Citrus Sinensis ID: 045942
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 225441815 | 874 | PREDICTED: putative disease resistance p | 0.969 | 0.145 | 0.460 | 1e-23 | |
| 147777286 | 815 | hypothetical protein VITISV_009157 [Viti | 0.854 | 0.137 | 0.513 | 3e-23 | |
| 356506536 | 831 | PREDICTED: disease resistance protein RG | 0.900 | 0.141 | 0.420 | 5e-21 | |
| 255577491 | 860 | leucine-rich repeat containing protein, | 0.916 | 0.139 | 0.426 | 9e-21 | |
| 356570458 | 857 | PREDICTED: disease resistance protein RG | 0.900 | 0.137 | 0.420 | 2e-20 | |
| 356571981 | 754 | PREDICTED: disease resistance protein RG | 0.900 | 0.156 | 0.428 | 7e-20 | |
| 356570433 | 856 | PREDICTED: disease resistance protein RG | 0.900 | 0.137 | 0.436 | 2e-19 | |
| 224069146 | 1053 | cc-nbs-lrr resistance protein [Populus t | 0.633 | 0.078 | 0.488 | 1e-18 | |
| 224069120 | 968 | nbs-lrr resistance protein [Populus tric | 0.633 | 0.085 | 0.488 | 1e-18 | |
| 351720930 | 863 | disease resistance protein [Glycine max] | 0.916 | 0.139 | 0.396 | 1e-18 |
| >gi|225441815|ref|XP_002277987.1| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 114 bits (285), Expect = 1e-23, Method: Compositional matrix adjust.
Identities = 59/128 (46%), Positives = 83/128 (64%), Gaps = 1/128 (0%)
Query: 3 HHDRKNTRPHLRRVVIGEITQFLELPQWLLQ-CCTDTLQSLIIVDCPNFMALPGSLKDLE 61
+D + LR +++ ++ + LP WL+Q TL L+I C F ALP SL++L
Sbjct: 744 ENDIQGISCRLRSLMVVDLPKLEALPGWLIQGLAASTLHYLLIRRCHKFKALPESLENLT 803
Query: 62 ALETLVIARCPKLSSLPEDMHHVTTLKSLAIAECPALSERCKPPTGEDWPKIAHIPEILL 121
+L+ L I CP+LS+L MH +TTLK L+I +CP LS+RCKP GEDW KIAH+PEI +
Sbjct: 804 SLQELRIDDCPQLSTLSGGMHRLTTLKVLSIRDCPELSKRCKPEIGEDWHKIAHVPEIYI 863
Query: 122 DDKMIKSS 129
D + IKS+
Sbjct: 864 DGEAIKST 871
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147777286|emb|CAN69089.1| hypothetical protein VITISV_009157 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356506536|ref|XP_003522036.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255577491|ref|XP_002529624.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223530909|gb|EEF32769.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356570458|ref|XP_003553404.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356571981|ref|XP_003554149.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356570433|ref|XP_003553392.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224069146|ref|XP_002302911.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222844637|gb|EEE82184.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224069120|ref|XP_002302905.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222844631|gb|EEE82178.1| nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351720930|ref|NP_001235657.1| disease resistance protein [Glycine max] gi|223452597|gb|ACM89625.1| disease resistance protein [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| TAIR|locus:2175433 | 811 | ADR1-L2 "ADR1-like 2" [Arabido | 0.664 | 0.107 | 0.348 | 1.8e-07 | |
| TAIR|locus:2171479 | 623 | ADR1-L3 "ADR1-like 3" [Arabido | 0.664 | 0.139 | 0.337 | 2.1e-07 | |
| TAIR|locus:2119196 | 816 | ADR1-L1 "ADR1-like 1" [Arabido | 0.687 | 0.110 | 0.351 | 3e-07 | |
| TAIR|locus:2006932 | 787 | ADR1 "ACTIVATED DISEASE RESIST | 0.648 | 0.108 | 0.340 | 5.6e-06 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.694 | 0.076 | 0.311 | 9.1e-06 | |
| TAIR|locus:2174944 | 815 | AT5G66910 [Arabidopsis thalian | 0.541 | 0.087 | 0.356 | 1.2e-05 | |
| TAIR|locus:2152536 | 908 | AT5G48620 [Arabidopsis thalian | 0.458 | 0.066 | 0.383 | 2.3e-05 | |
| TAIR|locus:2091662 | 1424 | AT3G14460 [Arabidopsis thalian | 0.458 | 0.042 | 0.383 | 3.8e-05 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.618 | 0.040 | 0.321 | 7e-05 | |
| TAIR|locus:2176486 | 908 | RPP8 "RECOGNITION OF PERONOSPO | 0.458 | 0.066 | 0.366 | 0.00013 |
| TAIR|locus:2175433 ADR1-L2 "ADR1-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 131 (51.2 bits), Expect = 1.8e-07, P = 1.8e-07
Identities = 31/89 (34%), Positives = 49/89 (55%)
Query: 11 PHLRRVVIGEITQFLELPQWLLQCCTDTLQSLIIVDCPNFMALPGSLKDLEALETLVIAR 70
P L + I LELP + C +L S+ I +CP LP +L L+AL+ L +
Sbjct: 651 PKLSDLTIDHCDDLLELPSTI--CGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYA 708
Query: 71 CPKLSSLPEDMHHVTTLKSLAIAECPALS 99
C +L+SLP ++ + LK + I++C +LS
Sbjct: 709 CHELNSLPVEICELPRLKYVDISQCVSLS 737
|
|
| TAIR|locus:2171479 ADR1-L3 "ADR1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119196 ADR1-L1 "ADR1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2006932 ADR1 "ACTIVATED DISEASE RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174944 AT5G66910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 6e-04 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 0.002 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 37.9 bits (88), Expect = 6e-04
Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
Query: 31 LLQCCTDTLQSLIIVDCPNFMALPGSLKDLEALETLVIARCPKLSSLPEDMHHVTTLKSL 90
L+ + +L L + D P+ + LP S+++L LE L I C L +LP + ++ +L+SL
Sbjct: 772 LMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESL 830
Query: 91 AIAECPALSERCKP 104
++ C L R P
Sbjct: 831 DLSGCSRL--RTFP 842
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.01 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.99 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.93 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.9 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.69 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.68 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.55 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.52 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.44 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.44 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.38 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.29 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.26 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.12 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.06 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.05 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.04 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.97 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.97 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.96 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.8 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.71 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.67 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.55 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.45 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.4 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.37 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.17 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.15 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.05 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.02 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.02 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 96.97 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.87 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.87 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.81 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.75 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.6 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 96.57 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.42 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 96.2 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.09 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.99 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.9 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 95.65 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.64 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.57 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.41 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.92 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.65 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.31 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.91 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 93.83 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 92.97 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 91.99 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 91.83 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 91.23 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 90.95 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 90.95 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 90.69 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 90.19 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 90.15 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 89.01 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 86.97 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 86.54 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 84.32 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 83.3 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 81.48 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 80.98 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.01 E-value=1.3e-09 Score=91.99 Aligned_cols=90 Identities=28% Similarity=0.543 Sum_probs=69.4
Q ss_pred CCCCCC-ccceEeecCcCCCcccchhhhccCCCCcCEEeecCCCCcccCCCCCCCcccccccccccccccCcCCCCCCCC
Q 045942 6 RKNTRP-HLRRVVIGEITQFLELPQWLLQCCTDTLQSLIIVDCPNFMALPGSLKDLEALETLVIARCPKLSSLPEDMHHV 84 (131)
Q Consensus 6 ~~i~~l-~L~~L~i~~c~~l~~lp~~~~~~~l~~L~~L~l~~~~~l~~lp~~l~~l~sL~~L~l~~c~~l~~lp~~~~~l 84 (131)
..+..+ +|+.|+++++..++.+|. + ..+++|+.|++.+|..+..+|..++++++|+.|++.+|..++.+|..+ ++
T Consensus 628 ~~~~~l~~Lk~L~Ls~~~~l~~ip~-l--s~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l 703 (1153)
T PLN03210 628 DGVHSLTGLRNIDLRGSKNLKEIPD-L--SMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NL 703 (1153)
T ss_pred cccccCCCCCEEECCCCCCcCcCCc-c--ccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CC
Confidence 445566 788888877777777764 4 567888888888888888888888888888888888888888888765 67
Q ss_pred CCcCeEeecCCchhh
Q 045942 85 TTLKSLAIAECPALS 99 (131)
Q Consensus 85 ~~L~~L~i~~~~~l~ 99 (131)
++|+.|.+.+|..+.
T Consensus 704 ~sL~~L~Lsgc~~L~ 718 (1153)
T PLN03210 704 KSLYRLNLSGCSRLK 718 (1153)
T ss_pred CCCCEEeCCCCCCcc
Confidence 788888888886553
|
syringae 6; Provisional |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 131 | ||||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 3e-04 |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 45.7 bits (109), Expect = 7e-07
Identities = 20/79 (25%), Positives = 30/79 (37%), Gaps = 2/79 (2%)
Query: 12 HLRRVVIGEITQFLELPQWLLQCCTDTLQSLIIVDCPNFMALPGSLKDLEALETLVIARC 71
L + + T P L+ LI+ DC N + LP + L LE L + C
Sbjct: 230 KLEELDLRGCTALRNYPPIFGGRAP--LKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGC 287
Query: 72 PKLSSLPEDMHHVTTLKSL 90
LS LP + + +
Sbjct: 288 VNLSRLPSLIAQLPANCII 306
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.4 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.36 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.16 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.14 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.13 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.11 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.1 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.1 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.09 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.03 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.02 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.02 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.01 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.01 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.0 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.0 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.0 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.99 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.99 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.98 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.98 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.97 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.97 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.97 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.96 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.96 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.96 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.96 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.95 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.95 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.94 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.94 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.94 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.93 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.93 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.93 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.93 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.9 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.9 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.9 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.89 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.89 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.89 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.89 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.88 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.88 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.87 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.87 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.86 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.86 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.86 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.86 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.85 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.85 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.84 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.84 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.83 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.83 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.83 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.82 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.82 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.82 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.81 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.79 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.79 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.79 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.78 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.76 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.76 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.76 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.75 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.75 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.74 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.74 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.74 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.74 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.73 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.73 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.73 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.72 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.72 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.72 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.71 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.68 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.67 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.67 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.66 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.66 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.66 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.66 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.66 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.66 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.64 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.64 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.59 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.59 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.57 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.57 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.56 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.54 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.53 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.51 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.5 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.49 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.48 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.47 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.44 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.44 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.43 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.4 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.38 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.38 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.35 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.31 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.19 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.12 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.02 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.97 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.94 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.83 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.75 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.63 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.46 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.4 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.38 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.36 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.33 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.31 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.3 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.15 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.1 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 96.96 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.6 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.46 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.37 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.26 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.17 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.93 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.91 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 95.77 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.23 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.64 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.9 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.04 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 92.71 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 92.18 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 90.2 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 89.68 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 81.72 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.40 E-value=1e-12 Score=95.69 Aligned_cols=81 Identities=25% Similarity=0.370 Sum_probs=45.4
Q ss_pred ccceEeecCcCCCcccchhhhccCCCCcCEEeecCCCCcccCCCCCCCcccccccccccccccCcCCCCCCCCCCcCeEe
Q 045942 12 HLRRVVIGEITQFLELPQWLLQCCTDTLQSLIIVDCPNFMALPGSLKDLEALETLVIARCPKLSSLPEDMHHVTTLKSLA 91 (131)
Q Consensus 12 ~L~~L~i~~c~~l~~lp~~~~~~~l~~L~~L~l~~~~~l~~lp~~l~~l~sL~~L~l~~c~~l~~lp~~~~~l~~L~~L~ 91 (131)
+|++|+++++ .+..+|.++ +.+++|+.|++++| .+..+|..++.+++|++|++++|...+.+|..+..+++|++|+
T Consensus 184 ~L~~L~L~~n-~l~~lp~~l--~~l~~L~~L~L~~N-~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~ 259 (328)
T 4fcg_A 184 NLQSLRLEWT-GIRSLPASI--ANLQNLKSLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLI 259 (328)
T ss_dssp TCCEEEEEEE-CCCCCCGGG--GGCTTCCEEEEESS-CCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEE
T ss_pred CCCEEECcCC-CcCcchHhh--cCCCCCCEEEccCC-CCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEE
Confidence 5666666554 344555555 55555666666555 3445555555555555555555555555555555555555555
Q ss_pred ecCCc
Q 045942 92 IAECP 96 (131)
Q Consensus 92 i~~~~ 96 (131)
+.+|.
T Consensus 260 L~~n~ 264 (328)
T 4fcg_A 260 LKDCS 264 (328)
T ss_dssp CTTCT
T ss_pred CCCCC
Confidence 55554
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.04 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.98 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.94 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.93 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.93 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.89 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.83 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.82 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.78 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.74 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.66 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.65 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.63 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.58 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.56 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.5 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.48 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.48 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.45 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.44 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.29 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.28 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.2 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.1 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.06 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.06 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.01 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.98 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.88 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.87 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.81 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.77 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.87 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.29 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.85 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.52 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.46 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 90.37 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 89.91 |
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: High affinity nerve growth factor receptor, N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04 E-value=7.7e-10 Score=71.19 Aligned_cols=91 Identities=18% Similarity=0.147 Sum_probs=75.4
Q ss_pred CCCCCCCCC-ccceEeecCcCCCcccchhhhccCCCCcCEEeecCCCCcccCC-CCCCCcccccccccccccccCcCCCC
Q 045942 3 HHDRKNTRP-HLRRVVIGEITQFLELPQWLLQCCTDTLQSLIIVDCPNFMALP-GSLKDLEALETLVIARCPKLSSLPED 80 (131)
Q Consensus 3 ~~~~~i~~l-~L~~L~i~~c~~l~~lp~~~~~~~l~~L~~L~l~~~~~l~~lp-~~l~~l~sL~~L~l~~c~~l~~lp~~ 80 (131)
+.|..+..+ +|++|++.+.+.++.++...| ..+++|+.|+++++ .+..++ ..+..+++|++|+++++ .++.+|..
T Consensus 22 ~~p~~l~~l~~l~~L~l~~n~~l~~i~~~~f-~~l~~L~~L~Ls~N-~l~~i~~~~f~~l~~L~~L~Ls~N-~l~~l~~~ 98 (156)
T d2ifga3 22 DSLHHLPGAENLTELYIENQQHLQHLELRDL-RGLGELRNLTIVKS-GLRFVAPDAFHFTPRLSRLNLSFN-ALESLSWK 98 (156)
T ss_dssp TTTTTSCSCSCCSEEECCSCSSCCEECGGGS-CSCCCCSEEECCSS-CCCEECTTGGGSCSCCCEEECCSS-CCSCCCST
T ss_pred cCcccccCccccCeeecCCCccccccCchhh-ccccccCcceeecc-ccCCcccccccccccccceeccCC-CCcccChh
Confidence 456778888 999999988777999986543 78999999999998 788886 45788999999999885 68899987
Q ss_pred CCCCCCcCeEeecCCc
Q 045942 81 MHHVTTLKSLAIAECP 96 (131)
Q Consensus 81 ~~~l~~L~~L~i~~~~ 96 (131)
.....+|+.|++.+++
T Consensus 99 ~~~~~~l~~L~L~~Np 114 (156)
T d2ifga3 99 TVQGLSLQELVLSGNP 114 (156)
T ss_dssp TTCSCCCCEEECCSSC
T ss_pred hhccccccccccCCCc
Confidence 6555589999998766
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|