Citrus Sinensis ID: 046075
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 328 | 2.2.26 [Sep-21-2011] | |||||||
| Q8GWP0 | 360 | Transcription factor MYB3 | no | no | 0.954 | 0.869 | 0.417 | 2e-65 | |
| Q50EX6 | 294 | Protein ODORANT1 OS=Petun | N/A | no | 0.429 | 0.479 | 0.576 | 3e-47 | |
| Q8LPH6 | 352 | Transcription factor MYB8 | no | no | 0.442 | 0.411 | 0.560 | 5e-47 | |
| Q9SZP1 | 282 | Transcription repressor M | no | no | 0.390 | 0.453 | 0.608 | 1e-45 | |
| Q38851 | 236 | Transcription repressor M | no | no | 0.487 | 0.677 | 0.52 | 1e-45 | |
| Q9SPG2 | 366 | Transcription factor MYB2 | no | no | 0.390 | 0.349 | 0.601 | 1e-45 | |
| Q9S9K9 | 257 | Transcription factor MYB3 | no | no | 0.387 | 0.494 | 0.613 | 3e-45 | |
| P81393 | 232 | Myb-related protein 308 O | N/A | no | 0.387 | 0.547 | 0.620 | 4e-45 | |
| P81395 | 274 | Myb-related protein 330 O | N/A | no | 0.387 | 0.463 | 0.613 | 9e-45 | |
| P20025 | 255 | Myb-related protein Zm38 | N/A | no | 0.390 | 0.501 | 0.586 | 1e-44 |
| >sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 249 bits (636), Expect = 2e-65, Method: Compositional matrix adjust.
Identities = 152/364 (41%), Positives = 203/364 (55%), Gaps = 51/364 (14%)
Query: 1 MGRSPCCDESRSLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTN 60
MGRSPCCD+ + +KKGPW PEED KL YI +G+G+W +LPKLAGLNRCGKSCRLRW N
Sbjct: 1 MGRSPCCDQDKGVKKGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMN 60
Query: 61 YLRPDIRRGRFSEEEERIIINLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNT 120
YLRPDIRRG+FS+ EE I+ LH++LGNK+ +I HLPGRTDNEIKN+WNT
Sbjct: 61 YLRPDIRRGKFSDGEESTIVRLHALLGNKWS---------KIAGHLPGRTDNEIKNYWNT 111
Query: 121 HIRKKFLQMGIDPITHKPRV-DLSQFLNLPQTLYSSPFGNLSTSPFGNNNALKLQTDATQ 179
H+RKK LQMGIDP+TH+PR DLS L++ Q L ++ ++ FGNNN L T
Sbjct: 112 HMRKKLLQMGIDPVTHEPRTNDLSPILDVSQMLAAA----INNGQFGNNNLLNNNTALED 167
Query: 180 LARIELLQNLLELMNTSAVIPNVGNYSGAL----------GFD-NLNQPFQNVMAQATLQ 228
+ +++L+ +L+++ T IPN+ ++ L F+ N P + A +
Sbjct: 168 ILKLQLIHKMLQII-TPKAIPNISSFKTNLLNPKPEPVVNSFNTNSVNPKPDPPAGLFIN 226
Query: 229 NPGSSP--------------------QTTGELEAQINSLSWFEAGLEQFEGLSDHDVISN 268
G +P Q G + SL+ + G ++DH
Sbjct: 227 QSGITPEAASDFIPSYENVWDGFEDNQLPGLVTVSQESLNTAKPGTSTTTKVNDHIRTGM 286
Query: 269 ENSSYGHNIQQECKLPPMVNASCDET----PSLSQTDHHFAAYEAWEKFIDDETSDSYWK 324
YG + E V+ S + T PS +Q E WEKF+DDETSDS WK
Sbjct: 287 MPCYYGDQL-LETPSTGSVSVSPETTSLNHPSTAQHSSGSDFLEDWEKFLDDETSDSCWK 345
Query: 325 KFLE 328
FL+
Sbjct: 346 SFLD 349
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 328 | ||||||
| 225427159 | 335 | PREDICTED: transcription factor MYB39 [V | 0.932 | 0.913 | 0.509 | 2e-83 | |
| 224074299 | 335 | predicted protein [Populus trichocarpa] | 0.948 | 0.928 | 0.502 | 3e-81 | |
| 297742074 | 303 | unnamed protein product [Vitis vinifera] | 0.878 | 0.950 | 0.510 | 2e-80 | |
| 356529726 | 352 | PREDICTED: transcription factor MYB39-li | 0.957 | 0.892 | 0.476 | 6e-79 | |
| 359489983 | 341 | PREDICTED: transcription factor MYB39-li | 0.917 | 0.882 | 0.487 | 5e-78 | |
| 255573461 | 322 | r2r3-myb transcription factor, putative | 0.899 | 0.916 | 0.507 | 1e-76 | |
| 356497655 | 339 | PREDICTED: transcription factor MYB39 [G | 0.957 | 0.926 | 0.507 | 2e-76 | |
| 224138964 | 336 | predicted protein [Populus trichocarpa] | 0.939 | 0.916 | 0.505 | 3e-76 | |
| 357485141 | 334 | Myb-like transcription factor [Medicago | 0.923 | 0.907 | 0.470 | 3e-73 | |
| 297737290 | 268 | unnamed protein product [Vitis vinifera] | 0.810 | 0.992 | 0.5 | 6e-73 |
| >gi|225427159|ref|XP_002277571.1| PREDICTED: transcription factor MYB39 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 315 bits (806), Expect = 2e-83, Method: Compositional matrix adjust.
Identities = 181/355 (50%), Positives = 227/355 (63%), Gaps = 49/355 (13%)
Query: 1 MGRSPCCDESRSLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTN 60
M RSPCCD+ SLKKGPWTP+EDQKLVDYI RHGHGSW ALPKLAGLNRCGKSCRLRWTN
Sbjct: 1 MVRSPCCDDG-SLKKGPWTPDEDQKLVDYIKRHGHGSWRALPKLAGLNRCGKSCRLRWTN 59
Query: 61 YLRPDIRRGRFSEEEERIIINLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNT 120
YLRPDI+RG+FS+EEERIII LHSVLGNK+ I HLPGRTDNEIKNFWNT
Sbjct: 60 YLRPDIKRGKFSDEEERIIIKLHSVLGNKWS---------RIAVHLPGRTDNEIKNFWNT 110
Query: 121 HIRKKFLQMGIDPITHKPRVDLSQFLNLPQTLYSSPFGNLSTSPFGNNNALKLQTDATQL 180
H++KKFLQMG+DP TH+PR DL+ +NL Q L ++ F NL TSP +AL+LQTDAT+L
Sbjct: 111 HVKKKFLQMGLDPNTHQPRADLNSLVNLSQLLATANFSNL-TSPL--EDALRLQTDATRL 167
Query: 181 ARIELLQNLLELMNTSAVIPNVGNYSGAL-------------GFDNLNQPFQN---VMAQ 224
+I+LLQN+L+++NT + + N GA GF N ++A
Sbjct: 168 TKIQLLQNILQIINTGSTLSR--NIEGASHQWSRNLTPTPLEGFVNGTSTLYTEDPMLAP 225
Query: 225 ATLQNPGSSPQTTGELEAQINSLSWFEAGLEQFEGLSDHDVISNENSSYGHNIQQECKLP 284
A NPG +P + + +A NS + + G S+ +N SS ++I+ E LP
Sbjct: 226 AEFPNPGVTPGSHNDYQAISNSWACIDGGFG-----SEVHNFNNNCSSSSYDIRAEQPLP 280
Query: 285 PMVNASCDETPSLSQTDHHF------------AAYEAWEKFIDDETSDSYWKKFL 327
+V+ S E S++QT+ +EAW + +DDETS SYWK L
Sbjct: 281 ALVSVS-PECSSVNQTESKMNLPCISTHSSTSNIFEAWGELMDDETSVSYWKDIL 334
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224074299|ref|XP_002304344.1| predicted protein [Populus trichocarpa] gi|222841776|gb|EEE79323.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297742074|emb|CBI33861.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356529726|ref|XP_003533439.1| PREDICTED: transcription factor MYB39-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359489983|ref|XP_003634006.1| PREDICTED: transcription factor MYB39-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255573461|ref|XP_002527656.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223532961|gb|EEF34727.1| r2r3-myb transcription factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356497655|ref|XP_003517675.1| PREDICTED: transcription factor MYB39 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224138964|ref|XP_002326734.1| predicted protein [Populus trichocarpa] gi|222834056|gb|EEE72533.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357485141|ref|XP_003612858.1| Myb-like transcription factor [Medicago truncatula] gi|355514193|gb|AES95816.1| Myb-like transcription factor [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297737290|emb|CBI26491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 328 | ||||||
| TAIR|locus:505006490 | 360 | MYB39 "myb domain protein 39" | 0.664 | 0.605 | 0.506 | 8.7e-69 | |
| TAIR|locus:2149000 | 336 | MYB9 "myb domain protein 9" [A | 0.945 | 0.922 | 0.446 | 2.3e-64 | |
| TAIR|locus:2075387 | 321 | MYB107 "myb domain protein 107 | 0.551 | 0.563 | 0.626 | 1.1e-62 | |
| TAIR|locus:2023951 | 365 | MYB93 "myb domain protein 93" | 0.692 | 0.621 | 0.526 | 1.3e-61 | |
| TAIR|locus:2145402 | 334 | MYB92 "myb domain protein 92" | 0.567 | 0.556 | 0.581 | 1.2e-56 | |
| TAIR|locus:2141231 | 350 | MYB102 "MYB-like 102" [Arabido | 0.865 | 0.811 | 0.443 | 1.1e-55 | |
| TAIR|locus:2171845 | 310 | MYB53 "myb domain protein 53" | 0.579 | 0.612 | 0.561 | 1.1e-55 | |
| TAIR|locus:2115708 | 324 | MYB74 "myb domain protein 74" | 0.445 | 0.450 | 0.653 | 3.4e-54 | |
| TAIR|locus:2132957 | 282 | MYB41 "myb domain protein 41" | 0.530 | 0.617 | 0.582 | 1.7e-52 | |
| TAIR|locus:2150891 | 326 | MYB16 "myb domain protein 16" | 0.393 | 0.395 | 0.654 | 1.5e-49 |
| TAIR|locus:505006490 MYB39 "myb domain protein 39" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 613 (220.8 bits), Expect = 8.7e-69, Sum P(2) = 8.7e-69
Identities = 119/235 (50%), Positives = 159/235 (67%)
Query: 1 MGRSPCCDESRSLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTN 60
MGRSPCCD+ + +KKGPW PEED KL YI +G+G+W +LPKLAGLNRCGKSCRLRW N
Sbjct: 1 MGRSPCCDQDKGVKKGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMN 60
Query: 61 YLRPDIRRGRFSEEEERIIINLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNT 120
YLRPDIRRG+FS+ EE I+ LH++LGNK+ +I HLPGRTDNEIKN+WNT
Sbjct: 61 YLRPDIRRGKFSDGEESTIVRLHALLGNKWS---------KIAGHLPGRTDNEIKNYWNT 111
Query: 121 HIRKKFLQMGIDPITHKPRV-DLSQFLNLPQTLYSSPFGNLSTSPFGNNNALKLQTDATQ 179
H+RKK LQMGIDP+TH+PR DLS L++ Q L ++ ++ FGNNN L T
Sbjct: 112 HMRKKLLQMGIDPVTHEPRTNDLSPILDVSQMLAAA----INNGQFGNNNLLNNNTALED 167
Query: 180 LARIELLQNLLELMNTSAVIPNVGNYSGALGFDNLNQPFQNVMAQATLQNPGSSP 234
+ +++L+ +L+++ A IPN+ ++ L + +P N ++ NP P
Sbjct: 168 ILKLQLIHKMLQIITPKA-IPNISSFKTNL-LNPKPEPVVNSFNTNSV-NPKPDP 219
|
|
| TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145402 MYB92 "myb domain protein 92" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171845 MYB53 "myb domain protein 53" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132957 MYB41 "myb domain protein 41" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150891 MYB16 "myb domain protein 16" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00015729001 | SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (335 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 328 | |||
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 3e-56 | |
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 3e-49 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 7e-16 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 6e-12 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 5e-11 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 8e-11 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 2e-10 | |
| COG5147 | 512 | COG5147, REB1, Myb superfamily proteins, including | 1e-09 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 3e-08 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-06 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 0.003 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 189 bits (480), Expect = 3e-56
Identities = 80/138 (57%), Positives = 104/138 (75%), Gaps = 10/138 (7%)
Query: 1 MGRSPCCDESRSLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTN 60
MGR CC + + L+KG W+PEED+KL+ +I ++GHG W+++PK AGL RCGKSCRLRW N
Sbjct: 1 MGRHSCCYKQK-LRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWIN 59
Query: 61 YLRPDIRRGRFSEEEERIIINLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNT 120
YLRPD++RG FS++EE +II LH+VLGN++ +I LPGRTDNEIKN WN+
Sbjct: 60 YLRPDLKRGTFSQQEENLIIELHAVLGNRW---------SQIAAQLPGRTDNEIKNLWNS 110
Query: 121 HIRKKFLQMGIDPITHKP 138
++KK Q GIDP THKP
Sbjct: 111 CLKKKLRQRGIDPNTHKP 128
|
Length = 459 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 328 | |||
| PLN03091 | 459 | hypothetical protein; Provisional | 100.0 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 100.0 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 100.0 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.74 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.74 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.65 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 99.57 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.55 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.55 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.39 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.31 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.23 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.21 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.12 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.1 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.04 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.01 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.96 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.86 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.66 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.51 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.84 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.53 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 97.21 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 97.19 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.19 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 97.12 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 97.05 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 96.96 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 96.78 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.6 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.41 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.14 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.12 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.05 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 95.95 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 95.94 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 95.72 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 94.29 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.23 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 94.19 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.02 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 93.05 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 91.93 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 91.15 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 90.57 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 89.89 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 87.77 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 86.72 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 83.25 |
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.1e-39 Score=316.53 Aligned_cols=132 Identities=61% Similarity=1.177 Sum_probs=128.5
Q ss_pred CCCCCcccCCCCCCCCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCCCCCCCHHHHHHHH
Q 046075 1 MGRSPCCDESRSLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTNYLRPDIRRGRFSEEEERIII 80 (328)
Q Consensus 1 mgR~~cc~k~~~lkKg~WT~EEDe~L~~lV~k~G~~nW~~IAk~lg~~Rt~kQCR~RW~n~L~P~ikkg~WT~EED~~Li 80 (328)
|||++||.| .+++||+||+|||++|+++|++||..+|..||+.++++|+++|||+||.+||+|.+++++||+|||++|+
T Consensus 1 mgr~~Cc~K-qklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLL 79 (459)
T PLN03091 1 MGRHSCCYK-QKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLII 79 (459)
T ss_pred CCCCccCcC-CCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHH
Confidence 999999999 9999999999999999999999999999999999988999999999999999999999999999999999
Q ss_pred HHHHHhCCCccccccchhHHHHHhhCCCCCHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCc
Q 046075 81 NLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNTHIRKKFLQMGIDPITHKPRVDL 142 (328)
Q Consensus 81 ~Lv~~~G~kW~~i~~~I~w~~IA~~lpgRT~~qcKnRW~~~Lkkkl~k~~~~p~~~~p~~~~ 142 (328)
++|++||++|. +||++|||||+++|||||+.+||+++++.+++|.+++|....
T Consensus 80 eL~k~~GnKWs---------kIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~ 132 (459)
T PLN03091 80 ELHAVLGNRWS---------QIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEV 132 (459)
T ss_pred HHHHHhCcchH---------HHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCcccc
Confidence 99999999999 999999999999999999999999999999999999987754
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 328 | ||||
| 1a5j_A | 110 | Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe | 7e-23 | ||
| 1h8a_C | 128 | Crystal Structure Of Ternary Protein-Dna Complex3 L | 7e-22 | ||
| 1mse_C | 105 | Solution Structure Of A Specific Dna Complex Of The | 1e-21 | ||
| 1gv2_A | 105 | Crystal Structure Of C-Myb R2r3 Length = 105 | 1e-21 | ||
| 1h88_C | 159 | Crystal Structure Of Ternary Protein-Dna Complex1 L | 3e-21 | ||
| 3zqc_A | 131 | Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin | 1e-11 | ||
| 3osf_A | 126 | The Structure Of Protozoan Parasite Trichomonas Vag | 5e-09 | ||
| 1gvd_A | 52 | Crystal Structure Of C-Myb R2 V103l Mutant Length = | 8e-08 | ||
| 1mbg_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | 1e-07 | ||
| 1gv5_A | 52 | Crystal Structure Of C-Myb R2 Length = 52 | 2e-07 | ||
| 1mbj_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | 6e-07 | ||
| 1idy_A | 54 | Structure Of Myb Transforming Protein, Nmr, Minimiz | 8e-07 | ||
| 2k9n_A | 107 | Solution Nmr Structure Of The R2r3 Dna Binding Doma | 9e-07 |
| >pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 | Back alignment and structure |
|
| >pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 | Back alignment and structure |
| >pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 | Back alignment and structure |
| >pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 | Back alignment and structure |
| >pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 | Back alignment and structure |
| >pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 | Back alignment and structure |
| >pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 | Back alignment and structure |
| >pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 | Back alignment and structure |
| >pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | Back alignment and structure |
| >pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 | Back alignment and structure |
| >pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | Back alignment and structure |
| >pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 | Back alignment and structure |
| >pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
Score = 195 bits (499), Expect = 1e-63
Identities = 49/113 (43%), Positives = 70/113 (61%), Gaps = 10/113 (8%)
Query: 13 LKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTNYLRPDIRRGRFS 72
L KGPWT EEDQ+++ + ++G W+ + K R GK CR RW N+L P++++ ++
Sbjct: 2 LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60
Query: 73 EEEERIIINLHSVLGNKYFSFNMHIYSIEIIYHLPGRTDNEIKNFWNTHIRKK 125
EEE+RII H LGN++ EI LPGRTDN IKN WN+ +R+K
Sbjct: 61 EEEDRIIYQAHKRLGNRW---------AEIAKLLPGRTDNAIKNHWNSTMRRK 104
|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 328 | |||
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 100.0 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 100.0 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 100.0 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.98 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.97 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.96 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.96 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.84 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.83 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.73 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.71 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.7 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.69 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.68 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.68 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.67 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.66 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.66 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.65 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.63 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.6 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.59 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.58 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.57 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.56 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.56 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.55 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.55 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.53 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.53 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.52 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.51 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.48 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.48 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.46 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.43 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.43 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.14 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.43 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.42 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.38 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.38 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.36 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.32 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.31 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.96 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.28 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.23 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.19 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.17 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.17 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.15 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.15 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.14 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.12 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.06 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.9 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 98.85 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.78 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.74 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.68 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.6 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.54 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.47 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.44 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.18 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.15 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.13 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.12 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.1 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.86 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.74 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.85 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.64 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.59 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.55 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.42 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.3 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.18 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.14 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.11 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.04 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.83 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.72 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 96.44 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 96.32 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 96.16 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 95.97 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 94.89 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.34 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 94.96 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 93.32 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 93.07 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 92.47 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 88.03 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 87.34 |
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-34 Score=232.58 Aligned_cols=105 Identities=47% Similarity=0.901 Sum_probs=99.3
Q ss_pred CCCCCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCCCCCCCHHHHHHHHHHHHHhCCCcc
Q 046075 12 SLKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTNYLRPDIRRGRFSEEEERIIINLHSVLGNKYF 91 (328)
Q Consensus 12 ~lkKg~WT~EEDe~L~~lV~k~G~~nW~~IAk~lg~~Rt~kQCR~RW~n~L~P~ikkg~WT~EED~~Li~Lv~~~G~kW~ 91 (328)
.++||+||+|||++|+++|++||.++|..||+.| ++|+++||++||.++|+|.+++++||+|||++|+++|.+||++|.
T Consensus 1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l-~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~ 79 (105)
T 1gv2_A 1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHL-KGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA 79 (105)
T ss_dssp CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTS-TTCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhh-cCCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence 4789999999999999999999988999999999 599999999999999999999999999999999999999999998
Q ss_pred ccccchhHHHHHhhCCCCCHHHHHHHHHHHHHHHH
Q 046075 92 SFNMHIYSIEIIYHLPGRTDNEIKNFWNTHIRKKF 126 (328)
Q Consensus 92 ~i~~~I~w~~IA~~lpgRT~~qcKnRW~~~Lkkkl 126 (328)
.||++|||||+++||+||+.++++++
T Consensus 80 ---------~Ia~~l~gRt~~~~k~rw~~~~~~~~ 105 (105)
T 1gv2_A 80 ---------EIAKLLPGRTDNAIKNHWNSTMRRKV 105 (105)
T ss_dssp ---------HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred ---------HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence 99999999999999999999998864
|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 328 | ||||
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 4e-22 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 3e-09 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 1e-20 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 1e-07 | |
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 3e-18 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 4e-18 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 7e-09 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 1e-17 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 1e-06 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 3e-17 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 7e-06 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 6e-15 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 9e-08 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 2e-13 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-04 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 4e-12 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 2e-10 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 5e-11 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-09 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 4e-04 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 4e-09 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 5e-09 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 3e-07 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 9e-06 | |
| d1ug2a_ | 95 | a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu | 1e-04 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 85.5 bits (212), Expect = 4e-22
Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
Query: 13 LKKGPWTPEEDQKLVDYIGRHGHGSWNALPKLAGLNRCGKSCRLRWTNYLRPD 65
L KGPWT EEDQ+L+ + ++G W+ + K R GK CR RW N+L P+
Sbjct: 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 328 | |||
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.73 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.73 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.67 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.63 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.6 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.58 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.54 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.52 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.51 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.48 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.45 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.42 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.4 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.39 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.38 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.27 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.26 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.25 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.24 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.19 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.16 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.16 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.14 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.02 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.01 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.86 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.83 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.62 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.81 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.62 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.59 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.52 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 97.34 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 96.79 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 96.64 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.09 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.02 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 93.97 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 92.36 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 91.87 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 89.01 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 84.81 |
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: DNA-binding domain of rap1 domain: DNA-binding domain of rap1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.73 E-value=1.2e-20 Score=148.43 Aligned_cols=71 Identities=20% Similarity=0.313 Sum_probs=65.4
Q ss_pred CCCCCHHHHHHHHHHHHHhCCC-----CcccccccccccccccccccccccccCCCCCCCCCCHHHHHHHHHHHHHh
Q 046075 15 KGPWTPEEDQKLVDYIGRHGHG-----SWNALPKLAGLNRCGKSCRLRWTNYLRPDIRRGRFSEEEERIIINLHSVL 86 (328)
Q Consensus 15 Kg~WT~EEDe~L~~lV~k~G~~-----nW~~IAk~lg~~Rt~kQCR~RW~n~L~P~ikkg~WT~EED~~Li~Lv~~~ 86 (328)
|++||+|||++|+++|.+||.. +|..||+.| +|||++|||.||.++|+|.++++.||.+||.+|+.++..+
T Consensus 1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~l-pgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l 76 (86)
T d1igna1 1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYV-PNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL 76 (86)
T ss_dssp CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTS-TTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHc-CCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence 6899999999999999999964 499999999 6999999999999999999999999999999988766444
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|