Citrus Sinensis ID: 046284

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------62
GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
ccccEEEEEEEcccccEEEEcHHHHcccccccEEEEEcccccccccHHHHcccccEEccccccccccccEEEEEccccccccccccccccccEEEccccccEEccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccEEEEEEcccccccccccccccEEEEEccccccccccEEEEEEEEEccccccccccccEEEEEEEEcccccccccccEEEEcccccccccccccEEEEEEEccccccccccEEEEEEEc
cccEEEEEEEEccccccccccHHHHHHccccEEEEEccccccccccHHHccccccEcccccHccccHHcEEEEccccccccccccccHHHHEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHcccccEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccHccccHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHcccccccEEccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHcHHcccEEEccccccccccccccccccEEEcccccccccccHHHHHHHHHcHcccHHcccccccccHHHHHHHcccHHHccccccccccccHccccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccccHHHcccccccEEEcccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEEccccccccccEEEEEEEEEEcccccccccEEcccccccccccccccEEEEEEcccccccccccccEEEEEc
GTDAIEGIFLDLskikrinldpgaftnmsnMRLLKFygieklpsmsieehlsyskvqlpngldylpkklrylhwdtyplrtlpsnfkpknlvALNLSCSKVEQLWEGEKNFKYLSALSFegckslrsfpsnlhfvcpvtINFSYCVNLIefplisgkvtslnlsksaieevpssieclTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTaitelpssfenlpgleelFVEDcskldklpdnignlKCLFIISAVGsaisqlpsssvaysNRLGVLYFSRCKglaylghldmrncavmeiPQEIACLSSlttlnlsgnsfesLPASIKQLSQLRSLHLEGCkmlqslpelplclesldltgcnmlrslpelplclhslnatncnrlqslpeipsCLQELDASVLEklskpspdlcewhpeyrlsqpiyfrftnclkldgkanNKILADSLRMAIAASLRRGKTIDEKLSELRRSQivlpgskipdwfsnqssgssiriqlpphsfcrnLIGFAFCAVLDFKQLYSDRfrnvyvgcrsdleiktlsetkhvhlsfdshsiedlidsdhvilgfkpclnvgfpdgyhhttvsl
GTDAIEGifldlskikrinldpgaftnmsNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRtlpsnfkpknlVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIeevpssiecltdlkklnLKYCKRLKRistrfcklrslVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSqivlpgskipdwFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIAClsslttlnlsgnsFESLPASIKQLSQLRSLHLEGCKMlqslpelplclesldlTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
****IEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKL****PDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTI**********QIVLPGSKIPDWF********IRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHH*****
GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
*TDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQSLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLEIKTLSETKHVHLSFDSHSIEDLIDSDHVILGFKPCLNVGFPDGYHHTTVSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query618 2.2.26 [Sep-21-2011]
Q9SZ671895 Probable WRKY transcripti no no 0.407 0.132 0.353 5e-39
Q9FH83 1288 Probable WRKY transcripti no no 0.737 0.354 0.287 3e-34
Q403921144 TMV resistance protein N N/A no 0.656 0.354 0.287 2e-32
O23530 1301 Protein SUPPRESSOR OF npr no no 0.582 0.276 0.296 2e-27
O825001095 Putative disease resistan no no 0.367 0.207 0.338 1e-24
Q9FL92 1372 Probable WRKY transcripti no no 0.415 0.187 0.277 5e-24
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.577 0.348 0.284 1e-18
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.415 0.159 0.25 1e-18
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.503 0.221 0.260 9e-13
Q96RT1 1412 Protein LAP2 OS=Homo sapi no no 0.487 0.213 0.264 1e-12
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  162 bits (411), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 156/317 (49%), Gaps = 65/317 (20%)

Query: 1    GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPN 60
            GT AIEGIFLD+  +K  + +P  F  M N+RLLK Y      S + E+H     V  P 
Sbjct: 1149 GTSAIEGIFLDMLNLK-FDANPNVFEKMCNLRLLKLY-----CSKAEEKH----GVSFPQ 1198

Query: 61   GLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEK----------- 109
            GL+YLP KLR LHW+ YPL +LP +F P+NLV LNL  S  ++LW+G+K           
Sbjct: 1199 GLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLE 1258

Query: 110  --------------------NFKYLSALSFEGCK------------------------SL 125
                                +   L  +  EGC                          L
Sbjct: 1259 KLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKL 1318

Query: 126  RSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLN 185
             + PS +       +N S C  L  FP IS  V  L +  + I+E+PSSI+ L  L+KL+
Sbjct: 1319 ENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLD 1378

Query: 186  LKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSS 245
            L+  + LK + T   KL+ L  L L+GC++LERFP+   +M+ L  ++L++T I ELPSS
Sbjct: 1379 LENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSS 1438

Query: 246  FENLPGLEELFVEDCSK 262
               L  L+EL   D  +
Sbjct: 1439 ISYLTALDELLFVDSRR 1455
Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query618
255563202 1158 leucine-rich repeat containing protein, 0.779 0.416 0.353 5e-78
359493273 1233 PREDICTED: TMV resistance protein N-like 0.868 0.435 0.334 2e-73
359486071 1261 PREDICTED: TMV resistance protein N-like 0.930 0.455 0.316 2e-73
451798988 1219 TMV resistance protein N-like protein 6 0.805 0.408 0.326 6e-71
359486075 1291 PREDICTED: TMV resistance protein N-like 0.928 0.444 0.320 2e-70
359487015 1610 PREDICTED: TMV resistance protein N-like 0.906 0.347 0.317 1e-69
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.928 0.405 0.319 2e-69
451798990 1335 TMV resistance protein N-like protein 7 0.813 0.376 0.319 6e-69
359486073 1296 PREDICTED: TMV resistance protein N-like 0.904 0.431 0.295 2e-67
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.902 0.388 0.323 2e-67
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  298 bits (764), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 203/574 (35%), Positives = 291/574 (50%), Gaps = 92/574 (16%)

Query: 1    GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPN 60
            GT+AI GI L +S+ +++ L+  AFT +SN++ L             E      KVQ P 
Sbjct: 565  GTEAIVGILLGMSEARKLELNRNAFTRISNLKFLILRMSNNCGGFEEE-----CKVQFPE 619

Query: 61   GLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEK------NFKYL 114
            GL+ LP++LRYL+W  YPL+ LP+NF P NL+ LN   S++E LWEG+K          L
Sbjct: 620  GLESLPQQLRYLYWHGYPLKFLPANFHPTNLIELNFPYSRLEGLWEGDKVPSSIGQLTKL 679

Query: 115  SALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSS 174
            + +S    K++RSFP+ +      T++ S C NL  FP +S  +  L L+++AI+EVP S
Sbjct: 680  TFMSLRCSKNIRSFPTTIDLQSLETLDLSGCSNLKIFPEVSRNIRYLYLNETAIQEVPLS 739

Query: 175  IECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINL 234
            IE L+ L  LN+K C  L+ I +   KL+SL  L L+GC  LE FPEILE   HL+ ++L
Sbjct: 740  IEHLSKLVVLNMKNCNELECIPSTIFKLKSLGVLILSGCKKLESFPEILETTNHLQHLSL 799

Query: 235  NKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSV 294
            ++TA+  LP +F NL  L  L   DCSKL KLP N+ NLK L  + A G  +S LP+   
Sbjct: 800  DETAMVNLPDTFCNLKALNMLNFSDCSKLGKLPKNMKNLKSLAELRAGGCNLSTLPA--- 856

Query: 295  AYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNSFESLPASI 354
                                               ++  LSS+  LNLSG++F+++PA I
Sbjct: 857  -----------------------------------DLKYLSSIVELNLSGSNFDTMPAGI 881

Query: 355  KQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPELPLCLHSLNATNCNRLQ 414
             QLS+LR +++ GCK LQSLPELP  +  L+   C  L S+               + L+
Sbjct: 882  NQLSKLRWINVTGCKRLQSLPELPPRIRYLNARDCRSLVSI---------------SGLK 926

Query: 415  SLPEIPSCLQELDASVLEKLSKPSPDLCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILA 474
             L E+  C   LD                            F FTNC KLD      ILA
Sbjct: 927  QLFEL-GCSNSLDDET-------------------------FVFTNCFKLDQDNWADILA 960

Query: 475  DSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIRIQ-LPPHSFC 533
             S ++ I       K  D +L +        PG++IP+WF+++S GSS+ IQ LPP    
Sbjct: 961  -SAQLKIQHFAMGRKHYDRELYDETFICFTYPGTEIPEWFADKSIGSSVTIQHLPPDWLN 1019

Query: 534  RNLIGFAFCAVLDFKQLYSDRFRNVYVGCRSDLE 567
               +GF+ C V+ F   +   +    V C+ + +
Sbjct: 1020 HRFLGFSVCLVVAFDDRFLCEYPRGVVACKCNFQ 1053

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487015|ref|XP_003633506.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query618
TAIR|locus:21584751217 RPS4 "RESISTANT TO P. SYRINGAE 0.511 0.259 0.308 9e-40
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.548 0.261 0.303 1e-39
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.729 0.379 0.295 1.1e-37
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.449 0.232 0.316 6.5e-37
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.631 0.309 0.296 9.1e-34
TAIR|locus:21533281231 AT5G45230 [Arabidopsis thalian 0.495 0.248 0.291 3.1e-33
TAIR|locus:20818101226 AT3G51570 [Arabidopsis thalian 0.511 0.257 0.283 3.1e-33
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.634 0.321 0.302 3.3e-33
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.466 0.151 0.351 4.7e-32
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.640 0.327 0.287 6.1e-32
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 9.0e-40, Sum P(2) = 9.0e-40
 Identities = 106/344 (30%), Positives = 165/344 (47%)

Query:     5 IEGIFLDLSKIK-RINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLD 63
             + GIFLDLS+++   +LD   F NM N+R LKFY      S   +E  + +K+ +P+ L 
Sbjct:   557 VRGIFLDLSEVEDETSLDRDHFINMGNLRYLKFYN-----SHCPQECKTNNKINIPDKLK 611

Query:    64 YLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCK 123
                K++R LHW  +PL TLP++F P NLV L L  S++EQLWEG+K+   L  +      
Sbjct:   612 LPLKEVRCLHWLKFPLETLPNDFNPINLVDLKLPYSEMEQLWEGDKDTPCLRWVDLNHSS 671

Query:   124 SLRSFPSNLHFVCPVT-INFSYCVNLIEFPLISGKVTSL---NLSK-SAIEEVPSSIECL 178
              L S  S L     +  +N   C  L  FP    K+  L   NL   +++E +P     L
Sbjct:   672 KLCSL-SGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFLNLKGCTSLESLPEMN--L 728

Query:   179 TDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTA 238
               LK L L  C   K        + +L   +L+G   + + P  +EK++ L  +N+    
Sbjct:   729 ISLKTLTLSGCSTFKEFPLISDNIETL---YLDGTA-ISQLPMNMEKLQRLVVLNMKDCK 784

Query:   239 -ITELPSSFENLPGLEELFVEDCSKLDKLPD-NIGNLKCLFIISAVGSAISQLPSSS--- 293
              + E+P     L  L+EL + DC  L   P+ +I  L  L +       + QLPS     
Sbjct:   785 MLEEIPGRVGELKALQELILSDCLNLKIFPEIDISFLNILLLDGTAIEVMPQLPSVQYLC 844

Query:   294 VAYSNRLGVLYFSRCKGLAYLGHLDMRNC----AVMEIPQEIAC 333
             ++ + ++  L     + L+ L  LD++ C    +V E P  + C
Sbjct:   845 LSRNAKISCLPVGISQ-LSQLKWLDLKYCTSLTSVPEFPPNLQC 887
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006952 "defense response" evidence=IEA;ISS;TAS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0004872 "receptor activity" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0012505 "endomembrane system" evidence=IDA
GO:0009870 "defense response signaling pathway, resistance gene-dependent" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0042742 "defense response to bacterium" evidence=IDA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-49
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-07
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 7e-07
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  186 bits (473), Expect = 1e-49
 Identities = 170/608 (27%), Positives = 259/608 (42%), Gaps = 162/608 (26%)

Query: 1    GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPN 60
            GT  + GI LD+ +I  +++   AF  M N+  LKFY  +      +  HL       P 
Sbjct: 530  GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHL-------PE 582

Query: 61   GLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFE 120
            G DYLP KLR L WD YPLR +PSNF+P+NLV L +  SK+E+LW+G  +   L  +   
Sbjct: 583  GFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLR 642

Query: 121  GCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTSLNLSK-SAIEEVPSSIECLT 179
            G K+L+  P           + S   NL           +L LS  S++ E+PSSI+ L 
Sbjct: 643  GSKNLKEIP-----------DLSMATNL----------ETLKLSDCSSLVELPSSIQYLN 681

Query: 180  DLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAI 239
             L+ L++  C+ L+ + T    L+SL  L L+GC  L+ FP+I              T I
Sbjct: 682  KLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI-------------STNI 727

Query: 240  TELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNR 299
            + L                                    +    +AI + PS+       
Sbjct: 728  SWL-----------------------------------DLD--ETAIEEFPSNL------ 744

Query: 300  LGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACL-----SSLTTLNLSGN-SFESLPAS 353
                   R + L  L   +M++  + E  Q +  L      SLT L LS   S   LP+S
Sbjct: 745  -------RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSS 797

Query: 354  IKQLSQLRSLHLEGCKMLQSLP---ELPLCLESLDLTGCNMLRSLP-------------- 396
            I+ L +L  L +E C  L++LP    L   LESLDL+GC+ LR+ P              
Sbjct: 798  IQNLHKLEHLEIENCINLETLPTGINLES-LESLDLSGCSRLRTFPDISTNISDLNLSRT 856

Query: 397  ---ELPLC------LHSLNATNCNRLQSLPEIPSCLQEL---DASVLEKLSKPSPD---- 440
               E+P        L  L+   CN LQ +    S L+ L   D S    L++ S +    
Sbjct: 857  GIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPS 916

Query: 441  ---LCEWHPEYRLSQPIYFRFTNCLKLDGKANNKILADSLRMAIAASLRRGKTIDEKLSE 497
               +   +   +L   +   F NC  LD +A                L + ++I +    
Sbjct: 917  EVAMATDNIHSKLPSTVCINFINCFNLDQEA----------------LLQQQSIFK---- 956

Query: 498  LRRSQIVLPGSKIPDWFSNQSSGSS-IRIQLPPHSFCRNLIGFAFCAVLDFKQLYSDRFR 556
                Q++L G ++P +F+++++G+S   I L   S C+    F  CAV+D +  +     
Sbjct: 957  ----QLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVS 1012

Query: 557  -NVYVGCR 563
             ++ V CR
Sbjct: 1013 FDIQVCCR 1020

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 618
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN032101153 Resistant to P. syringae 6; Provisional 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.32
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.91
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.88
PRK15386426 type III secretion protein GogB; Provisional 98.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.67
PLN03150623 hypothetical protein; Provisional 98.61
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.6
PLN03150623 hypothetical protein; Provisional 98.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
KOG4341483 consensus F-box protein containing LRR [General fu 98.36
PRK15386426 type III secretion protein GogB; Provisional 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
KOG4341483 consensus F-box protein containing LRR [General fu 98.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.2
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.74
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.56
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.44
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.87
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.7
KOG4308478 consensus LRR-containing protein [Function unknown 92.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.19
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 89.71
KOG4308478 consensus LRR-containing protein [Function unknown 89.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.54
smart0037026 LRR Leucine-rich repeats, outliers. 88.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.25
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.51
smart0037026 LRR Leucine-rich repeats, outliers. 85.51
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.65
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.67
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=1.2e-49  Score=469.22  Aligned_cols=463  Identities=32%  Similarity=0.572  Sum_probs=359.9

Q ss_pred             CCCceeEEEeecccccccccCchhhccCccceEEEEeCCCCCCCCccccccccceEEcCCCCcCCCcCceEEEeCCCCCC
Q 046284            1 GTDAIEGIFLDLSKIKRINLDPGAFTNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLR   80 (618)
Q Consensus         1 G~~~i~~i~Ldls~~~~~~l~~~~f~~l~~Lr~L~l~~n~~l~~~~~~~~~~~~~~~l~~~l~~l~~~L~~L~l~~~~l~   80 (618)
                      ||++|+||++|++..+...+.+.+|.+|++|++|+++.+..       ........++|+++..+|.+||+|+|.+|+++
T Consensus       530 g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~-------~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~  602 (1153)
T PLN03210        530 GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW-------DQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLR  602 (1153)
T ss_pred             ccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccc-------cccccceeecCcchhhcCcccEEEEecCCCCC
Confidence            78999999999999998999999999999999999987542       01123346889999999999999999999999


Q ss_pred             ccCCCCCCCCceEEEccCCCceeccccccccccCcEEeccCCCCCcccCCCCCCCCCcEEeccCCCCCCcCCCCCCCccE
Q 046284           81 TLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPLISGKVTS  160 (618)
Q Consensus        81 ~lp~~~~l~~L~~L~L~~n~i~~l~~~~~~l~~L~~L~Ls~~~~l~~lp~~~~l~~L~~L~l~~~~~l~~~~~~~~~L~~  160 (618)
                      .+|..|.+.+|++|+|++|+++.+|.++..+++|+.|+|++|..++.+|++..+++|++|++++|..+            
T Consensus       603 ~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L------------  670 (1153)
T PLN03210        603 CMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSL------------  670 (1153)
T ss_pred             CCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCc------------
Confidence            99999999999999999999999999999999999999999999999999999999999999999877            


Q ss_pred             EEccCCCCcccCccccCCCCCcEEecccCcCccchhhhccCCCCCcEEecCCccCccccchhhhCCCCCCEEEecCcCCc
Q 046284          161 LNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAIT  240 (618)
Q Consensus       161 L~L~~n~i~~l~~~i~~l~~L~~L~L~~~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~n~i~  240 (618)
                              .++|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..++.+|..   ..+|++|++++|.++
T Consensus       671 --------~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~  738 (1153)
T PLN03210        671 --------VELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIE  738 (1153)
T ss_pred             --------cccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccc
Confidence                    6778888999999999999999999999866 6999999999999988887764   467899999999999


Q ss_pred             cCCccCCCCCCCCEEEeccCCCccccCcccCCCccceEEEecCcccccCCcchhhccCCCceEecCCCCCCCCCCeEecc
Q 046284          241 ELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMR  320 (618)
Q Consensus       241 ~lp~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~~l~~L~~L~L~  320 (618)
                      .+|..+ .+++|++|.+.++.... ++..+..+                +....              ..+++|+.|+++
T Consensus       739 ~lP~~~-~l~~L~~L~l~~~~~~~-l~~~~~~l----------------~~~~~--------------~~~~sL~~L~Ls  786 (1153)
T PLN03210        739 EFPSNL-RLENLDELILCEMKSEK-LWERVQPL----------------TPLMT--------------MLSPSLTRLFLS  786 (1153)
T ss_pred             cccccc-cccccccccccccchhh-cccccccc----------------chhhh--------------hccccchheeCC
Confidence            998765 57888888887754221 11111110                00000              023567777777


Q ss_pred             CCCC-CcCCccccCCCCCCEEeCCCC-CCccCcccccCCcccceeeccccccCCcCCCCCCCccEEeccCCCCCCcCCCC
Q 046284          321 NCAV-MEIPQEIACLSSLTTLNLSGN-SFESLPASIKQLSQLRSLHLEGCKMLQSLPELPLCLESLDLTGCNMLRSLPEL  398 (618)
Q Consensus       321 ~n~l-~~~p~~l~~l~~L~~L~Ls~n-~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~l~~~L~~L~l~~c~~l~~l~~~  398 (618)
                      +|.. .++|..++++++|+.|++++| .+..+|..+ .+++|+.|++++|..++.+|..+.+|+.|+++++ .++.+|..
T Consensus       787 ~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n-~i~~iP~s  864 (1153)
T PLN03210        787 DIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNISDLNLSRT-GIEEVPWW  864 (1153)
T ss_pred             CCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCccccccccccccCEeECCCC-CCccChHH
Confidence            7643 347777888888888888876 466777655 6788888888888888888887788888888776 44556643


Q ss_pred             ---ccccccccccccccccCCCCCCc---cccccchhhhcccCCCCCccccc------CC-ccccCCCeEEEEccccccC
Q 046284          399 ---PLCLHSLNATNCNRLQSLPEIPS---CLQELDASVLEKLSKPSPDLCEW------HP-EYRLSQPIYFRFTNCLKLD  465 (618)
Q Consensus       399 ---~~~L~~L~i~~c~~l~~l~~~p~---~L~~L~~~~~~~L~~~~~~~~~~------~~-~~~~~~~~~l~~~nC~kL~  465 (618)
                         +++|+.|++.+|++++.+|..+.   .|+.+++.+|.+|+.........      .. ...++....+.|.||++|+
T Consensus       865 i~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~  944 (1153)
T PLN03210        865 IEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLD  944 (1153)
T ss_pred             HhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCC
Confidence               45677777778888887776443   34556777787776543211100      00 0011122346899999999


Q ss_pred             hhhHhHHHHHHHHHHHHHhhccccchhhhhccccceEEEecCCCCCCCcccCCCCCeEE-EEcCCCCCCCCcceeEEEEE
Q 046284          466 GKANNKILADSLRMAIAASLRRGKTIDEKLSELRRSQIVLPGSKIPDWFSNQSSGSSIR-IQLPPHSFCRNLIGFAFCAV  544 (618)
Q Consensus       466 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~~~~g~sv~-~~lp~~~~~~~~~g~~~c~v  544 (618)
                      +.+...                        +......+++||.+||+||+||+.|++++ |.+|+.|++..|.||++|+|
T Consensus       945 ~~a~l~------------------------~~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v 1000 (1153)
T PLN03210        945 QEALLQ------------------------QQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAV 1000 (1153)
T ss_pred             chhhhc------------------------ccccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEE
Confidence            766311                        11123468899999999999999999998 99999999889999999999


Q ss_pred             EecCCccc
Q 046284          545 LDFKQLYS  552 (618)
Q Consensus       545 ~~~~~~~~  552 (618)
                      ++++....
T Consensus      1001 ~~~~~~~~ 1008 (1153)
T PLN03210       1001 VDSESFFI 1008 (1153)
T ss_pred             EecCcccc
Confidence            99876533

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 7e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 7e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 8/156 (5%)
Query: 214 VNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNL 273
           V L +FP+   ++ HL+   ++   + ELP + +   GLE L +   + L  LP +I +L
Sbjct: 91  VPLPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASL 149
Query: 274 KCLFIISAVG-SAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIA 332
             L  +S      +++LP   +A ++  G       +GL  L  L +    +  +P  IA
Sbjct: 150 NRLRELSIRACPELTELP-EPLASTDASG-----EHQGLVNLQSLRLEWTGIRSLPASIA 203
Query: 333 CXXXXXXXXXXXXXFESLPASIKQLSQLRSLHLEGC 368
                           +L  +I  L +L  L L GC
Sbjct: 204 NLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGC 239
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query618
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-28
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  169 bits (430), Expect = 9e-48
 Identities = 65/328 (19%), Positives = 118/328 (35%), Gaps = 45/328 (13%)

Query: 110 NFKYLSALSFEGCKSLRSFPSNLH-FVCPVTINFSYCVNLIEFPLISGKVTSLNLSKSAI 168
           +      L F+G  +LR +   L  +      + +   +       +        +  A+
Sbjct: 10  HSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN-NPQIETRTGRAL 68

Query: 169 EEVPSSIECLTD--LKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKM 226
           +     +E  T      L L+    L +   +  +L  L  + ++    L   P+ +++ 
Sbjct: 69  KATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQQF 126

Query: 227 EHLERINLNKTAITELPSSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAI 286
             LE + L +  +  LP+S  +L  L EL +  C +L +LP+ + +              
Sbjct: 127 AGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQ------ 180

Query: 287 SQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCAVMEIPQEIACLSSLTTLNLSGNS 346
                                  GL  L  L +    +  +P  IA L +L +L +  + 
Sbjct: 181 -----------------------GLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP 217

Query: 347 FESLPASIKQLSQLRSLHLEGCKMLQSLPE----LPLCLESLDLTGCNMLRSLPE----L 398
             +L  +I  L +L  L L GC  L++ P         L+ L L  C+ L +LP     L
Sbjct: 218 LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA-PLKRLILKDCSNLLTLPLDIHRL 276

Query: 399 PLCLHSLNATNCNRLQSLPEIPSCLQEL 426
              L  L+   C  L  LP + + L   
Sbjct: 277 T-QLEKLDLRGCVNLSRLPSLIAQLPAN 303
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query618
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.76
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.53
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.1
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.93
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.07
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.82
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.21
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.68
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-38  Score=363.37  Aligned_cols=382  Identities=18%  Similarity=0.151  Sum_probs=246.6

Q ss_pred             EeecccccccccCchhh-ccCccceEEEEeCCCCC----------CCCccccccccce--EEcCCCCcCCCcCceEEEeC
Q 046284            9 FLDLSKIKRINLDPGAF-TNMSNMRLLKFYGIEKL----------PSMSIEEHLSYSK--VQLPNGLDYLPKKLRYLHWD   75 (618)
Q Consensus         9 ~Ldls~~~~~~l~~~~f-~~l~~Lr~L~l~~n~~l----------~~~~~~~~~~~~~--~~l~~~l~~l~~~L~~L~l~   75 (618)
                      +||+++|.+....+..+ .++++|++|++++|.+.          ..+..+...+...  ..-......+ .+|++|+++
T Consensus       130 ~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l-~~L~~L~Ls  208 (768)
T 3rgz_A          130 FLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRC-VNLEFLDVS  208 (768)
T ss_dssp             EEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTC-TTCCEEECC
T ss_pred             EEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccC-CcCCEEECc
Confidence            45666665543333333 56666666666666541          1111111111110  1111122444 489999999


Q ss_pred             CCCCCccCCCC-CCCCceEEEccCCCcee-ccccccccccCcEEeccCCCCCcccCCCCCCCCCcEEeccCCCCCCcCCC
Q 046284           76 TYPLRTLPSNF-KPKNLVALNLSCSKVEQ-LWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFPL  153 (618)
Q Consensus        76 ~~~l~~lp~~~-~l~~L~~L~L~~n~i~~-l~~~~~~l~~L~~L~Ls~~~~l~~lp~~~~l~~L~~L~l~~~~~l~~~~~  153 (618)
                      +|.+...+..+ .+++|++|++++|+++. +|..+..+++|++|++++|.....+|.. .+++|++|++++|.....+|.
T Consensus       209 ~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~  287 (768)
T 3rgz_A          209 SNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPD  287 (768)
T ss_dssp             SSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCC
T ss_pred             CCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCH
Confidence            99987644336 78999999999999984 6788899999999999999865566665 889999999999876556665


Q ss_pred             CC----CCccEEEccCCCCc-ccCccccCCCCCcEEecccCcCccchhhh-ccCCCCCcEEecCCccCccccchhhhCCC
Q 046284          154 IS----GKVTSLNLSKSAIE-EVPSSIECLTDLKKLNLKYCKRLKRISTR-FCKLRSLVDLFLNGCVNLERFPEILEKME  227 (618)
Q Consensus       154 ~~----~~L~~L~L~~n~i~-~l~~~i~~l~~L~~L~L~~~~~~~~l~~~-~~~l~~L~~L~L~~~~~~~~~~~~~~~l~  227 (618)
                      .+    .+|++|++++|.+. .+|..++.+++|++|++++|.+.+.+|.. +.++++|++|++++|.+.+.+|..+..++
T Consensus       288 ~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~  367 (768)
T 3rgz_A          288 FLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLS  367 (768)
T ss_dssp             CSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHT
T ss_pred             HHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhh
Confidence            43    67899999999987 66788899999999999999888777765 88899999999999888878887777766


Q ss_pred             -CCCEEEecCcCCc-cCCccCCC--CCCCCEEEeccCCCccccCcccCCCccceEEEecCcccccCCcchhhccCCCceE
Q 046284          228 -HLERINLNKTAIT-ELPSSFEN--LPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVL  303 (618)
Q Consensus       228 -~L~~L~L~~n~i~-~lp~~l~~--l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L  303 (618)
                       +|++|++++|.++ .+|..+..  +++|++|++++|.+.+.+|..++.+++|+.|++++|.++...+..+..+++|+.|
T Consensus       368 ~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L  447 (768)
T 3rgz_A          368 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL  447 (768)
T ss_dssp             TTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             cCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEE
Confidence             7777777777666 34544444  5566666666666655666666666666666666666654444444455555655


Q ss_pred             ecCCCC----------CCCCCCeEeccCCCCCc-CCccccCCCCCCEEeCCCCCCc-cCcccccCCcccceeeccccccC
Q 046284          304 YFSRCK----------GLAYLGHLDMRNCAVME-IPQEIACLSSLTTLNLSGNSFE-SLPASIKQLSQLRSLHLEGCKML  371 (618)
Q Consensus       304 ~l~~~~----------~l~~L~~L~L~~n~l~~-~p~~l~~l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~~~~l  371 (618)
                      ++++|.          .+++|++|++++|.+.. +|..+..+++|+.|++++|+++ .+|.+++.+++|++|+|++|+..
T Consensus       448 ~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~  527 (768)
T 3rgz_A          448 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFS  527 (768)
T ss_dssp             ECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             ECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCccc
Confidence            555543          34455555555555553 4555555555555555555555 44555555555555555555544


Q ss_pred             CcCCCC---CCCccEEeccCCCCC
Q 046284          372 QSLPEL---PLCLESLDLTGCNML  392 (618)
Q Consensus       372 ~~lp~l---~~~L~~L~l~~c~~l  392 (618)
                      +.+|..   .++|+.|++++|+..
T Consensus       528 ~~~p~~l~~l~~L~~L~Ls~N~l~  551 (768)
T 3rgz_A          528 GNIPAELGDCRSLIWLDLNTNLFN  551 (768)
T ss_dssp             EECCGGGGGCTTCCEEECCSSEEE
T ss_pred             CcCCHHHcCCCCCCEEECCCCccC
Confidence            444421   234555555555443
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 618
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-11
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 61.2 bits (147), Expect = 8e-11
 Identities = 55/306 (17%), Positives = 117/306 (38%), Gaps = 41/306 (13%)

Query: 79  LRTLPSNFKPKNLVALNLSCSKVEQLWEGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPV 138
           L  +P +  P +   L+L  +K+ ++ +G+  FK L  L      +L    + +  + P 
Sbjct: 22  LEKVPKDL-PPDTALLDLQNNKITEIKDGD--FKNLKNL-----HTLILINNKISKISPG 73

Query: 139 TINFSYCVNLIEFPLISGKVTSLNLSKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTR 198
              F+  V L            L LSK+ ++E+P  +       +++     ++++    
Sbjct: 74  A--FAPLVKL----------ERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFN 121

Query: 199 FCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELPSSFENLPGLEELFVE 258
                 +V+L  N   +        + M+ L  I +  T IT +P      P L EL ++
Sbjct: 122 GLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGL--PPSLTELHLD 179

Query: 259 DCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCK--------- 309
                     ++  L  L  +    ++IS + + S+A +  L  L+ +  K         
Sbjct: 180 GNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLA 239

Query: 310 GLAYLGHLDMRNCAVMEIPQEIAC-------LSSLTTLNLSGN---SFESLPASIKQLSQ 359
              Y+  + + N  +  I     C        +S + ++L  N    +E  P++ + +  
Sbjct: 240 DHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYV 299

Query: 360 LRSLHL 365
             ++ L
Sbjct: 300 RAAVQL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query618
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.96
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.18
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.31
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.93  E-value=9e-25  Score=226.60  Aligned_cols=319  Identities=16%  Similarity=0.198  Sum_probs=223.6

Q ss_pred             ccCccceEEEEeCCCCCCCCccccccccceEEcCCCCcCCCcCceEEEeCCCCCCccCCCCCCCCceEEEccCCCceecc
Q 046284           26 TNMSNMRLLKFYGIEKLPSMSIEEHLSYSKVQLPNGLDYLPKKLRYLHWDTYPLRTLPSNFKPKNLVALNLSCSKVEQLW  105 (618)
Q Consensus        26 ~~l~~Lr~L~l~~n~~l~~~~~~~~~~~~~~~l~~~l~~l~~~L~~L~l~~~~l~~lp~~~~l~~L~~L~L~~n~i~~l~  105 (618)
                      +.+.+|+.|+++++.+              ..+ +++..+ ++|++|++++|.++.+|..-++++|++|++++|.++.++
T Consensus        41 ~~l~~l~~L~l~~~~I--------------~~l-~gl~~L-~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~  104 (384)
T d2omza2          41 TDLDQVTTLQADRLGI--------------KSI-DGVEYL-NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT  104 (384)
T ss_dssp             HHHTTCCEEECCSSCC--------------CCC-TTGGGC-TTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG
T ss_pred             HHhCCCCEEECCCCCC--------------CCc-cccccC-CCCCEEeCcCCcCCCCccccCCccccccccccccccccc
Confidence            4567788888888764              233 456666 488888888888888876447888888888888888775


Q ss_pred             ccccccccCcEEeccCCCCCcccCCCCCCCCCcEEeccCCCCCCcCC----------------------CCCCCccEEEc
Q 046284          106 EGEKNFKYLSALSFEGCKSLRSFPSNLHFVCPVTINFSYCVNLIEFP----------------------LISGKVTSLNL  163 (618)
Q Consensus       106 ~~~~~l~~L~~L~Ls~~~~l~~lp~~~~l~~L~~L~l~~~~~l~~~~----------------------~~~~~L~~L~L  163 (618)
                       .+..+++|+.|+++++. ...++.......+..+....+.......                      ...........
T Consensus       105 -~l~~l~~L~~L~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  182 (384)
T d2omza2         105 -PLANLTNLTGLTLFNNQ-ITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDI  182 (384)
T ss_dssp             -GGTTCTTCCEEECCSSC-CCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEEC
T ss_pred             -ccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccchhhhhccccccccccc
Confidence             37788888888888776 4445444455555555444321100000                      00011122222


Q ss_pred             cCCCCcccCccccCCCCCcEEecccCcCccchhhhccCCCCCcEEecCCccCccccchhhhCCCCCCEEEecCcCCccCC
Q 046284          164 SKSAIEEVPSSIECLTDLKKLNLKYCKRLKRISTRFCKLRSLVDLFLNGCVNLERFPEILEKMEHLERINLNKTAITELP  243 (618)
Q Consensus       164 ~~n~i~~l~~~i~~l~~L~~L~L~~~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~n~i~~lp  243 (618)
                      ..+.. ........+++++.+++++|.+.+..|  ....++|++|++++|.+.. + ..+..+++|+.|++++|.++.++
T Consensus       183 ~~~~~-~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~-~-~~l~~l~~L~~L~l~~n~l~~~~  257 (384)
T d2omza2         183 SSNKV-SDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKD-I-GTLASLTNLTDLDLANNQISNLA  257 (384)
T ss_dssp             CSSCC-CCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCC-C-GGGGGCTTCSEEECCSSCCCCCG
T ss_pred             ccccc-ccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCC-c-chhhcccccchhccccCccCCCC
Confidence            22222 223456678889999999987766544  4557889999999987654 2 35778899999999999988876


Q ss_pred             ccCCCCCCCCEEEeccCCCccccCcccCCCccceEEEecCcccccCCcchhhccCCCceEecCCCCCCCCCCeEeccCCC
Q 046284          244 SSFENLPGLEELFVEDCSKLDKLPDNIGNLKCLFIISAVGSAISQLPSSSVAYSNRLGVLYFSRCKGLAYLGHLDMRNCA  323 (618)
Q Consensus       244 ~~l~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~~~~l~~L~~L~L~~n~  323 (618)
                      . ++.+++|++|++++|...+..  .+..++.++.+++..|.++.++...                .+++++.|++++|+
T Consensus       258 ~-~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~~~~----------------~~~~l~~L~ls~n~  318 (384)
T d2omza2         258 P-LSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDISPIS----------------NLKNLTYLTLYFNN  318 (384)
T ss_dssp             G-GTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCGGGG----------------GCTTCSEEECCSSC
T ss_pred             c-ccccccCCEeeccCcccCCCC--ccccccccccccccccccccccccc----------------hhcccCeEECCCCC
Confidence            5 778899999999988765432  3678888999999988887654321                56778888888888


Q ss_pred             CCcCCccccCCCCCCEEeCCCCCCccCcccccCCcccceeeccccccCCcCCC--CCCCccEEeccCC
Q 046284          324 VMEIPQEIACLSSLTTLNLSGNSFESLPASIKQLSQLRSLHLEGCKMLQSLPE--LPLCLESLDLTGC  389 (618)
Q Consensus       324 l~~~p~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~~~~l~~lp~--l~~~L~~L~l~~c  389 (618)
                      +.+++ .+..+++|++|++++|+++.++ .+..+++|++|++++|+.. .++.  -.++|+.|++++|
T Consensus       319 l~~l~-~l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~-~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         319 ISDIS-PVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQIS-DLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             CSCCG-GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCC-BCGGGTTCTTCSEEECCCE
T ss_pred             CCCCc-ccccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCC-CChhhccCCCCCEeeCCCC
Confidence            88775 3777888888898888888877 5888888888988888644 4432  2358888888875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure