~~------------------~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~~   70 (485)
T 3nxu_A            9 GLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKT   70 (485)
T ss_dssp             THHHHHTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHH
T ss_pred             hHHhhCCCCCCCCcCeecCcHHhhc------------------ChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHHH
Confidence            4567789999999999999877642                  1134567899999999999999999999999999999


Q ss_pred             HH-hc-CCCCCCCC-cccccccccccccccC
Q 045884          117 VF-TN-INDFQKPK-TNPLGKILTTRLAIRE  144 (144)
Q Consensus       117 VL-~~-~~~f~k~~-~~~~~~~lG~GLl~s~  144 (144)
                      ++ ++ .+.|.+.. .... .++|.|+++++
T Consensus        71 il~~~~~~~f~~r~~~~~~-~~~~~~l~~~~  100 (485)
T 3nxu_A           71 VLVKECYSVFTNRRPFGPV-GFMKSAISIAE  100 (485)
T ss_dssp             HHTTTTTTTCCCCCCCSCC-GGGGGSTTTCC
T ss_pred             HHhccchhhccCCcccccc-cccccCccccC
Confidence            99 54 45664432 2222 35677877653
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 0.003
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.7 bits (78), Expect = 0.003
 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 90  KLYGKNTYWWIGPIPMINIMDPDQIKEVF-TNINDFQKPKTNPLGKILTTRLAI 142
           K+YG     + G  P++ +   + +KE       +F      PL +       I
Sbjct: 34  KVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGI 87

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.46
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.3
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.27
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.2
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.18
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.16
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.51
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.12
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 97.03
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 96.77
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 96.42
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 95.33
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 93.96
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 92.77
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 92.3
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 90.62
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 84.18
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 83.42
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.46  E-value=6.8e-14  Score=105.47  Aligned_cols=89  Identities=20%  Similarity=0.284  Sum_probs=66.9

Q ss_pred             HHHhcCCCCCCCcccCCCHHHHHHHHHhhcCCCCCCCCCcccchhhhHHHHHHHhCCeEEEeeCCcCeEEEcChhHHHHH
Q 045884           38 QLRRQGFRGNSYRFLFGDVKEHDILSRQAKSKPISLDDDIAPRVVPLYDQQEKLYGKNTYWWIGPIPMINIMDPDQIKEV  117 (144)
Q Consensus        38 ~~~~~~~pgp~~~pl~Gn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yg~v~~~~~g~~~~vvv~dPe~ik~V  117 (144)
                      .++++|+|||+++|++||+.++.+                  ....++.++.++||+++++++|+.++++++||++++++
T Consensus         5 ~~~~~~iPGP~~~P~iG~~~~~~~------------------~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~i   66 (472)
T d1tqna_           5 LFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTV   66 (472)
T ss_dssp             HHHHTTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHH
T ss_pred             chhhcCCCCCCCcCceeEHHHhhC------------------CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHH
Confidence            467789999999999999887753                  12346789999999999999999999999999999999


Q ss_pred             H-hcCCCCCCCC-cccccccccccccccC
Q 045884          118 F-TNINDFQKPK-TNPLGKILTTRLAIRE  144 (144)
Q Consensus       118 L-~~~~~f~k~~-~~~~~~~lG~GLl~s~  144 (144)
                      + ++...+.++. ........|+|+++++
T Consensus        67 l~~~~~~~~~~~~~~~~~~~~~~~i~~~~   95 (472)
T d1tqna_          67 LVKECYSVFTNRRPFGPVGFMKSAISIAE   95 (472)
T ss_dssp             HTTTTTTTCCBCCCCSCCGGGGGSTTTCC
T ss_pred             HhcCCcccccCCcccccccccCCceeccC
Confidence            9 5443332222 1123345678887754
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure