Citrus Sinensis ID: 046030


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MERRRTNGGKTYQVRVSIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLEGKY
cccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccHHHccccccEEEcccccccccccHHHHHHHHHcHHHHHHHHHHHccHHHHccccccccHHHHHHHccHHHHHHHHHHccHHHHHHHHHHccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHEEEHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccc
merrrtnggktyqvrvsipdgdaanspqplqnahsgnFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAqysnpkpiskvpgAALEMQRELITFKEVETIVKpsfkemknndgktpwELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQaaftlpggtkdgkgtpnfhsKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRyrendflkLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRdrincfsmlPIILVFLPVALYLLLQCRLMGdilystcrprfllegky
merrrtnggktyqvrvsiPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITfkevetivkpsfkemknndgktpWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLEGKY
MERRRTNGGKTYQVRVSIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDflkllpfklilgllslfialTAMMLSFSSNFFLAYRDRINCFSMLPIIlvflpvalylllQCRLMGDILYSTCRPRFLLEGKY
***********************************GNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSN***I*KVPGAALEMQRELITFKEVETIVKPSF********KTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLL****
****************************PLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLE***
**********TYQVRVSIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLEGKY
**********TYQVRVSIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLEGK*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERRRTNGGKTYQVRVSIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYSTCRPRFLLEGKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
359473665 602 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.915 0.503 0.488 1e-76
356558266 584 PREDICTED: uncharacterized protein LOC10 0.912 0.517 0.469 2e-71
356532642 590 PREDICTED: ankyrin repeat-containing pro 0.864 0.484 0.489 4e-71
356498501 567 PREDICTED: uncharacterized protein LOC10 0.885 0.516 0.511 5e-71
225425076 563 PREDICTED: ankyrin repeat-containing pro 0.909 0.534 0.486 1e-70
224120314354 predicted protein [Populus trichocarpa] 0.909 0.850 0.459 1e-69
147860696 891 hypothetical protein VITISV_011174 [Viti 0.873 0.324 0.455 2e-68
118488149354 unknown [Populus trichocarpa] 0.909 0.850 0.459 2e-68
224120494354 predicted protein [Populus trichocarpa] 0.909 0.850 0.455 9e-68
449515682 642 PREDICTED: uncharacterized LOC101218503 0.897 0.462 0.446 1e-67
>gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 204/311 (65%), Gaps = 8/311 (2%)

Query: 22  DAANSPQPL--QNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIY 79
           D   SP PL    A  GN  FL  LI  YPDL+ E+D+ +RSIFHIAV+HR    F LIY
Sbjct: 287 DLIRSPSPLLLVAAELGNTVFLTELIAIYPDLIWEVDDHNRSIFHIAVLHRQENIFNLIY 346

Query: 80  EIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPS 139
           EIG  K+LI    D++ NN+LHLA + + P+  + V GAAL+MQREL+ F+EVE +V PS
Sbjct: 347 EIGSMKDLIVPNKDENDNNILHLAGRLAPPRQRNIVVGAALQMQRELLWFREVEKMVLPS 406

Query: 140 FKEMKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGT 199
           F+E KN DG+TPW+LFT EHK L++E E WM+  A    +VATL    VF AA T+PGG+
Sbjct: 407 FRERKNRDGETPWDLFTKEHKDLMKEGEKWMRGTAAQSMLVATLIATVVFAAALTVPGGS 466

Query: 200 KDGKGTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLIL 259
               G P F  K   HIF +S+AIA   S  S+L+FLSI++TSRY ++DFL+LLP +L+ 
Sbjct: 467 NQDTGIPXFVEKEILHIFAVSDAIALFTSLTSILVFLSIVLTSRYADDDFLELLPSRLMF 526

Query: 260 GLLSLFIALTAMMLSFSSNFFLAYRDRINCFSMLPIILVFLPVALYLLLQCRLMGDILYS 319
           GL +LFI++ +MM++F++ FFL +   +    +L  +  FL V LY  +QCRL   I+ +
Sbjct: 527 GLFTLFISIISMMVTFTATFFLLFSHGVTWAPILVAVFAFLLVTLYFSMQCRLWAHIIRA 586

Query: 320 T-C-----RPR 324
           T C     RPR
Sbjct: 587 TYCSRLIFRPR 597




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356558266|ref|XP_003547428.1| PREDICTED: uncharacterized protein LOC100814409 [Glycine max] Back     alignment and taxonomy information
>gi|356532642|ref|XP_003534880.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Glycine max] Back     alignment and taxonomy information
>gi|356498501|ref|XP_003518089.1| PREDICTED: uncharacterized protein LOC100784675 [Glycine max] Back     alignment and taxonomy information
>gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120314|ref|XP_002331017.1| predicted protein [Populus trichocarpa] gi|222872947|gb|EEF10078.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147860696|emb|CAN81449.1| hypothetical protein VITISV_011174 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118488149|gb|ABK95894.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120494|ref|XP_002331061.1| predicted protein [Populus trichocarpa] gi|222872991|gb|EEF10122.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449515682|ref|XP_004164877.1| PREDICTED: uncharacterized LOC101218503 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2165174347 AT5G35810 "AT5G35810" [Arabido 0.918 0.876 0.382 3.2e-49
TAIR|locus:2080240574 AT3G54070 "AT3G54070" [Arabido 0.746 0.430 0.400 1.2e-42
TAIR|locus:2175448603 AT5G04730 "AT5G04730" [Arabido 0.773 0.424 0.364 4.8e-38
TAIR|locus:2175413669 AT5G04700 "AT5G04700" [Arabido 0.734 0.363 0.411 5.3e-38
TAIR|locus:2180228625 AT5G04690 "AT5G04690" [Arabido 0.740 0.392 0.379 1e-35
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.501 0.245 0.286 3.8e-05
TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 513 (185.6 bits), Expect = 3.2e-49, P = 3.2e-49
 Identities = 120/314 (38%), Positives = 175/314 (55%)

Query:    25 NSPQPLQNA-HSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGF 83
             +SP  L +A  SGN + L +LIRSYPDL+  +D +++S+FHIA ++RH + F  IYE+G 
Sbjct:    30 SSPMLLFDAAQSGNLELLLILIRSYPDLIWTVDHKNQSLFHIAAINRHEKIFNRIYELGA 89

Query:    84 SKELIATYVDKSGN-NLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKE 142
              K+LIA Y +K  N NLLHL A+   P  +  V GAAL+MQRE++ +K V+ IV   + +
Sbjct:    90 IKDLIAMYKEKESNDNLLHLVARLPPPNRLQVVSGAALQMQREILWYKAVKEIVPRVYIK 149

Query:   143 MKNNDGKTPWELFTAEHKTLLEEAENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTK-- 200
              KN   +   +LFT EH  L +E E WMK  A +C +V+TL    VF AAFTLPGG    
Sbjct:   150 TKNKKEEVAHDLFTKEHDNLRKEGEKWMKETATACILVSTLIATVVFAAAFTLPGGNDTS 209

Query:   201 -DGK--GTPNFHSKIWFHIFVMSEAIAFSCSCISMLMFLSILITSRYRENDXXXXXXXXX 257
              D K  G P F  + WF +F++S+++A   S  S+++FLSIL TSRY E           
Sbjct:   210 GDIKTLGFPTFRKEFWFEVFIISDSVALLSSVTSIMIFLSIL-TSRYAEASFQTTLPTKL 268

Query:   258 XXXXXXXXXXXTAMMLSFSSNFFLAYRDRINCFSMLPIIXXXXXXXXXXXX-QCRLMGDI 316
                         +M+L+F++   L  RD+   +S++ ++               +L  D 
Sbjct:   269 MLGLLALFVSIISMVLAFTATLILI-RDQEPKWSLILLVYVASATALSFVVLHFQLWFDT 327

Query:   317 LYSTCRPRFLLEGK 330
             L S    +FL  G+
Sbjct:   328 LRSAYLSKFLFHGR 341




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_152000027
hypothetical protein (354 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
pfam13962114 pfam13962, PGG, Domain of unknown function 8e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-04
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
 Score = 88.3 bits (220), Expect = 8e-22
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 14/115 (12%)

Query: 167 ENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDG-----KGTPNFHSKI-WFHIFVMS 220
             W+++   S  +VATL     F A FT PGG          GTP    K   F  F +S
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 221 EAIAFSCSCISMLMFLSILITSRYRENDFLKLLPFKLILGLLSLFIALTAMMLSF 275
             IAF  S +++++ L I+         F + LP +L+  L  L+++L ++M++F
Sbjct: 61  NTIAFVASLVAVILLLYIV-------PSFSRRLP-RLLALLTLLWLSLLSLMVAF 107


The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
PF13962113 PGG: Domain of unknown function 99.93
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.9
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.87
PHA02741169 hypothetical protein; Provisional 99.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.8
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.79
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.78
PHA02791284 ankyrin-like protein; Provisional 99.77
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
PHA02791284 ankyrin-like protein; Provisional 99.75
PHA02878477 ankyrin repeat protein; Provisional 99.75
KOG0510 929 consensus Ankyrin repeat protein [General function 99.74
PHA02874434 ankyrin repeat protein; Provisional 99.73
PLN03192823 Voltage-dependent potassium channel; Provisional 99.73
PHA02946446 ankyin-like protein; Provisional 99.73
PHA02859209 ankyrin repeat protein; Provisional 99.71
PHA02743166 Viral ankyrin protein; Provisional 99.71
PHA03100480 ankyrin repeat protein; Provisional 99.71
PHA02736154 Viral ankyrin protein; Provisional 99.71
PHA02875413 ankyrin repeat protein; Provisional 99.7
PHA02859209 ankyrin repeat protein; Provisional 99.7
PHA02874434 ankyrin repeat protein; Provisional 99.7
PHA02884300 ankyrin repeat protein; Provisional 99.69
PHA02798 489 ankyrin-like protein; Provisional 99.69
PHA02878477 ankyrin repeat protein; Provisional 99.69
PHA02875413 ankyrin repeat protein; Provisional 99.69
KOG0510 929 consensus Ankyrin repeat protein [General function 99.68
KOG0508 615 consensus Ankyrin repeat protein [General function 99.68
PHA03100480 ankyrin repeat protein; Provisional 99.67
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.67
PHA02743166 Viral ankyrin protein; Provisional 99.66
PHA03095 471 ankyrin-like protein; Provisional 99.65
PHA02989494 ankyrin repeat protein; Provisional 99.64
PHA02946446 ankyin-like protein; Provisional 99.64
KOG0514452 consensus Ankyrin repeat protein [General function 99.64
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.64
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.64
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.64
PLN03192823 Voltage-dependent potassium channel; Provisional 99.64
PHA03095471 ankyrin-like protein; Provisional 99.63
PHA02876682 ankyrin repeat protein; Provisional 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
PHA02876682 ankyrin repeat protein; Provisional 99.62
PHA02795437 ankyrin-like protein; Provisional 99.6
PHA02917 661 ankyrin-like protein; Provisional 99.6
PHA02989 494 ankyrin repeat protein; Provisional 99.59
PHA02798 489 ankyrin-like protein; Provisional 99.58
PHA02741169 hypothetical protein; Provisional 99.58
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.57
KOG0508 615 consensus Ankyrin repeat protein [General function 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.55
PHA02736154 Viral ankyrin protein; Provisional 99.54
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.53
PHA02730 672 ankyrin-like protein; Provisional 99.52
PHA02884300 ankyrin repeat protein; Provisional 99.52
PHA02730672 ankyrin-like protein; Provisional 99.51
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.5
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.46
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.46
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.44
PHA02917 661 ankyrin-like protein; Provisional 99.43
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.43
PHA02795437 ankyrin-like protein; Provisional 99.41
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.4
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.37
PHA02792 631 ankyrin-like protein; Provisional 99.37
PHA02792631 ankyrin-like protein; Provisional 99.37
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.34
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.34
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.31
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.29
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.28
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.25
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.25
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.24
KOG0514452 consensus Ankyrin repeat protein [General function 99.24
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.18
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.16
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.16
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.14
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.06
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 98.97
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.94
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.88
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.72
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.67
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.66
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.63
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.54
PF1360630 Ank_3: Ankyrin repeat 98.53
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.52
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.49
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.46
PF1360630 Ank_3: Ankyrin repeat 98.41
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.41
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.4
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.38
KOG0522 560 consensus Ankyrin repeat protein [General function 98.36
KOG0522 560 consensus Ankyrin repeat protein [General function 98.26
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.16
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.07
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.94
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.93
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.69
KOG2384223 consensus Major histocompatibility complex protein 97.64
KOG0511 516 consensus Ankyrin repeat protein [General function 97.64
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.36
KOG0520975 consensus Uncharacterized conserved protein, conta 97.32
KOG2384223 consensus Major histocompatibility complex protein 97.08
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.04
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.43
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.22
KOG2505591 consensus Ankyrin repeat protein [General function 95.94
KOG0511 516 consensus Ankyrin repeat protein [General function 94.23
KOG2505591 consensus Ankyrin repeat protein [General function 94.05
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 93.07
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.14
KOG4591280 consensus Uncharacterized conserved protein, conta 82.44
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
Probab=99.93  E-value=5e-25  Score=171.72  Aligned_cols=109  Identities=36%  Similarity=0.604  Sum_probs=94.7

Q ss_pred             HHHHHhhhhhHHHHHHHHHHHHHHhhhcCCCCCCCC---CCcccccCcc-hhHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 046030          167 ENWMKRRAESCSIVATLAIAGVFQAAFTLPGGTKDG---KGTPNFHSKI-WFHIFVMSEAIAFSCSCISMLMFLSILITS  242 (331)
Q Consensus       167 ~~~~k~~~~~~~iva~Liatvtfaa~~t~PgG~~~~---~G~p~~~~~~-~f~~F~~~~~~a~~~S~~~~~~~~~~~~~~  242 (331)
                      +||+++.++++++||+||||+||+|+++||||++|+   .|+|++.+++ .|++|+++|++||++|+++++++++.+   
T Consensus         1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~~l~~~~---   77 (113)
T PF13962_consen    1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIFLLISGL---   77 (113)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHHHHHHHh---
Confidence            479999999999999999999999999999999875   6999998887 999999999999999999998876322   


Q ss_pred             hhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhHHh
Q 046030          243 RYRENDFLKLLPFKLILGLLSLFIALTAMMLSFSSNFFLA  282 (331)
Q Consensus       243 ~~~~~~~~~~l~~~~~~~~~~~~~s~~~~~~af~~~~~~v  282 (331)
                          .++.+..+..+.++..++++++.+|++||++|+|+|
T Consensus        78 ----~~~~~~~~~~~~~~~~~~~~a~~~~~~Af~~g~~~v  113 (113)
T PF13962_consen   78 ----DDFRRFLRRYLLIASVLMWIALISMMVAFAAGIYLV  113 (113)
T ss_pred             ----hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence                222334455677888999999999999999999975



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
2pnn_A273 Transient receptor potential cation channel subfa 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-04
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
 Score = 42.5 bits (100), Expect = 8e-05
 Identities = 14/88 (15%), Positives = 28/88 (31%), Gaps = 4/88 (4%)

Query: 64  HIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQ 123
            +A         K + +  +    I +  D  GN +LH   + ++    +      +   
Sbjct: 153 SLAACTNQLAIVKFLLQNSWQPADI-SARDSVGNTVLHALVEVAD---NTVDNTKFVTSM 208

Query: 124 RELITFKEVETIVKPSFKEMKNNDGKTP 151
              I     +       +E+ N  G TP
Sbjct: 209 YNEILILGAKLHPTLKLEEITNRKGLTP 236


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.86
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.86
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.86
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.86
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.86
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.85
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.85
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.85
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.84
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.83
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.83
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.83
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.83
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.83
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.83
3hra_A201 Ankyrin repeat family protein; structural protein; 99.83
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.82
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.82
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.82
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.82
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.82
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.82
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.82
2rfa_A232 Transient receptor potential cation channel subfa 99.82
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.82
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.82
2etb_A256 Transient receptor potential cation channel subfam 99.82
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.82
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.82
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.81
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.81
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.81
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.81
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.81
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.81
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.8
2rfa_A232 Transient receptor potential cation channel subfa 99.8
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.8
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.8
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.8
2pnn_A273 Transient receptor potential cation channel subfa 99.8
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.8
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.8
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.79
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.79
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.79
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.79
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.79
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.79
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.78
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.78
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.78
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.78
2etb_A256 Transient receptor potential cation channel subfam 99.77
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.77
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.77
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.77
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.77
3hra_A201 Ankyrin repeat family protein; structural protein; 99.76
2pnn_A273 Transient receptor potential cation channel subfa 99.76
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.76
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.76
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.76
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.75
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.75
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.75
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.75
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.75
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.74
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.74
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.73
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.73
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.73
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.72
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.72
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.72
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.71
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.71
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.71
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.71
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.71
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.7
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.7
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.7
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.69
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.68
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.68
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.68
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.66
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.66
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.65
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.65
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.65
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.6
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.59
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.59
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.5
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.49
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.44
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.90  E-value=6.3e-24  Score=176.84  Aligned_cols=135  Identities=23%  Similarity=0.343  Sum_probs=114.3

Q ss_pred             ccCCceeEEEe------cccCCCCCCCCHHHHHHhcCcHHHHHHHHHhCCCcccccccCCccHHHHHHHcCCHHHHHHHH
Q 046030            6 TNGGKTYQVRV------SIPDGDAANSPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIY   79 (331)
Q Consensus         6 ~~~g~~~~~~~------~l~~~d~~g~t~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~t~LH~Aa~~g~~~iv~~Ll   79 (331)
                      .+.|+.+.++.      +++.+|.+|+||||+|+..|+.++++.|++.+.+ ++.+|.+|+||||+|+.+|+.+++++|+
T Consensus        12 a~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad-~~~~d~~g~TpLh~A~~~g~~~~v~~Ll   90 (169)
T 4gpm_A           12 AENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGAD-VNAKDSDGRTPLHHAAENGHKEVVKLLI   90 (169)
T ss_dssp             HHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccc-hhhhccCCCCHHHHHHHcCCHHHHHHHH
Confidence            34555555543      3567889999999999999999999999999999 8899999999999999999999999999


Q ss_pred             hhCCchhhhhhhcccCCCcHHHHHHhhCCCCCCCCCCCcHHhhHHhhhhhhhhhhhcCcccccccccCCCCchhchHH-h
Q 046030           80 EIGFSKELIATYVDKSGNNLLHLAAQYSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTA-E  158 (331)
Q Consensus        80 ~~~~~~~~~in~~d~~G~TpLHlAa~~g~~~~~~~l~~~~l~~~~~l~~~~~v~~l~~~~~~~~~n~~G~Tpl~la~~-~  158 (331)
                      +.|++.    |.+|.+|+||||+|+..|+.+++++|                   +..|++++.+|++|+||+++|.+ +
T Consensus        91 ~~gadv----n~~d~~G~TpLh~A~~~g~~~~v~~L-------------------l~~gad~~~~d~~G~TpL~~A~~~g  147 (169)
T 4gpm_A           91 SKGADV----NAKDSDGRTPLHHAAENGHKEVVKLL-------------------ISKGADVNTSDSDGRTPLDLAREHG  147 (169)
T ss_dssp             HTTCCT----TCCCTTSCCHHHHHHHTTCHHHHHHH-------------------HHTTCCTTCCCTTSCCHHHHHHHTT
T ss_pred             HCcCCC----CCCCCCCCCHHHHHHHcCCHHHHHHH-------------------HHcCCCccccCCCCCCHHHHHHHcC
Confidence            999884    55999999999999999996654433                   23689999999999999999965 4


Q ss_pred             hhhHHH
Q 046030          159 HKTLLE  164 (331)
Q Consensus       159 ~~~l~~  164 (331)
                      +.++++
T Consensus       148 ~~~iv~  153 (169)
T 4gpm_A          148 NEEVVK  153 (169)
T ss_dssp             CHHHHH
T ss_pred             CHHHHH
Confidence            555544



>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.003
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.9 bits (97), Expect = 6e-05
 Identities = 15/83 (18%), Positives = 28/83 (33%), Gaps = 6/83 (7%)

Query: 29  PLQNA-HSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKEL 87
           PL  A   G+   +  L++      +  + +  +  H+A    H E  K + +       
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 88  IATYVDKSGNNLLHLAAQYSNPK 110
                 K     LH AA+  +  
Sbjct: 62  ----KAKDDQTPLHCAARIGHTN 80


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.81
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.81
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.78
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.77
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.77
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.77
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.75
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.75
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.74
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.73
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.71
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.71
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.68
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.67
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.66
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.65
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.65
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.63
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.59
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.53
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.53
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.52
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.51
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.44
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.38
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.29
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.87  E-value=2.2e-23  Score=161.23  Aligned_cols=108  Identities=19%  Similarity=0.123  Sum_probs=97.3

Q ss_pred             CCHHHHHHhcCcHHHHHHHHHhCCCcccccccCCccHHHHHHHcCCHHHHHHHHhhCCchhhhhhhcccCCCcHHHHHHh
Q 046030           26 SPQPLQNAHSGNFKFLAVLIRSYPDLVHELDEEDRSIFHIAVMHRHAETFKLIYEIGFSKELIATYVDKSGNNLLHLAAQ  105 (331)
Q Consensus        26 ~t~Lh~Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~t~LH~Aa~~g~~~iv~~Ll~~~~~~~~~in~~d~~G~TpLHlAa~  105 (331)
                      .|||++|+++|+.++|+.|++.+++ ++.+|.+|+||||+|+.+|+.++++++++.|++.    |.+|.+|+||||+|+.
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d-~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~di----n~~d~~g~tpLh~A~~   77 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGED-VNRTLEGGRKPLHYAADCGQLEILEFLLLKGADI----NAPDKHHITPLLSAVY   77 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCC-CCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTT----TCCSSSCSCHHHHHHT
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhc-ccccccccccccccccccccccccccccccccee----eecccccccchhhhhh
Confidence            3799999999999999999999998 8899999999999999999999999999999884    5599999999999999


Q ss_pred             hCCCCCCCCCCCcHHhhHHhhhhhhhhhhhcCcccccccccCCCCchhchHH
Q 046030          106 YSNPKPISKVPGAALEMQRELITFKEVETIVKPSFKEMKNNDGKTPWELFTA  157 (331)
Q Consensus       106 ~g~~~~~~~l~~~~l~~~~~l~~~~~v~~l~~~~~~~~~n~~G~Tpl~la~~  157 (331)
                      .|+.+++++|                   +..|++++.+|++|+||+|+|..
T Consensus        78 ~~~~~~v~~L-------------------l~~Gad~~~~d~~G~t~l~~a~~  110 (118)
T d1myoa_          78 EGHVSCVKLL-------------------LSKGADKTVKGPDGLTALEATDN  110 (118)
T ss_dssp             TTCCHHHHHH-------------------HTTCCCSSSSSSSTCCCCCTCSS
T ss_pred             cCchhhhhhh-------------------hcccccceeeCCCCCCHHHHHhH
Confidence            9997764433                   23688999999999999999953



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure