Citrus Sinensis ID: 046123
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| 359493483 | 1274 | PREDICTED: TMV resistance protein N-like | 0.916 | 0.077 | 0.532 | 3e-20 | |
| 224126507 | 1741 | tir-nbs-lrr resistance protein [Populus | 0.916 | 0.056 | 0.522 | 6e-20 | |
| 105922306 | 1778 | TIR-NBS-NBS-LRR type disease resistance | 0.916 | 0.055 | 0.522 | 6e-20 | |
| 359493487 | 1162 | PREDICTED: TMV resistance protein N-like | 0.916 | 0.085 | 0.523 | 2e-19 | |
| 109676360 | 1138 | NBS-LRR type disease resistance-like pro | 0.925 | 0.087 | 0.518 | 2e-19 | |
| 105922810 | 1524 | TIR-NBS-LRR-TIR type disease resistance | 0.925 | 0.065 | 0.518 | 2e-19 | |
| 224120756 | 813 | hypothetical protein POPTRDRAFT_838042 [ | 0.925 | 0.123 | 0.518 | 2e-19 | |
| 451798988 | 1219 | TMV resistance protein N-like protein 6 | 0.916 | 0.081 | 0.523 | 6e-19 | |
| 451798990 | 1335 | TMV resistance protein N-like protein 7 | 0.916 | 0.074 | 0.523 | 8e-19 | |
| 224127726 | 1203 | tir-nbs-lrr resistance protein [Populus | 0.879 | 0.078 | 0.533 | 1e-18 |
| >gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 102 bits (254), Expect = 3e-20, Method: Compositional matrix adjust.
Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 8/107 (7%)
Query: 1 MKSLKTLVLSGCLKLKKFPDIVGKSSQRKLQAGISSWSFILEGTAIRGLPASIELLSGSV 60
M+SL+ L LSGC KLKKFP++ G + LEGTAI+GLP SIE L+G
Sbjct: 723 MESLQILTLSGCSKLKKFPEVQGNMEHLP--------NLSLEGTAIKGLPLSIENLTGLA 774
Query: 61 LLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPETLGKVESL 107
LLNLK+CK+L+SLP +I L+SL+TL LSGCS+LK++P+ LG ++ L
Sbjct: 775 LLNLKECKSLESLPRSIFKLKSLKTLILSGCSELKDLPDNLGSLQCL 821
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224126507|ref|XP_002319855.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222858231|gb|EEE95778.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|105922306|gb|ABF81409.1| TIR-NBS-NBS-LRR type disease resistance protein [Populus trichocarpa] gi|105922325|gb|ABF81410.1| TIR-NBS-NBS-LRR type disease resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|109676360|gb|ABG37662.1| NBS-LRR type disease resistance-like protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|105922810|gb|ABF81438.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224120756|ref|XP_002330944.1| hypothetical protein POPTRDRAFT_838042 [Populus trichocarpa] gi|222873138|gb|EEF10269.1| hypothetical protein POPTRDRAFT_838042 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| TAIR|locus:2170333 | 1197 | CSA1 "constitutive shade-avoid | 0.879 | 0.079 | 0.481 | 2.4e-15 | |
| TAIR|locus:2122965 | 1210 | AT4G19510 [Arabidopsis thalian | 0.898 | 0.080 | 0.481 | 2.4e-15 | |
| TAIR|locus:2827639 | 1195 | AT2G17060 [Arabidopsis thalian | 0.898 | 0.081 | 0.453 | 1.7e-14 | |
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.888 | 0.078 | 0.439 | 5.9e-14 | |
| TAIR|locus:2153328 | 1231 | AT5G45230 [Arabidopsis thalian | 0.870 | 0.076 | 0.447 | 5.9e-14 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.898 | 0.074 | 0.425 | 3.5e-13 | |
| TAIR|locus:2153207 | 1165 | AT5G45060 [Arabidopsis thalian | 0.814 | 0.075 | 0.444 | 1.7e-12 | |
| TAIR|locus:2153363 | 1261 | AT5G45200 [Arabidopsis thalian | 0.870 | 0.074 | 0.380 | 1.1e-11 | |
| TAIR|locus:2158475 | 1217 | RPS4 "RESISTANT TO P. SYRINGAE | 0.796 | 0.070 | 0.412 | 5.6e-11 | |
| TAIR|locus:2155322 | 1170 | LAZ5 "LAZARUS 5" [Arabidopsis | 0.888 | 0.082 | 0.364 | 8.8e-11 |
| TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 207 (77.9 bits), Expect = 2.4e-15, P = 2.4e-15
Identities = 51/106 (48%), Positives = 62/106 (58%)
Query: 3 SLKTLVLSGCLKLKKFPDIVGKSSQRKLQAGISSWSFILEGTAIRGLPASIELLSGSVLL 62
SLKTL+LSGC K K F I KL+A L+GTAI+ LP I L V+L
Sbjct: 730 SLKTLILSGCSKFKTFQVI-----SDKLEA------LYLDGTAIKELPCDIGRLQRLVML 778
Query: 63 NLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPETLGKVESLE 108
N+K CK LK LP ++ L++L L LSGCSKL PET G + LE
Sbjct: 779 NMKGCKKLKRLPDSLGQLKALEELILSGCSKLNEFPETWGNMSRLE 824
|
|
| TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00130958 | hypothetical protein (1741 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-09 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 6e-08 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-07 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 6e-04 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 53.0 bits (127), Expect = 2e-09
Identities = 36/99 (36%), Positives = 59/99 (59%), Gaps = 9/99 (9%)
Query: 1 MKSLKTLVLSGCLKLKKFPDIVGKSSQRKLQAGISSWSFILEGTAIRGLPASIELLSGSV 60
+ L+ + L G LK+ PD+ ++ L+ +S S ++E LP+SI+ L+
Sbjct: 633 LTGLRNIDLRGSKNLKEIPDLSMATNLETLK--LSDCSSLVE------LPSSIQYLNKLE 684
Query: 61 LLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPE 99
L++ C+NL+ LP+ IN L+SL L LSGCS+LK+ P+
Sbjct: 685 DLDMSRCENLEILPTGIN-LKSLYRLNLSGCSRLKSFPD 722
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.25 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.23 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.11 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.03 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.95 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.92 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.85 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.83 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.83 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.81 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.71 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.7 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.69 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 98.63 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.61 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.57 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.56 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.55 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.47 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.45 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.29 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.28 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.28 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.24 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.22 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.18 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.18 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.02 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.01 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.99 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.96 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.93 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.92 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.91 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.91 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.9 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.86 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.82 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.65 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.5 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.45 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.31 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.3 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.19 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.07 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 97.02 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.91 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 96.6 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.54 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.5 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.35 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.27 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.43 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.28 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.1 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.01 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.99 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.8 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.31 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.14 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.58 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 93.38 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 92.8 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 92.8 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 92.43 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 92.42 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 92.23 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.4 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 88.54 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 85.79 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 85.67 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 85.56 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 83.04 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 82.76 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 81.49 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 81.18 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=99.25 E-value=1.3e-11 Score=96.79 Aligned_cols=69 Identities=20% Similarity=0.281 Sum_probs=30.1
Q ss_pred EEEecCcccc-ccCcccccCCCCcEEeccCCcCCccccccccCCCCCCEEeecCCCCCcccccCcCCCCC
Q 046123 38 SFILEGTAIR-GLPASIELLSGSVLLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPETLGKVES 106 (108)
Q Consensus 38 ~l~l~~~~~~-~~p~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~l~l~~~~~~~~~p~~~~~l~~ 106 (108)
+|++++|.+. .+|+.++.+++|+.|++++|.....+|..++.+++|++|++++|...+.+|..++++++
T Consensus 192 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~ 261 (968)
T PLN00113 192 FLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKN 261 (968)
T ss_pred eeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCC
Confidence 4444444433 33333444444444444443333344444444444444444444443444444444433
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 108 | ||||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 2e-05 |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-07 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 7e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 60.0 bits (146), Expect = 3e-12
Identities = 27/108 (25%), Positives = 45/108 (41%), Gaps = 10/108 (9%)
Query: 1 MKSLKTLVLSGCLKLKKFPDIVGKSSQRKLQAGISSWSFILEGTAIRGLPASIELLSGSV 60
L L L +FPD + S LQ ++ + LP +++ +G
Sbjct: 80 QPGRVALELRSV-PLPQFPDQAFRLS--HLQ------HMTIDAAGLMELPDTMQQFAGLE 130
Query: 61 LLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPETLGKVESLE 108
L L L++LP++I L LR L + C +L +PE L ++
Sbjct: 131 TLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASG 177
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.58 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.57 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.49 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.47 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.46 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.46 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.44 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.44 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.41 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.39 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.38 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.38 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.37 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.37 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.36 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.36 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.36 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.35 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.34 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.34 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.34 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.34 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.33 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.33 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.33 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.33 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.33 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.33 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.33 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.32 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.31 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.31 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.31 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.3 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.3 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.3 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.3 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.29 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.29 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.29 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.29 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.29 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.28 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.28 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.27 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.27 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.26 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.26 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.26 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.26 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.25 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.25 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.25 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.24 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.24 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.24 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.23 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.23 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.23 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.23 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.23 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.22 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.22 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.22 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.22 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.21 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.21 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.2 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.19 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.18 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.17 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.17 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.17 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.16 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.16 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.16 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.15 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.15 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.12 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.11 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.11 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.1 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.1 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.09 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.09 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.03 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.02 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.99 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.98 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.97 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.96 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.93 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.92 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.91 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.91 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.9 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.9 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.87 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.86 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.85 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.82 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.81 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.8 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.79 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.78 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.76 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.75 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.7 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.58 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.29 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.25 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.22 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.21 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.14 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.03 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.01 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.01 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.88 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.85 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.76 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.69 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.46 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.45 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.44 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.41 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.37 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.19 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.99 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.95 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 96.93 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.91 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 96.9 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.71 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.51 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 96.26 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 95.33 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 94.14 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 85.48 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.58 E-value=1.1e-14 Score=101.06 Aligned_cols=70 Identities=30% Similarity=0.449 Sum_probs=32.3
Q ss_pred EEEecCcccc-ccCcccccCCCCcEEeccCCcCCccccccccCCCCCCEEeecCCCCCcccccCcCCCCCC
Q 046123 38 SFILEGTAIR-GLPASIELLSGSVLLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPETLGKVESL 107 (108)
Q Consensus 38 ~l~l~~~~~~-~~p~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~l~l~~~~~~~~~p~~~~~l~~L 107 (108)
.|++++|.+. .+|..+..+++|+.|++++|+..+.+|..++.+++|+++++++|+..+.+|..+++++++
T Consensus 233 ~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L~~L 303 (328)
T 4fcg_A 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPAN 303 (328)
T ss_dssp EEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGSCTT
T ss_pred EEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhccCc
Confidence 4444444333 333334444444444444444444444444444555555555544445555444444433
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 108 | ||||
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 |
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Leucine rich effector protein YopM domain: Leucine rich effector protein YopM species: Yersinia pestis [TaxId: 632]
Score = 38.3 bits (87), Expect = 6e-05
Identities = 14/67 (20%), Positives = 25/67 (37%), Gaps = 8/67 (11%)
Query: 41 LEGTAIRGLPASIELLSGSVLLNLKDCKNLKSLPSTINGLRSLRTLYLSGCSKLKNVPET 100
+ + LPA L L +L +P ++L+ L++ L+ P+
Sbjct: 291 VSNNKLIELPALPPRLE---RLIASFN-HLAEVPEL---PQNLKQLHVEYN-PLREFPDI 342
Query: 101 LGKVESL 107
VE L
Sbjct: 343 PESVEDL 349
|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.37 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.33 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.29 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.28 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.22 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.21 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.21 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.2 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.18 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.13 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.13 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.08 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.07 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.0 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.89 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.86 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.86 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.86 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.83 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.8 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.79 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.77 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.75 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.73 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.65 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.6 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.51 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.41 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.11 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.1 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.03 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.65 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.58 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.41 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.8 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.7 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.27 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.06 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 93.94 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 89.23 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.44 E-value=4.8e-13 Score=80.00 Aligned_cols=78 Identities=18% Similarity=0.165 Sum_probs=39.3
Q ss_pred CCcEEeccCCcCCCcCCcccCCccccccccCcceeEEEecCccccccCcccccCCCCcEEeccCCcCCcccc--ccccCC
Q 046123 3 SLKTLVLSGCLKLKKFPDIVGKSSQRKLQAGISSWSFILEGTAIRGLPASIELLSGSVLLNLKDCKNLKSLP--STINGL 80 (108)
Q Consensus 3 ~L~~L~l~~~~~~~~~p~~~~~~~~L~~~~~~~~~~l~l~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~~lp--~~~~~l 80 (108)
+|++|++++ +.++.+|+.++.+.+| + .+++++|.++.+| .+..+++|+.+++++ +.+..+| ..++.+
T Consensus 21 ~L~~L~ls~-N~l~~lp~~~~~l~~L---~-----~L~l~~N~i~~l~-~~~~l~~L~~L~l~~-N~i~~~~~~~~l~~~ 89 (124)
T d1dcea3 21 LVTHLDLSH-NRLRALPPALAALRCL---E-----VLQASDNALENVD-GVANLPRLQELLLCN-NRLQQSAAIQPLVSC 89 (124)
T ss_dssp TCCEEECCS-SCCCCCCGGGGGCTTC---C-----EEECCSSCCCCCG-GGTTCSSCCEEECCS-SCCCSSSTTGGGGGC
T ss_pred CCCEEECCC-CccCcchhhhhhhhcc---c-----ccccccccccccC-ccccccccCeEECCC-CccCCCCCchhhcCC
Confidence 455555555 3455555445555555 5 5555555555443 255555555555555 3344333 234455
Q ss_pred CCCCEEeecCC
Q 046123 81 RSLRTLYLSGC 91 (108)
Q Consensus 81 ~~L~~l~l~~~ 91 (108)
++|+++++++|
T Consensus 90 ~~L~~L~l~~N 100 (124)
T d1dcea3 90 PRLVLLNLQGN 100 (124)
T ss_dssp TTCCEEECTTS
T ss_pred CCCCEEECCCC
Confidence 55555555553
|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|